3OLLA

Crystal structure of phosphorylated estrogen receptor beta ligand binding domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
237
structure length
234
Chain Sequence
ALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATADSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVDLLLEMLNAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Synthesis and crystal structure of a phosphorylated estrogen receptor ligand binding domain.
pubmed doi rcsb
molecule keywords Estrogen receptor beta
molecule tags Hormone receptor/activator
source organism Homo sapiens
total genus 89
structure length 234
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3ollA00
4OH5A 1OT7A 2GPPA 5APHA 2XYWA 3H0AD 3VT5A 3L0EA 4RUPA 4RMEA 4F9MA 3A40X 5DU5A 2ZMHA 3ZRAA 3PRGA 5DKBA 3K23A 3OKHA 5CJ6A 4ZNWA 3OLFA 3OAPA 4S0TA 4QE6A 5AWKA 2G0GA 1R5KA 5L7GA 5DK9A 3VT7A 2P7AA 2Q5GA 4YNKA 2YLPA 2FVJA 2VV4B 1NQ7A 3W0CA 1RDTD 4NIEA 2QA8B 4UDDA 5EHJA 5L7HA 1QKMA 5DXKA 1RDTA 1FD0A 3SZ1A 3U9QA 2QMVA 2ZK5A 4G21A 4DOSA 3G0WA 5C4SA 5G5WA 2VV0A 5E1CA 5FQVA 3IXPD 4A4VA 4YPQA 5KRJA 2PIWA 4R06A 5DZ0A 3D57A 3B0TA 3CS6A 3IXPA 1OVLA 4IVYA 5JJMA 1H9UA 3KDUA 2YJAB 3GZ9A 3HQ5A 3R8AA 1ZAFA 3V4AA 3VRWA 2I0JA 3VRUA 5DXGA 3KYTA 2ZXNA 3DT3A 4PLDA 1YOKA 3F7DA 3L0LA 4OK1A 5KRKA 5KRIA 3X36A 3B3KA 4ZN9A 1XV9B 4Q13A 5DP0A 3VTBA 4RMCA 5HZCA 1PDUA 1I7GA 5LGAA 5K13A 3PBAA 5DYDA 5AVIA 4M8EA 3B5RA 2JFAA 4WHGA 3VT3A 5L7EA 1U9EA 4P6WA 4REEA 4G2IA 2HB8A 5AAVA 2AAXA 3UUAB 2AM9A 3V3QA 1U3RA 4ZNSA 4YMQA 2HVCA 4FHIA 5G45A 5IZ0A 2Q8SA 4MG8A 2I4ZA 3A9EA 3OLLA 3X1IA 4IS8A 1GS4A 3W0YA 3P0UA 1Z95A 4ZI1A 4G2HA 3AX8A 5B41A 5HJPB 2AO6A 5DRJA 5APJA 1T79A 1X7RA 5JY3A 2G0HA 3FURA 4N73A 5E0WA 5DLRA 4RZFA 3HM1A 4E4QA 1S19A 5KD9A 4CSJA 3UUCA 3VHWA 3KFCA 2HAMA 4ZJRA 2H77A 3A78A 4JGVA 2F4BA 4POJA 1I7IA 1K74D 2P54A 4IQRA 2B1ZA 3OZ0A 2AB2A 2REWA 2QA8A 2GIUA 1LV2A 3T03A 1ZKYA 1K74A 4J24A 5KRHA 2Q6JA 1PRGA 4ONIA 1XP9A 2BAWA 2P15A 3GBKA 4RUJA 5DKGA 4B7WA 3UP3A 2ZK4A 3B65A 3KMGA 1PQ9A 2OVMA 2ZVTA 4OFUA 2PITA 2AX9A 2AYRA 3HVLA 3VHVA 4APUA 4PWLA 4PXMA 5DXPA 3ADXA 5EITA 4J5XA 1A28A 5GT4A 1FM9D 1NAVA 2VSTA 5DUEA 2GPVA 3G8IA 3UU7B 2QW4A 4QK4A 2ZMJA 1FM9A 1PQCA 1YJEA 1XPCA 2V7CA 3NSQA 4OKTA 5C4UA 1QKTA 1T7MA 3FC6B 1UPWA 5IAWA 1XV9A 1P8DA 2B23A 3PO9A 5EGVA 4NB6A 1G50A 3HC5A 3R2AA 3ADSA 1EXAA 4ZN7A 3B1MA 4OGHA 3HO0A 3R8DA 2AWHA 2J7YA 3RUUA 3CDPA 4X1FA 5KCEA 3OS8C 2J4AA 2OVHA 2HB7A 2P1UA 4FGYA 4ITFA 2VV2A 5DY8A 2ZK0A 2LBDA 3ILZA 3VSOA 5HYRA 4PPPA 4N1YA 5G46A 3L1BA 2QE4A 2QA6A 3ADUA 2HWRA 4JYIA 2G44A 4KZJA 5DYBA 5HJPA 1KNUA 3RVFA 2AXAA 3CWDA 5ACCA 3HZFA 1IE8A 3PLZA 4OH6A 2QTUA 3B0QA 1R20D 2FAIA 2YLQA 1YY4A 3KWYA 2ACLB 2AA6A 2Q70A 4J26A 3AUNA 4R2UA 1T73A 5KR9A 3CS4A 4IW8A 1M2ZA 4NY9A 1R20A 3V9TA 1DKFB 1FCYA 4OJ4A 3WT7A 1NAXA 2E2RA 4MG9B 3RLLA 4Q50A 2GL8A 3W0IA 1E3KA 1T65A 4OKXA 3H0AA 2Q59B 5DXRA 4HLWA 3FALB 5AZTA 2QGWA 2ZK1A 3ADVA 3IPQA 1FBYA 2R40D 5KCFA 5DIDA 5DXMA 3CQVA 5DI7A 1T5ZA 2R40A 3IA6A 4QM0A 4N5GA 4Q0AC 3VRVA 3UUDB 4OZRE 1NRLA 2PRGA 3AZ2A 5KCDA 1T74A 4ZO1X 3HC6A 2OCFA 4OLMA 2FSZA 2QXMA 1R6GA 1Y0XX 4MGDB 2B1VA 5DIGA 3KBAA 5DKEA 2PIVA 5DZ3A 1YINA 5G42A 3OSAA 2XHSA 1YA3A 2ZNOA 1SR7A 4PP5A 1KV6A 1EXXA 4LSJA 3B68A 2Q7JA 2Q3YA 3A2HA 3VJHA 3ADWA 4FNEA 1XQCA 2IOGA 3FEIA 3UU7A 1XP6A 2GP7A 3SP9A 1XVPB 4K6IA 4NUFA 2PNUA 3FC6A 4ZNVA 2VV1B 2POBA 4PLEA 2AA2A 4TUZA 3B66A 5DTVA 1S0XA 3FEJA 5LWPA 3VJSA 4QL8A 3R8IA 5DV6A 5E14A 3M7RA 3OGTA 1Q4XA 3ET0A 1X78A 5AYGA 1KKQA 2O4RA 1GWRA 3E00D 1K7LA 5G43A 3HODA 3W0AA 3IPUA 2ZXMA 1X76A 3Q95B 5DSHA 5AWJA 5AZVA 2GTKA 3E00A 1TFCA 2PIRA 5AK2A 2PIXA 4OEYA 3TKMA 2Q1VA 2ZK2A 2JF9A 2W8YA 3W0GA 2HASA 1ILGA 1G2NA 1OSVA 1ERRA 2OM9A 2POGA 2Z4JA 3KDTA 3WJ4A 4XLDA 4MGBB 4RE8A 4DORA 1PZLA 2ZNPA 3DY6A 4CI5A 3OLSA 4X1GA 4IA7A 4KZMA 1I37A 2HCDA 2Q1HA 1FCZA 1HJ1A 3V9VA 1EREA 4FN9A 4MG9A 3VTDA 4IW6A 5EJVA 2OUZA 3O1DA 4MGCA 4MGAB 5SYZA 2ZMIA 3FALA 1ILHA 5KCWA 3P88A 3UVVB 4XHDA 3G8OA 5E0XA 3JZBA 3DZYD 3KMRA 3UUDA 2VV4A 2ZK3A 4XT9A 1XDKB 3RLJA 1GWQA 1PQ6A 1PCGA 2NV7A 5DXEA 1G1UA 3VHUA 2Q7IA 1N46A 1NHZA 3CS8A 4ZNUA 1YOWA 2PIOA 5IXKA 1ZEOA 4IA2A 1XAPA 4PP6A 5L11A 4CI4A 1SJ0A 3ADTA 2JJ3A 4IV2A 1Y0SA 2Q61A 3K22A 3MNEA 1QKNA 4PP3A 3TY0A 3EYBA 1T63A 4OARA 1Z5XE 3A3ZX 2OZ7A 2NW4A 2P1TA 3MNOA 4J5WA 1UPVA 4OILA 3WT6A 5AAUA 2PIQA 1ZDTA 3WWRA 4P6XA 3GYUA 3WTQA 3ZRBA 3X1HA 4OJ9A 3VSPA 2R6YA 2GWXA 3OOKA 4FHHA 2J7XA 4UDBA 5DL4A 5E19A 5FQRA 4A2JA 3AUQA 5GIEA 4K4JA 2HBHA 4XTAA 2ZL9A 3ET2A 1XNXA 3L0JA 5FQTA 1S9PA 2G5OA 2Q7LA 3OMPA 4S15A 4NQAB 1XNNA 3GWXA 3BC5A 5DWLA 4DK8A 3BEJA 4DMAA 1BSXA 2QNVA 3AZ3A 5DXBB 1XJ7A 5M96A 3ERDA 3FXVA 3OMKA 1YP0A 4MG6A 4OC7A 3UUAA 1NUOA 1QKUA 4LBDA 2AX6A 2ZLAA 2ZK6A 2VSRA 2XYJA 4G1YA 5EC9A 2ATHA 4S0SA 3P8XA 5KCCA 3G9EA 4Y29A 4J5XC 1YMTA 4DQMA 3F5CB 4HEEX 3E94A 4XUHA 4G20A 1T7RA 3AZ1A 3PCUA 3CJWA 4MGAA 4JYHA 3WFFA 2P7ZA 5DVSA 3VT6A 3R5MA 1L2JA 5DZIA 2VV3A 4IWCA 4OHAA 5DUHA 3R29A 4OEAA 3DCUA 4N8RA 4S14A 1XDKA 2AX7A 3WFGA 5C4TA 5DV3A 5FQSA 2HFPA 4ZOMA 4RWVA 1GWXA 3FLIA 3L3XA 4IWFA 4RZEA 5DZHA 3TKCA 1FM6D 2O4JA 1SQNA 1UHLB 2NXXA 3DR1A 5DX3B 3W0JA 4IUIA 3OMOA 5DVVA 5KRMA 1FM6A 5DMCA 1S0ZA 2J14A 4MDDA 5DIEA 1N83A 5GIDA 4BCRA 1ZUCA 4ZJWA 2NXXE 4MG8B 2GPUA 1T7TA 5DV8A 2QZOB 4DM8A 3OKIA 2I4PA 4XI3A 3S9SA 2ZFXA 2ZNQA 5C4OA 1R1KD 2YATA 2Q6RA 3X31A 4M8HA 2PINA 4R6SA 4RAKA 3W5PA 4E2JA 1R1KA 3D5FA 3BQDA 1RJKA 1T7FA 3VT8A 1IE9A 3OMQA 3OZJA 2HARA 2ZKCA 3OSIA 1XP1A 5DKSA 5DWEA 5G3JA 5KRAA 5KYAA 4EM9A 1YYEA 3FS1A 4L96A 4PF3A 5KRLA 3OOFA 3RY9A 2H79A 4K7AA 4WPFA 3TX7B 2EWPA 1A52A 2ZASA 3KMZA 4LNWA 5DXBA 4G1ZA 3VI8A 1YIMA 3LMPA 3NSPA 4OEZA 3L3ZA 4OZTU 2NPAA 2Q5SA 3QT0A 1X7EA 2XKWA 3V49A 2QXSA 4IV4A 3H52A 3R5NA 2AA7A 4WQPA 5ICKA 2V0VA 2GPOA 4MG7B 2AMAA 2Q7KA 4OIVA 3F5CA 1M13A 2QPYA 5KCUA 2PKLA 4LNXA 2QGTA 4LTWA 1MV9A 4TV1B 5GICA 1N4HA 5KROA 3ET3A 3VJIA 1RKHA 1ZDUA 2ACLA 2B50A 2YJDA 4JAZA 4EMAA 3AURA 2ZNNA 2ZXZA 4RFWA 1DKFA 4WVDA 1G5YA 5G44A 1PK5A 3MNPA 2Q5PA 2QH6A 1ZH7A 2Q59A 2QSEA 5EI1A 3A2IA 3ZQTA 1XOWA 3KPZA 2Q60A 4IVWA 2P7GA 3PEQA 4POHA 4ZNTA 1UHLA 4OZRU 1SKXA 5DX3A 2A3IA 4DK7A 1NQ0A 4RZGA 2AX8A 2PJLA 4KZIA 5F9BA 3DZYA 3A2JA 4OIUA 4RMDA 5A86A 3D90A 4OFRA 3IPSA 4E4KA 3K6PA 4MGDA 1XB7A 4JYGA 1P93A 2BJ4B 2I0GA 4WLBA 2QZOA 1XLSA 3CTBA 2O9IA 4ITEA 3VT9A 3VRTA 4ZO1B 3UP0A 2YLYA 5HYKA 5KCTA 3FUGA 2Z4BA 3IMYA 2Q6SA 1VJBA 4G1DA 1X7JA 5HCVA 3W5QA 2OAXA 5DWIA 4L98A 5DVCA 1XLSE 2IOKA 5APKA 2YFEA 3LBDA 1XVPA 3OMMA 3W5RA 3DZUD 1K4WA 2AA5A 1MVCA 2P1VA 3GD2A 3L03A 2VV1A 3DZUA 3SP6A 3CLDA 5KYJA 2ABIA 3GYTA 3NOAA 5I4VA 2IHQA 3D24A 4OKBA 5HJSA 1OSHA 3WMHA 5H1EA 5DMFA 1HG4A 5DWGA 3V9YA 1YUCA 3B0RA 4UDAA 4PPSA 4ZNHA 5ETHA 1NYXA 3B67A 3OS8A 4PRGA 4QJRA 1U3QA 2YHDA 3Q95A 3E7CA 3ZR7A 1L2IA 3HLVA 3GN8A 1XQ3A 1DB1A 3AN4A 5DRMA 2I4JA 1NDEA 4MG7A 2PIUA 1MZNA 4MG5A 3WT5A 4UDCA 3B0WA 3GWSX 4OKWA 3V3EA 1RK3A 2ZBSA 3VT4A 2HC4A 4TV1A 2YLOA 4IA3A 4J5WC 4MGBA 2HWQA 3OS9A 4O8FA 4A4WA 1I38A 5JI0D 1LBDA 1OVLB 5JJMB 4DM6A 3AFRA 2ZY0A 5B5BA 4XAOA 5DZ1A 1FCXA 2AMBA 5KRFA 5KRCA 1M7WA 4TUZB 3WGPA 1TXIA 3VN2A 3O1EA 5E7VA 1NQ2A 3CDSA 2ZLCA 2QR9A 3UVVA 2P4YA 2PIPL 2QABA 2R6WA 2XYXA 3DCTA 3ET1A 4OEDA 4XUMA 3P89A 5AVLA 1Y9RA 5DXQA 3OSWA 4PVUA 5DUGA 4IA1A 1RKGA 3ERTA 3AN3A 4OJBA 3VJTA 1WM0X 1XZXX 1U3SA 4IU7A 3VTCA 5DWJA 5E15A 4OZTE 1S9QA 1XIUA 3N00A 4RUOX 1T76A 2BJ4A 2JFAB 3RUTA 5FQPA 3W5TA 4WHFA 5AAVB 3K8SA 1NQ1A 4REFA 1UOMA 1X7BA 4JL4A 1Z5XU 1E3GA 3JZCA 3D6DA 3W0HA 4QE8A 3A9EB 3WJ5A 4YT1A 1ZGYA
chains in the Genus database with same CATH superfamily
4OH5A 1OT7A 2GPPA 5APHA 2XYWA 3H0AD 3VT5A 3L0EA 4RUPA 4RMEA 4F9MA 3A40X 5DU5A 2ZMHA 3ZRAA 3PRGA 5DKBA 3K23A 3OKHA 5CJ6A 4ZNWA 3OLFA 3OAPA 4S0TA 4QE6A 5AWKA 2G0GA 1R5KA 5L7GA 5DK9A 3VT7A 2P7AA 2Q5GA 4YNKA 2YLPA 2FVJA 2VV4B 1NQ7A 3W0CA 1RDTD 4NIEA 2QA8B 4UDDA 5EHJA 5L7HA 1QKMA 5DXKA 1RDTA 1FD0A 3SZ1A 3U9QA 2QMVA 2ZK5A 4G21A 4DOSA 3G0WA 5C4SA 5G5WA 2VV0A 5E1CA 5FQVA 3IXPD 4A4VA 4YPQA 5KRJA 2PIWA 4R06A 5DZ0A 3D57A 3B0TA 3CS6A 3IXPA 1OVLA 4IVYA 5JJMA 1H9UA 3KDUA 2YJAB 3GZ9A 3HQ5A 3R8AA 1ZAFA 3V4AA 3VRWA 2I0JA 3VRUA 5DXGA 3KYTA 2ZXNA 3DT3A 4PLDA 1YOKA 3F7DA 3L0LA 4OK1A 5KRKA 5KRIA 3X36A 3B3KA 4ZN9A 1XV9B 4Q13A 5DP0A 3VTBA 4RMCA 5HZCA 1PDUA 1I7GA 5LGAA 5K13A 3PBAA 5DYDA 5AVIA 4M8EA 3B5RA 2JFAA 4WHGA 3VT3A 5L7EA 1U9EA 4P6WA 4REEA 4G2IA 2HB8A 5AAVA 2AAXA 3UUAB 2AM9A 3V3QA 1U3RA 4ZNSA 4YMQA 2HVCA 4FHIA 5G45A 5IZ0A 2Q8SA 4MG8A 2I4ZA 3A9EA 3OLLA 3X1IA 4IS8A 1GS4A 3W0YA 3P0UA 1Z95A 4ZI1A 4G2HA 3AX8A 5B41A 5HJPB 2AO6A 5DRJA 5APJA 1T79A 1X7RA 5JY3A 2G0HA 3FURA 4N73A 5E0WA 5DLRA 4RZFA 3HM1A 4E4QA 1S19A 5KD9A 4CSJA 3UUCA 3VHWA 3KFCA 2HAMA 4ZJRA 2H77A 3A78A 4JGVA 2F4BA 4POJA 1I7IA 1K74D 2P54A 4IQRA 2B1ZA 3OZ0A 2AB2A 2REWA 2QA8A 2GIUA 1LV2A 3T03A 1ZKYA 1K74A 4J24A 5KRHA 2Q6JA 1PRGA 4ONIA 1XP9A 2BAWA 2P15A 3GBKA 4RUJA 5DKGA 4B7WA 3UP3A 2ZK4A 3B65A 3KMGA 1PQ9A 2OVMA 2ZVTA 4OFUA 2PITA 2AX9A 2AYRA 3HVLA 3VHVA 4APUA 4PWLA 4PXMA 5DXPA 3ADXA 5EITA 4J5XA 1A28A 5GT4A 1FM9D 1NAVA 2VSTA 5DUEA 2GPVA 3G8IA 3UU7B 2QW4A 4QK4A 2ZMJA 1FM9A 1PQCA 1YJEA 1XPCA 2V7CA 3NSQA 4OKTA 5C4UA 1QKTA 1T7MA 3FC6B 1UPWA 5IAWA 1XV9A 1P8DA 2B23A 3PO9A 5EGVA 4NB6A 1G50A 3HC5A 3R2AA 3ADSA 1EXAA 4ZN7A 3B1MA 4OGHA 3HO0A 3R8DA 2AWHA 2J7YA 3RUUA 3CDPA 4X1FA 5KCEA 3OS8C 2J4AA 2OVHA 2HB7A 2P1UA 4FGYA 4ITFA 2VV2A 5DY8A 2ZK0A 2LBDA 3ILZA 3VSOA 5HYRA 4PPPA 4N1YA 5G46A 3L1BA 2QE4A 2QA6A 3ADUA 2HWRA 4JYIA 2G44A 4KZJA 5DYBA 5HJPA 1KNUA 3RVFA 2AXAA 3CWDA 5ACCA 3HZFA 1IE8A 3PLZA 4OH6A 2QTUA 3B0QA 1R20D 2FAIA 2YLQA 1YY4A 3KWYA 2ACLB 2AA6A 2Q70A 4J26A 3AUNA 4R2UA 1T73A 5KR9A 3CS4A 4IW8A 1M2ZA 4NY9A 1R20A 3V9TA 1DKFB 1FCYA 4OJ4A 3WT7A 1NAXA 2E2RA 4MG9B 3RLLA 4Q50A 2GL8A 3W0IA 1E3KA 1T65A 4OKXA 3H0AA 2Q59B 5DXRA 4HLWA 3FALB 5AZTA 2QGWA 2ZK1A 3ADVA 3IPQA 1FBYA 2R40D 5KCFA 5DIDA 5DXMA 3CQVA 5DI7A 1T5ZA 2R40A 3IA6A 4QM0A 4N5GA 4Q0AC 3VRVA 3UUDB 4OZRE 1NRLA 2PRGA 3AZ2A 5KCDA 1T74A 4ZO1X 3HC6A 2OCFA 4OLMA 2FSZA 2QXMA 1R6GA 1Y0XX 4MGDB 2B1VA 5DIGA 3KBAA 5DKEA 2PIVA 5DZ3A 1YINA 5G42A 3OSAA 2XHSA 1YA3A 2ZNOA 1SR7A 4PP5A 1KV6A 1EXXA 4LSJA 3B68A 2Q7JA 2Q3YA 3A2HA 3VJHA 3ADWA 4FNEA 1XQCA 2IOGA 3FEIA 3UU7A 1XP6A 2GP7A 3SP9A 1XVPB 4K6IA 4NUFA 2PNUA 3FC6A 4ZNVA 2VV1B 2POBA 4PLEA 2AA2A 4TUZA 3B66A 5DTVA 1S0XA 3FEJA 5LWPA 3VJSA 4QL8A 3R8IA 5DV6A 5E14A 3M7RA 3OGTA 1Q4XA 3ET0A 1X78A 5AYGA 1KKQA 2O4RA 1GWRA 3E00D 1K7LA 5G43A 3HODA 3W0AA 3IPUA 2ZXMA 1X76A 3Q95B 5DSHA 5AWJA 5AZVA 2GTKA 3E00A 1TFCA 2PIRA 5AK2A 2PIXA 4OEYA 3TKMA 2Q1VA 2ZK2A 2JF9A 2W8YA 3W0GA 2HASA 1ILGA 1G2NA 1OSVA 1ERRA 2OM9A 2POGA 2Z4JA 3KDTA 3WJ4A 4XLDA 4MGBB 4RE8A 4DORA 1PZLA 2ZNPA 3DY6A 4CI5A 3OLSA 4X1GA 4IA7A 4KZMA 1I37A 2HCDA 2Q1HA 1FCZA 1HJ1A 3V9VA 1EREA 4FN9A 4MG9A 3VTDA 4IW6A 5EJVA 2OUZA 3O1DA 4MGCA 4MGAB 5SYZA 2ZMIA 3FALA 1ILHA 5KCWA 3P88A 3UVVB 4XHDA 3G8OA 5E0XA 3JZBA 3DZYD 3KMRA 3UUDA 2VV4A 2ZK3A 4XT9A 1XDKB 3RLJA 1GWQA 1PQ6A 1PCGA 2NV7A 5DXEA 1G1UA 3VHUA 2Q7IA 1N46A 1NHZA 3CS8A 4ZNUA 1YOWA 2PIOA 5IXKA 1ZEOA 4IA2A 1XAPA 4PP6A 5L11A 4CI4A 1SJ0A 3ADTA 2JJ3A 4IV2A 1Y0SA 2Q61A 3K22A 3MNEA 1QKNA 4PP3A 3TY0A 3EYBA 1T63A 4OARA 1Z5XE 3A3ZX 2OZ7A 2NW4A 2P1TA 3MNOA 4J5WA 1UPVA 4OILA 3WT6A 5AAUA 2PIQA 1ZDTA 3WWRA 4P6XA 3GYUA 3WTQA 3ZRBA 3X1HA 4OJ9A 3VSPA 2R6YA 2GWXA 3OOKA 4FHHA 2J7XA 4UDBA 5DL4A 5E19A 5FQRA 4A2JA 3AUQA 5GIEA 4K4JA 2HBHA 4XTAA 2ZL9A 3ET2A 1XNXA 3L0JA 5FQTA 1S9PA 2G5OA 2Q7LA 3OMPA 4S15A 4NQAB 1XNNA 3GWXA 3BC5A 5DWLA 4DK8A 3BEJA 4DMAA 1BSXA 2QNVA 3AZ3A 5DXBB 1XJ7A 5M96A 3ERDA 3FXVA 3OMKA 1YP0A 4MG6A 4OC7A 3UUAA 1NUOA 1QKUA 4LBDA 2AX6A 2ZLAA 2ZK6A 2VSRA 2XYJA 4G1YA 5EC9A 2ATHA 4S0SA 3P8XA 5KCCA 3G9EA 4Y29A 4J5XC 1YMTA 4DQMA 3F5CB 4HEEX 3E94A 4XUHA 4G20A 1T7RA 3AZ1A 3PCUA 3CJWA 4MGAA 4JYHA 3WFFA 2P7ZA 5DVSA 3VT6A 3R5MA 1L2JA 5DZIA 2VV3A 4IWCA 4OHAA 5DUHA 3R29A 4OEAA 3DCUA 4N8RA 4S14A 1XDKA 2AX7A 3WFGA 5C4TA 5DV3A 5FQSA 2HFPA 4ZOMA 4RWVA 1GWXA 3FLIA 3L3XA 4IWFA 4RZEA 5DZHA 3TKCA 1FM6D 2O4JA 1SQNA 1UHLB 2NXXA 3DR1A 5DX3B 3W0JA 4IUIA 3OMOA 5DVVA 5KRMA 1FM6A 5DMCA 1S0ZA 2J14A 4MDDA 5DIEA 1N83A 5GIDA 4BCRA 1ZUCA 4ZJWA 2NXXE 4MG8B 2GPUA 1T7TA 5DV8A 2QZOB 4DM8A 3OKIA 2I4PA 4XI3A 3S9SA 2ZFXA 2ZNQA 5C4OA 1R1KD 2YATA 2Q6RA 3X31A 4M8HA 2PINA 4R6SA 4RAKA 3W5PA 4E2JA 1R1KA 3D5FA 3BQDA 1RJKA 1T7FA 3VT8A 1IE9A 3OMQA 3OZJA 2HARA 2ZKCA 3OSIA 1XP1A 5DKSA 5DWEA 5G3JA 5KRAA 5KYAA 4EM9A 1YYEA 3FS1A 4L96A 4PF3A 5KRLA 3OOFA 3RY9A 2H79A 4K7AA 4WPFA 3TX7B 2EWPA 1A52A 2ZASA 3KMZA 4LNWA 5DXBA 4G1ZA 3VI8A 1YIMA 3LMPA 3NSPA 4OEZA 3L3ZA 4OZTU 2NPAA 2Q5SA 3QT0A 1X7EA 2XKWA 3V49A 2QXSA 4IV4A 3H52A 3R5NA 2AA7A 4WQPA 5ICKA 2V0VA 2GPOA 4MG7B 2AMAA 2Q7KA 4OIVA 3F5CA 1M13A 2QPYA 5KCUA 2PKLA 4LNXA 2QGTA 4LTWA 1MV9A 4TV1B 5GICA 1N4HA 5KROA 3ET3A 3VJIA 1RKHA 1ZDUA 2ACLA 2B50A 2YJDA 4JAZA 4EMAA 3AURA 2ZNNA 2ZXZA 4RFWA 1DKFA 4WVDA 1G5YA 5G44A 1PK5A 3MNPA 2Q5PA 2QH6A 1ZH7A 2Q59A 2QSEA 5EI1A 3A2IA 3ZQTA 1XOWA 3KPZA 2Q60A 4IVWA 2P7GA 3PEQA 4POHA 4ZNTA 1UHLA 4OZRU 1SKXA 5DX3A 2A3IA 4DK7A 1NQ0A 4RZGA 2AX8A 2PJLA 4KZIA 5F9BA 3DZYA 3A2JA 4OIUA 4RMDA 5A86A 3D90A 4OFRA 3IPSA 4E4KA 3K6PA 4MGDA 1XB7A 4JYGA 1P93A 2BJ4B 2I0GA 4WLBA 2QZOA 1XLSA 3CTBA 2O9IA 4ITEA 3VT9A 3VRTA 4ZO1B 3UP0A 2YLYA 5HYKA 5KCTA 3FUGA 2Z4BA 3IMYA 2Q6SA 1VJBA 4G1DA 1X7JA 5HCVA 3W5QA 2OAXA 5DWIA 4L98A 5DVCA 1XLSE 2IOKA 5APKA 2YFEA 3LBDA 1XVPA 3OMMA 3W5RA 3DZUD 1K4WA 2AA5A 1MVCA 2P1VA 3GD2A 3L03A 2VV1A 3DZUA 3SP6A 3CLDA 5KYJA 2ABIA 3GYTA 3NOAA 5I4VA 2IHQA 3D24A 4OKBA 5HJSA 1OSHA 3WMHA 5H1EA 5DMFA 1HG4A 5DWGA 3V9YA 1YUCA 3B0RA 4UDAA 4PPSA 4ZNHA 5ETHA 1NYXA 3B67A 3OS8A 4PRGA 4QJRA 1U3QA 2YHDA 3Q95A 3E7CA 3ZR7A 1L2IA 3HLVA 3GN8A 1XQ3A 1DB1A 3AN4A 5DRMA 2I4JA 1NDEA 4MG7A 2PIUA 1MZNA 4MG5A 3WT5A 4UDCA 3B0WA 3GWSX 4OKWA 3V3EA 1RK3A 2ZBSA 3VT4A 2HC4A 4TV1A 2YLOA 4IA3A 4J5WC 4MGBA 2HWQA 3OS9A 4O8FA 4A4WA 1I38A 5JI0D 1LBDA 1OVLB 5JJMB 4DM6A 3AFRA 2ZY0A 5B5BA 4XAOA 5DZ1A 1FCXA 2AMBA 5KRFA 5KRCA 1M7WA 4TUZB 3WGPA 1TXIA 3VN2A 3O1EA 5E7VA 1NQ2A 3CDSA 2ZLCA 2QR9A 3UVVA 2P4YA 2PIPL 2QABA 2R6WA 2XYXA 3DCTA 3ET1A 4OEDA 4XUMA 3P89A 5AVLA 1Y9RA 5DXQA 3OSWA 4PVUA 5DUGA 4IA1A 1RKGA 3ERTA 3AN3A 4OJBA 3VJTA 1WM0X 1XZXX 1U3SA 4IU7A 3VTCA 5DWJA 5E15A 4OZTE 1S9QA 1XIUA 3N00A 4RUOX 1T76A 2BJ4A 2JFAB 3RUTA 5FQPA 3W5TA 4WHFA 5AAVB 3K8SA 1NQ1A 4REFA 1UOMA 1X7BA 4JL4A 1Z5XU 1E3GA 3JZCA 3D6DA 3W0HA 4QE8A 3A9EB 3WJ5A 4YT1A 1ZGYA
chains in the Genus database with same CATH topology
4OH5A 1OT7A 2GPPA 5APHA 2XYWA 3H0AD 3VT5A 3L0EA 4RUPA 4RMEA 4F9MA 3A40X 5DU5A 2ZMHA 3ZRAA 3PRGA 5DKBA 3K23A 3OKHA 5CJ6A 4ZNWA 3OLFA 3OAPA 4S0TA 4QE6A 5AWKA 2G0GA 1R5KA 5L7GA 5DK9A 3VT7A 2P7AA 2Q5GA 4YNKA 2YLPA 2FVJA 2VV4B 1NQ7A 3W0CA 1RDTD 4NIEA 2QA8B 4UDDA 5EHJA 5L7HA 1QKMA 5DXKA 1RDTA 1FD0A 3SZ1A 3U9QA 2QMVA 2ZK5A 4G21A 4DOSA 3G0WA 5C4SA 5G5WA 2VV0A 5E1CA 5FQVA 3IXPD 4A4VA 4YPQA 5KRJA 2PIWA 4R06A 5DZ0A 3D57A 3B0TA 3CS6A 3IXPA 1OVLA 4IVYA 5JJMA 1H9UA 3KDUA 2YJAB 3GZ9A 3HQ5A 3R8AA 1ZAFA 3V4AA 3VRWA 2I0JA 3VRUA 5DXGA 3KYTA 2ZXNA 3DT3A 4PLDA 1YOKA 3F7DA 3L0LA 4OK1A 5KRKA 5KRIA 3X36A 3B3KA 4ZN9A 1XV9B 4Q13A 5DP0A 3VTBA 4RMCA 5HZCA 1PDUA 1I7GA 5LGAA 5K13A 3PBAA 5DYDA 5AVIA 4M8EA 3B5RA 2JFAA 4WHGA 3VT3A 5L7EA 1U9EA 4P6WA 4REEA 4G2IA 2HB8A 5AAVA 2AAXA 3UUAB 2AM9A 3V3QA 1U3RA 4ZNSA 4YMQA 2HVCA 4FHIA 5G45A 5IZ0A 2Q8SA 4MG8A 2I4ZA 3A9EA 3OLLA 3X1IA 4IS8A 1GS4A 3W0YA 3P0UA 1Z95A 4ZI1A 4G2HA 3AX8A 5B41A 5HJPB 2AO6A 5DRJA 5APJA 1T79A 1X7RA 5JY3A 2G0HA 3FURA 4N73A 5E0WA 5DLRA 4RZFA 3HM1A 4E4QA 1S19A 5KD9A 4CSJA 3UUCA 3VHWA 3KFCA 2HAMA 4ZJRA 2H77A 3A78A 4JGVA 2F4BA 4POJA 1I7IA 1K74D 2P54A 4IQRA 2B1ZA 3OZ0A 2AB2A 2REWA 2QA8A 2GIUA 1LV2A 3T03A 1ZKYA 1K74A 4J24A 5KRHA 2Q6JA 1PRGA 4ONIA 1XP9A 2BAWA 2P15A 3GBKA 4RUJA 5DKGA 4B7WA 3UP3A 2ZK4A 3B65A 3KMGA 1PQ9A 2OVMA 2ZVTA 4OFUA 2PITA 2AX9A 2AYRA 3HVLA 3VHVA 4APUA 4PWLA 4PXMA 5DXPA 3ADXA 5EITA 4J5XA 1A28A 5GT4A 1FM9D 1NAVA 2VSTA 5DUEA 2GPVA 3G8IA 3UU7B 2QW4A 4QK4A 2ZMJA 1FM9A 1PQCA 1YJEA 1XPCA 2V7CA 3NSQA 4OKTA 5C4UA 1QKTA 1T7MA 3FC6B 1UPWA 5IAWA 1XV9A 1P8DA 2B23A 3PO9A 5EGVA 4NB6A 1G50A 3HC5A 3R2AA 3ADSA 1EXAA 4ZN7A 3B1MA 4OGHA 3HO0A 3R8DA 2AWHA 2J7YA 3RUUA 3CDPA 4X1FA 5KCEA 3OS8C 2J4AA 2OVHA 2HB7A 2P1UA 4FGYA 4ITFA 2VV2A 5DY8A 2ZK0A 2LBDA 3ILZA 3VSOA 5HYRA 4PPPA 4N1YA 5G46A 3L1BA 2QE4A 2QA6A 3ADUA 2HWRA 4JYIA 2G44A 4KZJA 5DYBA 5HJPA 1KNUA 3RVFA 2AXAA 3CWDA 5ACCA 3HZFA 1IE8A 3PLZA 4OH6A 2QTUA 3B0QA 1R20D 2FAIA 2YLQA 1YY4A 3KWYA 2ACLB 2AA6A 2Q70A 4J26A 3AUNA 4R2UA 1T73A 5KR9A 3CS4A 4IW8A 1M2ZA 4NY9A 1R20A 3V9TA 1DKFB 1FCYA 4OJ4A 3WT7A 1NAXA 2E2RA 4MG9B 3RLLA 4Q50A 2GL8A 3W0IA 1E3KA 1T65A 4OKXA 3H0AA 2Q59B 5DXRA 4HLWA 3FALB 5AZTA 2QGWA 2ZK1A 3ADVA 3IPQA 1FBYA 2R40D 5KCFA 5DIDA 5DXMA 3CQVA 5DI7A 1T5ZA 2R40A 3IA6A 4QM0A 4N5GA 4Q0AC 3VRVA 3UUDB 4OZRE 1NRLA 2PRGA 3AZ2A 5KCDA 1T74A 4ZO1X 3HC6A 2OCFA 4OLMA 2FSZA 2QXMA 1R6GA 1Y0XX 4MGDB 2B1VA 5DIGA 3KBAA 5DKEA 2PIVA 5DZ3A 1YINA 5G42A 3OSAA 2XHSA 1YA3A 2ZNOA 1SR7A 4PP5A 1KV6A 1EXXA 4LSJA 3B68A 2Q7JA 2Q3YA 3A2HA 3VJHA 3ADWA 4FNEA 1XQCA 2IOGA 3FEIA 3UU7A 1XP6A 2GP7A 3SP9A 1XVPB 4K6IA 4NUFA 2PNUA 3FC6A 4ZNVA 2VV1B 2POBA 4PLEA 2AA2A 4TUZA 3B66A 5DTVA 1S0XA 3FEJA 5LWPA 3VJSA 4QL8A 3R8IA 5DV6A 5E14A 3M7RA 3OGTA 1Q4XA 3ET0A 1X78A 5AYGA 1KKQA 2O4RA 1GWRA 3E00D 1K7LA 5G43A 3HODA 3W0AA 3IPUA 2ZXMA 1X76A 3Q95B 5DSHA 5AWJA 5AZVA 2GTKA 3E00A 1TFCA 2PIRA 5AK2A 2PIXA 4OEYA 3TKMA 2Q1VA 2ZK2A 2JF9A 2W8YA 3W0GA 2HASA 1ILGA 1G2NA 1OSVA 1ERRA 2OM9A 2POGA 2Z4JA 3KDTA 3WJ4A 4XLDA 4MGBB 4RE8A 4DORA 1PZLA 2ZNPA 3DY6A 4CI5A 3OLSA 4X1GA 4IA7A 4KZMA 1I37A 2HCDA 2Q1HA 1FCZA 1HJ1A 3V9VA 1EREA 4FN9A 4MG9A 3VTDA 4IW6A 5EJVA 2OUZA 3O1DA 4MGCA 4MGAB 5SYZA 2ZMIA 3FALA 1ILHA 5KCWA 3P88A 3UVVB 4XHDA 3G8OA 5E0XA 3JZBA 3DZYD 3KMRA 3UUDA 2VV4A 2ZK3A 4XT9A 1XDKB 3RLJA 1GWQA 1PQ6A 1PCGA 2NV7A 5DXEA 1G1UA 3VHUA 2Q7IA 1N46A 1NHZA 3CS8A 4ZNUA 1YOWA 2PIOA 5IXKA 1ZEOA 4IA2A 1XAPA 4PP6A 5L11A 4CI4A 1SJ0A 3ADTA 2JJ3A 4IV2A 1Y0SA 2Q61A 3K22A 3MNEA 1QKNA 4PP3A 3TY0A 3EYBA 1T63A 4OARA 1Z5XE 3A3ZX 2OZ7A 2NW4A 2P1TA 3MNOA 4J5WA 1UPVA 4OILA 3WT6A 5AAUA 2PIQA 1ZDTA 3WWRA 4P6XA 3GYUA 3WTQA 3ZRBA 3X1HA 4OJ9A 3VSPA 2R6YA 2GWXA 3OOKA 4FHHA 2J7XA 4UDBA 5DL4A 5E19A 5FQRA 4A2JA 3AUQA 5GIEA 4K4JA 2HBHA 4XTAA 2ZL9A 3ET2A 1XNXA 3L0JA 5FQTA 1S9PA 2G5OA 2Q7LA 3OMPA 4S15A 4NQAB 1XNNA 3GWXA 3BC5A 5DWLA 4DK8A 3BEJA 4DMAA 1BSXA 2QNVA 3AZ3A 5DXBB 1XJ7A 5M96A 3ERDA 3FXVA 3OMKA 1YP0A 4MG6A 4OC7A 3UUAA 1NUOA 1QKUA 4LBDA 2AX6A 2ZLAA 2ZK6A 2VSRA 2XYJA 4G1YA 5EC9A 2ATHA 4S0SA 3P8XA 5KCCA 3G9EA 4Y29A 4J5XC 1YMTA 4DQMA 3F5CB 4HEEX 3E94A 4XUHA 4G20A 1T7RA 3AZ1A 3PCUA 3CJWA 4MGAA 4JYHA 3WFFA 2P7ZA 5DVSA 3VT6A 3R5MA 1L2JA 5DZIA 2VV3A 4IWCA 4OHAA 5DUHA 3R29A 4OEAA 3DCUA 4N8RA 4S14A 1XDKA 2AX7A 3WFGA 5C4TA 5DV3A 5FQSA 2HFPA 4ZOMA 4RWVA 1GWXA 3FLIA 3L3XA 4IWFA 4RZEA 5DZHA 3TKCA 1FM6D 2O4JA 1SQNA 1UHLB 2NXXA 3DR1A 5DX3B 3W0JA 4IUIA 3OMOA 5DVVA 5KRMA 1FM6A 5DMCA 1S0ZA 2J14A 4MDDA 5DIEA 1N83A 5GIDA 4BCRA 1ZUCA 4ZJWA 2NXXE 4MG8B 2GPUA 1T7TA 5DV8A 2QZOB 4DM8A 3OKIA 2I4PA 4XI3A 3S9SA 2ZFXA 2ZNQA 5C4OA 1R1KD 2YATA 2Q6RA 3X31A 4M8HA 2PINA 4R6SA 4RAKA 3W5PA 4E2JA 1R1KA 3D5FA 3BQDA 1RJKA 1T7FA 3VT8A 1IE9A 3OMQA 3OZJA 2HARA 2ZKCA 3OSIA 1XP1A 5DKSA 5DWEA 5G3JA 5KRAA 5KYAA 4EM9A 1YYEA 3FS1A 4L96A 4PF3A 5KRLA 3OOFA 3RY9A 2H79A 4K7AA 4WPFA 3TX7B 2EWPA 1A52A 2ZASA 3KMZA 4LNWA 5DXBA 4G1ZA 3VI8A 1YIMA 3LMPA 3NSPA 4OEZA 3L3ZA 4OZTU 2NPAA 2Q5SA 3QT0A 1X7EA 2XKWA 3V49A 2QXSA 4IV4A 3H52A 3R5NA 2AA7A 4WQPA 5ICKA 2V0VA 2GPOA 4MG7B 2AMAA 2Q7KA 4OIVA 3F5CA 1M13A 2QPYA 5KCUA 2PKLA 4LNXA 2QGTA 4LTWA 1MV9A 4TV1B 5GICA 1N4HA 5KROA 3ET3A 3VJIA 1RKHA 1ZDUA 2ACLA 2B50A 2YJDA 4JAZA 4EMAA 3AURA 2ZNNA 2ZXZA 4RFWA 1DKFA 4WVDA 1G5YA 5G44A 1PK5A 3MNPA 2Q5PA 2QH6A 1ZH7A 2Q59A 2QSEA 5EI1A 3A2IA 3ZQTA 1XOWA 3KPZA 2Q60A 4IVWA 2P7GA 3PEQA 4POHA 4ZNTA 1UHLA 4OZRU 1SKXA 5DX3A 2A3IA 4DK7A 1NQ0A 4RZGA 2AX8A 2PJLA 4KZIA 5F9BA 3DZYA 3A2JA 4OIUA 4RMDA 5A86A 3D90A 4OFRA 3IPSA 4E4KA 3K6PA 4MGDA 1XB7A 4JYGA 1P93A 2BJ4B 2I0GA 4WLBA 2QZOA 1XLSA 3CTBA 2O9IA 4ITEA 3VT9A 3VRTA 4ZO1B 3UP0A 2YLYA 5HYKA 5KCTA 3FUGA 2Z4BA 3IMYA 2Q6SA 1VJBA 4G1DA 1X7JA 5HCVA 3W5QA 2OAXA 5DWIA 4L98A 5DVCA 1XLSE 2IOKA 5APKA 2YFEA 3LBDA 1XVPA 3OMMA 3W5RA 3DZUD 1K4WA 2AA5A 1MVCA 2P1VA 3GD2A 3L03A 2VV1A 3DZUA 3SP6A 3CLDA 5KYJA 2ABIA 3GYTA 3NOAA 5I4VA 2IHQA 3D24A 4OKBA 5HJSA 1OSHA 3WMHA 5H1EA 5DMFA 1HG4A 5DWGA 3V9YA 1YUCA 3B0RA 4UDAA 4PPSA 4ZNHA 5ETHA 1NYXA 3B67A 3OS8A 4PRGA 4QJRA 1U3QA 2YHDA 3Q95A 3E7CA 3ZR7A 1L2IA 3HLVA 3GN8A 1XQ3A 1DB1A 3AN4A 5DRMA 2I4JA 1NDEA 4MG7A 2PIUA 1MZNA 4MG5A 3WT5A 4UDCA 3B0WA 3GWSX 4OKWA 3V3EA 1RK3A 2ZBSA 3VT4A 2HC4A 4TV1A 2YLOA 4IA3A 4J5WC 4MGBA 2HWQA 3OS9A 4O8FA 4A4WA 1I38A 5JI0D 1LBDA 1OVLB 5JJMB 4DM6A 3AFRA 2ZY0A 5B5BA 4XAOA 5DZ1A 1FCXA 2AMBA 5KRFA 5KRCA 1M7WA 4TUZB 3WGPA 1TXIA 3VN2A 3O1EA 5E7VA 1NQ2A 3CDSA 2ZLCA 2QR9A 3UVVA 2P4YA 2PIPL 2QABA 2R6WA 2XYXA 3DCTA 3ET1A 4OEDA 4XUMA 3P89A 5AVLA 1Y9RA 5DXQA 3OSWA 4PVUA 5DUGA 4IA1A 1RKGA 3ERTA 3AN3A 4OJBA 3VJTA 1WM0X 1XZXX 1U3SA 4IU7A 3VTCA 5DWJA 5E15A 4OZTE 1S9QA 1XIUA 3N00A 4RUOX 1T76A 2BJ4A 2JFAB 3RUTA 5FQPA 3W5TA 4WHFA 5AAVB 3K8SA 1NQ1A 4REFA 1UOMA 1X7BA 4JL4A 1Z5XU 1E3GA 3JZCA 3D6DA 3W0HA 4QE8A 3A9EB 3WJ5A 4YT1A 1ZGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OH5 A;  1OT7 A;  2GPP A;  5APH A;  2XYW A;  3H0A D;  3VT5 A;  3L0E A;  4RUP A;  4RME A;  4F9M A;  3A40 X;  5DU5 A;  2ZMH A;  3ZRA A;  3PRG A;  5DKB A;  3K23 A;  3OKH A;  5CJ6 A;  4ZNW A;  3OLF A;  3OAP A;  4S0T A;  4QE6 A;  5AWK A;  2G0G A;  1R5K A;  5L7G A;  5DK9 A;  3VT7 A;  2P7A A;  2Q5G A;  4YNK A;  2YLP A;  2FVJ A;  2VV4 B;  1NQ7 A;  3W0C A;  1RDT D;  4NIE A;  2QA8 B;  4UDD A;  5EHJ A;  5L7H A;  1QKM A;  5DXK A;  1RDT A;  1FD0 A;  3SZ1 A;  3U9Q A;  2QMV A;  2ZK5 A;  4G21 A;  4DOS A;  3G0W A;  5C4S A;  5G5W A;  2VV0 A;  5E1C A;  5FQV A;  3IXP D;  4A4V A;  4YPQ A;  5KRJ A;  2PIW A;  4R06 A;  5DZ0 A;  3D57 A;  3B0T A;  3CS6 A;  3IXP A;  1OVL A;  4IVY A;  5JJM A;  1H9U A;  3KDU A;  2YJA B;  3GZ9 A;  3HQ5 A;  3R8A A;  1ZAF A;  3V4A A;  3VRW A;  2I0J A;  3VRU A;  5DXG A;  3KYT A;  2ZXN A;  3DT3 A;  4PLD A;  1YOK A;  3F7D A;  3L0L A;  4OK1 A;  5KRK A;  5KRI A;  3X36 A;  3B3K A;  4ZN9 A;  1XV9 B;  4Q13 A;  5DP0 A;  3VTB A;  4RMC A;  5HZC A;  1PDU A;  1I7G A;  5LGA A;  5K13 A;  3PBA A;  5DYD A;  5AVI A;  4M8E A;  3B5R A;  2JFA A;  4WHG A;  3VT3 A;  5L7E A;  1U9E A;  4P6W A;  4REE A;  4G2I A;  2HB8 A;  5AAV A;  2AAX A;  3UUA B;  2AM9 A;  3V3Q A;  1U3R A;  4ZNS A;  4YMQ A;  2HVC A;  4FHI A;  5G45 A;  5IZ0 A;  2Q8S A;  4MG8 A;  2I4Z A;  3A9E A;  3OLL A;  3X1I A;  4IS8 A;  1GS4 A;  3W0Y A;  3P0U A;  1Z95 A;  4ZI1 A;  4G2H A;  3AX8 A;  5B41 A;  5HJP B;  2AO6 A;  5DRJ A;  5APJ A;  1T79 A;  1X7R A;  5JY3 A;  2G0H A;  3FUR A;  4N73 A;  5E0W A;  5DLR A;  4RZF A;  3HM1 A;  4E4Q A;  1S19 A;  5KD9 A;  4CSJ A;  3UUC A;  3VHW A;  3KFC A;  2HAM A;  4ZJR A;  2H77 A;  3A78 A;  4JGV A;  2F4B A;  4POJ A;  1I7I A;  1K74 D;  2P54 A;  4IQR A;  2B1Z A;  3OZ0 A;  2AB2 A;  2REW A;  2QA8 A;  2GIU A;  1LV2 A;  3T03 A;  1ZKY A;  1K74 A;  4J24 A;  5KRH A;  2Q6J A;  1PRG A;  4ONI A;  1XP9 A;  2BAW A;  2P15 A;  3GBK A;  4RUJ A;  5DKG A;  4B7W A;  3UP3 A;  2ZK4 A;  3B65 A;  3KMG A;  1PQ9 A;  2OVM A;  2ZVT A;  4OFU A;  2PIT A;  2AX9 A;  2AYR A;  3HVL A;  3VHV A;  4APU A;  4PWL A;  4PXM A;  5DXP A;  3ADX A;  5EIT A;  4J5X A;  1A28 A;  5GT4 A;  1FM9 D;  1NAV A;  2VST A;  5DUE A;  2GPV A;  3G8I A;  3UU7 B;  2QW4 A;  4QK4 A;  2ZMJ A;  1FM9 A;  1PQC A;  1YJE A;  1XPC A;  2V7C A;  3NSQ A;  4OKT A;  5C4U A;  1QKT A;  1T7M A;  3FC6 B;  1UPW A;  5IAW A;  1XV9 A;  1P8D A;  2B23 A;  3PO9 A;  5EGV A;  4NB6 A;  1G50 A;  3HC5 A;  3R2A A;  3ADS A;  1EXA A;  4ZN7 A;  3B1M A;  4OGH A;  3HO0 A;  3R8D A;  2AWH A;  2J7Y A;  3RUU A;  3CDP A;  4X1F A;  5KCE A;  3OS8 C;  2J4A A;  2OVH A;  2HB7 A;  2P1U A;  4FGY A;  4ITF A;  2VV2 A;  5DY8 A;  2ZK0 A;  2LBD A;  3ILZ A;  3VSO A;  5HYR A;  4PPP A;  4N1Y A;  5G46 A;  3L1B A;  2QE4 A;  2QA6 A;  3ADU A;  2HWR A;  4JYI A;  2G44 A;  4KZJ A;  5DYB A;  5HJP A;  1KNU A;  3RVF A;  2AXA A;  3CWD A;  5ACC A;  3HZF A;  1IE8 A;  3PLZ A;  4OH6 A;  2QTU A;  3B0Q A;  1R20 D;  2FAI A;  2YLQ A;  1YY4 A;  3KWY A;  2ACL B;  2AA6 A;  2Q70 A;  4J26 A;  3AUN A;  4R2U A;  1T73 A;  5KR9 A;  3CS4 A;  4IW8 A;  1M2Z A;  4NY9 A;  1R20 A;  3V9T A;  1DKF B;  1FCY A;  4OJ4 A;  3WT7 A;  1NAX A;  2E2R A;  4MG9 B;  3RLL A;  4Q50 A;  2GL8 A;  3W0I A;  1E3K A;  1T65 A;  4OKX A;  3H0A A;  2Q59 B;  5DXR A;  4HLW A;  3FAL B;  5AZT A;  2QGW A;  2ZK1 A;  3ADV A;  3IPQ A;  1FBY A;  2R40 D;  5KCF A;  5DID A;  5DXM A;  3CQV A;  5DI7 A;  1T5Z A;  2R40 A;  3IA6 A;  4QM0 A;  4N5G A;  4Q0A C;  3VRV A;  3UUD B;  4OZR E;  1NRL A;  2PRG A;  3AZ2 A;  5KCD A;  1T74 A;  4ZO1 X;  3HC6 A;  2OCF A;  4OLM A;  2FSZ A;  2QXM A;  1R6G A;  1Y0X X;  4MGD B;  2B1V A;  5DIG A;  3KBA A;  5DKE A;  2PIV A;  5DZ3 A;  1YIN A;  5G42 A;  3OSA A;  2XHS A;  1YA3 A;  2ZNO A;  1SR7 A;  4PP5 A;  1KV6 A;  1EXX A;  4LSJ A;  3B68 A;  2Q7J A;  2Q3Y A;  3A2H A;  3VJH A;  3ADW A;  4FNE A;  1XQC A;  2IOG A;  3FEI A;  3UU7 A;  1XP6 A;  2GP7 A;  3SP9 A;  1XVP B;  4K6I A;  4NUF A;  2PNU A;  3FC6 A;  4ZNV A;  2VV1 B;  2POB A;  4PLE A;  2AA2 A;  4TUZ A;  3B66 A;  5DTV A;  1S0X A;  3FEJ A;  5LWP A;  3VJS A;  4QL8 A;  3R8I A;  5DV6 A;  5E14 A;  3M7R A;  3OGT A;  1Q4X A;  3ET0 A;  1X78 A;  5AYG A;  1KKQ A;  2O4R A;  1GWR A;  3E00 D;  1K7L A;  5G43 A;  3HOD A;  3W0A A;  3IPU A;  2ZXM A;  1X76 A;  3Q95 B;  5DSH A;  5AWJ A;  5AZV A;  2GTK A;  3E00 A;  1TFC A;  2PIR A;  5AK2 A;  2PIX A;  4OEY A;  3TKM A;  2Q1V A;  2ZK2 A;  2JF9 A;  2W8Y A;  3W0G A;  2HAS A;  1ILG A;  1G2N A;  1OSV A;  1ERR A;  2OM9 A;  2POG A;  2Z4J A;  3KDT A;  3WJ4 A;  4XLD A;  4MGB B;  4RE8 A;  4DOR A;  1PZL A;  2ZNP A;  3DY6 A;  4CI5 A;  3OLS A;  4X1G A;  4IA7 A;  4KZM A;  1I37 A;  2HCD A;  2Q1H A;  1FCZ A;  1HJ1 A;  3V9V A;  1ERE A;  4FN9 A;  4MG9 A;  3VTD A;  4IW6 A;  5EJV A;  2OUZ A;  3O1D A;  4MGC A;  4MGA B;  5SYZ A;  2ZMI A;  3FAL A;  1ILH A;  5KCW A;  3P88 A;  3UVV B;  4XHD A;  3G8O A;  5E0X A;  3JZB A;  3DZY D;  3KMR A;  3UUD A;  2VV4 A;  2ZK3 A;  4XT9 A;  1XDK B;  3RLJ A;  1GWQ A;  1PQ6 A;  1PCG A;  2NV7 A;  5DXE A;  1G1U A;  3VHU A;  2Q7I A;  1N46 A;  1NHZ A;  3CS8 A;  4ZNU A;  1YOW A;  2PIO A;  5IXK A;  1ZEO A;  4IA2 A;  1XAP A;  4PP6 A;  5L11 A;  4CI4 A;  1SJ0 A;  3ADT A;  2JJ3 A;  4IV2 A;  1Y0S A;  2Q61 A;  3K22 A;  3MNE A;  1QKN A;  4PP3 A;  3TY0 A;  3EYB A;  1T63 A;  4OAR A;  1Z5X E;  3A3Z X;  2OZ7 A;  2NW4 A;  2P1T A;  3MNO A;  4J5W A;  1UPV A;  4OIL A;  3WT6 A;  5AAU A;  2PIQ A;  1ZDT A;  3WWR A;  4P6X A;  3GYU A;  3WTQ A;  3ZRB A;  3X1H A;  4OJ9 A;  3VSP A;  2R6Y A;  2GWX A;  3OOK A;  4FHH A;  2J7X A;  4UDB A;  5DL4 A;  5E19 A;  5FQR A;  4A2J A;  3AUQ A;  5GIE A;  4K4J A;  2HBH A;  4XTA A;  2ZL9 A;  3ET2 A;  1XNX A;  3L0J A;  5FQT A;  1S9P A;  2G5O A;  2Q7L A;  3OMP A;  4S15 A;  4NQA B;  1XNN A;  3GWX A;  3BC5 A;  5DWL A;  4DK8 A;  3BEJ A;  4DMA A;  1BSX A;  2QNV A;  3AZ3 A;  5DXB B;  1XJ7 A;  5M96 A;  3ERD A;  3FXV A;  3OMK A;  1YP0 A;  4MG6 A;  4OC7 A;  3UUA A;  1NUO A;  1QKU A;  4LBD A;  2AX6 A;  2ZLA A;  2ZK6 A;  2VSR A;  2XYJ A;  4G1Y A;  5EC9 A;  2ATH A;  4S0S A;  3P8X A;  5KCC A;  3G9E A;  4Y29 A;  4J5X C;  1YMT A;  4DQM A;  3F5C B;  4HEE X;  3E94 A;  4XUH A;  4G20 A;  1T7R A;  3AZ1 A;  3PCU A;  3CJW A;  4MGA A;  4JYH A;  3WFF A;  2P7Z A;  5DVS A;  3VT6 A;  3R5M A;  1L2J A;  5DZI A;  2VV3 A;  4IWC A;  4OHA A;  5DUH A;  3R29 A;  4OEA A;  3DCU A;  4N8R A;  4S14 A;  1XDK A;  2AX7 A;  3WFG A;  5C4T A;  5DV3 A;  5FQS A;  2HFP A;  4ZOM A;  4RWV A;  1GWX A;  3FLI A;  3L3X A;  4IWF A;  4RZE A;  5DZH A;  3TKC A;  1FM6 D;  2O4J A;  1SQN A;  1UHL B;  2NXX A;  3DR1 A;  5DX3 B;  3W0J A;  4IUI A;  3OMO A;  5DVV A;  5KRM A;  1FM6 A;  5DMC A;  1S0Z A;  2J14 A;  4MDD A;  5DIE A;  1N83 A;  5GID A;  4BCR A;  1ZUC A;  4ZJW A;  2NXX E;  4MG8 B;  2GPU A;  1T7T A;  5DV8 A;  2QZO B;  4DM8 A;  3OKI A;  2I4P A;  4XI3 A;  3S9S A;  2ZFX A;  2ZNQ A;  5C4O A;  1R1K D;  2YAT A;  2Q6R A;  3X31 A;  4M8H A;  2PIN A;  4R6S A;  4RAK A;  3W5P A;  4E2J A;  1R1K A;  3D5F A;  3BQD A;  1RJK A;  1T7F A;  3VT8 A;  1IE9 A;  3OMQ A;  3OZJ A;  2HAR A;  2ZKC A;  3OSI A;  1XP1 A;  5DKS A;  5DWE A;  5G3J A;  5KRA A;  5KYA A;  4EM9 A;  1YYE A;  3FS1 A;  4L96 A;  4PF3 A;  5KRL A;  3OOF A;  3RY9 A;  2H79 A;  4K7A A;  4WPF A;  3TX7 B;  2EWP A;  1A52 A;  2ZAS A;  3KMZ A;  4LNW A;  5DXB A;  4G1Z A;  3VI8 A;  1YIM A;  3LMP A;  3NSP A;  4OEZ A;  3L3Z A;  4OZT U;  2NPA A;  2Q5S A;  3QT0 A;  1X7E A;  2XKW A;  3V49 A;  2QXS A;  4IV4 A;  3H52 A;  3R5N A;  2AA7 A;  4WQP A;  5ICK A;  2V0V A;  2GPO A;  4MG7 B;  2AMA A;  2Q7K A;  4OIV A;  3F5C A;  1M13 A;  2QPY A;  5KCU A;  2PKL A;  4LNX A;  2QGT A;  4LTW A;  1MV9 A;  4TV1 B;  5GIC A;  1N4H A;  5KRO A;  3ET3 A;  3VJI A;  1RKH A;  1ZDU A;  2ACL A;  2B50 A;  2YJD A;  4JAZ A;  4EMA A;  3AUR A;  2ZNN A;  2ZXZ A;  4RFW A;  1DKF A;  4WVD A;  1G5Y A;  5G44 A;  1PK5 A;  3MNP A;  2Q5P A;  2QH6 A;  1ZH7 A;  2Q59 A;  2QSE A;  5EI1 A;  3A2I A;  3ZQT A;  1XOW A;  3KPZ A;  2Q60 A;  4IVW A;  2P7G A;  3PEQ A;  4POH A;  4ZNT A;  1UHL A;  4OZR U;  1SKX A;  5DX3 A;  2A3I A;  4DK7 A;  1NQ0 A;  4RZG A;  2AX8 A;  2PJL A;  4KZI A;  5F9B A;  3DZY A;  3A2J A;  4OIU A;  4RMD A;  5A86 A;  3D90 A;  4OFR A;  3IPS A;  4E4K A;  3K6P A;  4MGD A;  1XB7 A;  4JYG A;  1P93 A;  2BJ4 B;  2I0G A;  4WLB A;  2QZO A;  1XLS A;  3CTB A;  2O9I A;  4ITE A;  3VT9 A;  3VRT A;  4ZO1 B;  3UP0 A;  2YLY A;  5HYK A;  5KCT A;  3FUG A;  2Z4B A;  3IMY A;  2Q6S A;  1VJB A;  4G1D A;  1X7J A;  5HCV A;  3W5Q A;  2OAX A;  5DWI A;  4L98 A;  5DVC A;  1XLS E;  2IOK A;  5APK A;  2YFE A;  3LBD A;  1XVP A;  3OMM A;  3W5R A;  3DZU D;  1K4W A;  2AA5 A;  1MVC A;  2P1V A;  3GD2 A;  3L03 A;  2VV1 A;  3DZU A;  3SP6 A;  3CLD A;  5KYJ A;  2ABI A;  3GYT A;  3NOA A;  5I4V A;  2IHQ A;  3D24 A;  4OKB A;  5HJS A;  1OSH A;  3WMH A;  5H1E A;  5DMF A;  1HG4 A;  5DWG A;  3V9Y A;  1YUC A;  3B0R A;  4UDA A;  4PPS A;  4ZNH A;  5ETH A;  1NYX A;  3B67 A;  3OS8 A;  4PRG A;  4QJR A;  1U3Q A;  2YHD A;  3Q95 A;  3E7C A;  3ZR7 A;  1L2I A;  3HLV A;  3GN8 A;  1XQ3 A;  1DB1 A;  3AN4 A;  5DRM A;  2I4J A;  1NDE A;  4MG7 A;  2PIU A;  1MZN A;  4MG5 A;  3WT5 A;  4UDC A;  3B0W A;  3GWS X;  4OKW A;  3V3E A;  1RK3 A;  2ZBS A;  3VT4 A;  2HC4 A;  4TV1 A;  2YLO A;  4IA3 A;  4J5W C;  4MGB A;  2HWQ A;  3OS9 A;  4O8F A;  4A4W A;  1I38 A;  5JI0 D;  1LBD A;  1OVL B;  5JJM B;  4DM6 A;  3AFR A;  2ZY0 A;  5B5B A;  4XAO A;  5DZ1 A;  1FCX A;  2AMB A;  5KRF A;  5KRC A;  1M7W A;  4TUZ B;  3WGP A;  1TXI A;  3VN2 A;  3O1E A;  5E7V A;  1NQ2 A;  3CDS A;  2ZLC A;  2QR9 A;  3UVV A;  2P4Y A;  2PIP L;  2QAB A;  2R6W A;  2XYX A;  3DCT A;  3ET1 A;  4OED A;  4XUM A;  3P89 A;  5AVL A;  1Y9R A;  5DXQ A;  3OSW A;  4PVU A;  5DUG A;  4IA1 A;  1RKG A;  3ERT A;  3AN3 A;  4OJB A;  3VJT A;  1WM0 X;  1XZX X;  1U3S A;  4IU7 A;  3VTC A;  5DWJ A;  5E15 A;  4OZT E;  1S9Q A;  1XIU A;  3N00 A;  4RUO X;  1T76 A;  2BJ4 A;  2JFA B;  3RUT A;  5FQP A;  3W5T A;  4WHF A;  5AAV B;  3K8S A;  1NQ1 A;  4REF A;  1UOM A;  1X7B A;  4JL4 A;  1Z5X U;  1E3G A;  3JZC A;  3D6D A;  3W0H A;  4QE8 A;  3A9E B;  3WJ5 A;  4YT1 A;  1ZGY A; 
#chains in the Genus database with same CATH topology
 4OH5 A;  1OT7 A;  2GPP A;  5APH A;  2XYW A;  3H0A D;  3VT5 A;  3L0E A;  4RUP A;  4RME A;  4F9M A;  3A40 X;  5DU5 A;  2ZMH A;  3ZRA A;  3PRG A;  5DKB A;  3K23 A;  3OKH A;  5CJ6 A;  4ZNW A;  3OLF A;  3OAP A;  4S0T A;  4QE6 A;  5AWK A;  2G0G A;  1R5K A;  5L7G A;  5DK9 A;  3VT7 A;  2P7A A;  2Q5G A;  4YNK A;  2YLP A;  2FVJ A;  2VV4 B;  1NQ7 A;  3W0C A;  1RDT D;  4NIE A;  2QA8 B;  4UDD A;  5EHJ A;  5L7H A;  1QKM A;  5DXK A;  1RDT A;  1FD0 A;  3SZ1 A;  3U9Q A;  2QMV A;  2ZK5 A;  4G21 A;  4DOS A;  3G0W A;  5C4S A;  5G5W A;  2VV0 A;  5E1C A;  5FQV A;  3IXP D;  4A4V A;  4YPQ A;  5KRJ A;  2PIW A;  4R06 A;  5DZ0 A;  3D57 A;  3B0T A;  3CS6 A;  3IXP A;  1OVL A;  4IVY A;  5JJM A;  1H9U A;  3KDU A;  2YJA B;  3GZ9 A;  3HQ5 A;  3R8A A;  1ZAF A;  3V4A A;  3VRW A;  2I0J A;  3VRU A;  5DXG A;  3KYT A;  2ZXN A;  3DT3 A;  4PLD A;  1YOK A;  3F7D A;  3L0L A;  4OK1 A;  5KRK A;  5KRI A;  3X36 A;  3B3K A;  4ZN9 A;  1XV9 B;  4Q13 A;  5DP0 A;  3VTB A;  4RMC A;  5HZC A;  1PDU A;  1I7G A;  5LGA A;  5K13 A;  3PBA A;  5DYD A;  5AVI A;  4M8E A;  3B5R A;  2JFA A;  4WHG A;  3VT3 A;  5L7E A;  1U9E A;  4P6W A;  4REE A;  4G2I A;  2HB8 A;  5AAV A;  2AAX A;  3UUA B;  2AM9 A;  3V3Q A;  1U3R A;  4ZNS A;  4YMQ A;  2HVC A;  4FHI A;  5G45 A;  5IZ0 A;  2Q8S A;  4MG8 A;  2I4Z A;  3A9E A;  3OLL A;  3X1I A;  4IS8 A;  1GS4 A;  3W0Y A;  3P0U A;  1Z95 A;  4ZI1 A;  4G2H A;  3AX8 A;  5B41 A;  5HJP B;  2AO6 A;  5DRJ A;  5APJ A;  1T79 A;  1X7R A;  5JY3 A;  2G0H A;  3FUR A;  4N73 A;  5E0W A;  5DLR A;  4RZF A;  3HM1 A;  4E4Q A;  1S19 A;  5KD9 A;  4CSJ A;  3UUC A;  3VHW A;  3KFC A;  2HAM A;  4ZJR A;  2H77 A;  3A78 A;  4JGV A;  2F4B A;  4POJ A;  1I7I A;  1K74 D;  2P54 A;  4IQR A;  2B1Z A;  3OZ0 A;  2AB2 A;  2REW A;  2QA8 A;  2GIU A;  1LV2 A;  3T03 A;  1ZKY A;  1K74 A;  4J24 A;  5KRH A;  2Q6J A;  1PRG A;  4ONI A;  1XP9 A;  2BAW A;  2P15 A;  3GBK A;  4RUJ A;  5DKG A;  4B7W A;  3UP3 A;  2ZK4 A;  3B65 A;  3KMG A;  1PQ9 A;  2OVM A;  2ZVT A;  4OFU A;  2PIT A;  2AX9 A;  2AYR A;  3HVL A;  3VHV A;  4APU A;  4PWL A;  4PXM A;  5DXP A;  3ADX A;  5EIT A;  4J5X A;  1A28 A;  5GT4 A;  1FM9 D;  1NAV A;  2VST A;  5DUE A;  2GPV A;  3G8I A;  3UU7 B;  2QW4 A;  4QK4 A;  2ZMJ A;  1FM9 A;  1PQC A;  1YJE A;  1XPC A;  2V7C A;  3NSQ A;  4OKT A;  5C4U A;  1QKT A;  1T7M A;  3FC6 B;  1UPW A;  5IAW A;  1XV9 A;  1P8D A;  2B23 A;  3PO9 A;  5EGV A;  4NB6 A;  1G50 A;  3HC5 A;  3R2A A;  3ADS A;  1EXA A;  4ZN7 A;  3B1M A;  4OGH A;  3HO0 A;  3R8D A;  2AWH A;  2J7Y A;  3RUU A;  3CDP A;  4X1F A;  5KCE A;  3OS8 C;  2J4A A;  2OVH A;  2HB7 A;  2P1U A;  4FGY A;  4ITF A;  2VV2 A;  5DY8 A;  2ZK0 A;  2LBD A;  3ILZ A;  3VSO A;  5HYR A;  4PPP A;  4N1Y A;  5G46 A;  3L1B A;  2QE4 A;  2QA6 A;  3ADU A;  2HWR A;  4JYI A;  2G44 A;  4KZJ A;  5DYB A;  5HJP A;  1KNU A;  3RVF A;  2AXA A;  3CWD A;  5ACC A;  3HZF A;  1IE8 A;  3PLZ A;  4OH6 A;  2QTU A;  3B0Q A;  1R20 D;  2FAI A;  2YLQ A;  1YY4 A;  3KWY A;  2ACL B;  2AA6 A;  2Q70 A;  4J26 A;  3AUN A;  4R2U A;  1T73 A;  5KR9 A;  3CS4 A;  4IW8 A;  1M2Z A;  4NY9 A;  1R20 A;  3V9T A;  1DKF B;  1FCY A;  4OJ4 A;  3WT7 A;  1NAX A;  2E2R A;  4MG9 B;  3RLL A;  4Q50 A;  2GL8 A;  3W0I A;  1E3K A;  1T65 A;  4OKX A;  3H0A A;  2Q59 B;  5DXR A;  4HLW A;  3FAL B;  5AZT A;  2QGW A;  2ZK1 A;  3ADV A;  3IPQ A;  1FBY A;  2R40 D;  5KCF A;  5DID A;  5DXM A;  3CQV A;  5DI7 A;  1T5Z A;  2R40 A;  3IA6 A;  4QM0 A;  4N5G A;  4Q0A C;  3VRV A;  3UUD B;  4OZR E;  1NRL A;  2PRG A;  3AZ2 A;  5KCD A;  1T74 A;  4ZO1 X;  3HC6 A;  2OCF A;  4OLM A;  2FSZ A;  2QXM A;  1R6G A;  1Y0X X;  4MGD B;  2B1V A;  5DIG A;  3KBA A;  5DKE A;  2PIV A;  5DZ3 A;  1YIN A;  5G42 A;  3OSA A;  2XHS A;  1YA3 A;  2ZNO A;  1SR7 A;  4PP5 A;  1KV6 A;  1EXX A;  4LSJ A;  3B68 A;  2Q7J A;  2Q3Y A;  3A2H A;  3VJH A;  3ADW A;  4FNE A;  1XQC A;  2IOG A;  3FEI A;  3UU7 A;  1XP6 A;  2GP7 A;  3SP9 A;  1XVP B;  4K6I A;  4NUF A;  2PNU A;  3FC6 A;  4ZNV A;  2VV1 B;  2POB A;  4PLE A;  2AA2 A;  4TUZ A;  3B66 A;  5DTV A;  1S0X A;  3FEJ A;  5LWP A;  3VJS A;  4QL8 A;  3R8I A;  5DV6 A;  5E14 A;  3M7R A;  3OGT A;  1Q4X A;  3ET0 A;  1X78 A;  5AYG A;  1KKQ A;  2O4R A;  1GWR A;  3E00 D;  1K7L A;  5G43 A;  3HOD A;  3W0A A;  3IPU A;  2ZXM A;  1X76 A;  3Q95 B;  5DSH A;  5AWJ A;  5AZV A;  2GTK A;  3E00 A;  1TFC A;  2PIR A;  5AK2 A;  2PIX A;  4OEY A;  3TKM A;  2Q1V A;  2ZK2 A;  2JF9 A;  2W8Y A;  3W0G A;  2HAS A;  1ILG A;  1G2N A;  1OSV A;  1ERR A;  2OM9 A;  2POG A;  2Z4J A;  3KDT A;  3WJ4 A;  4XLD A;  4MGB B;  4RE8 A;  4DOR A;  1PZL A;  2ZNP A;  3DY6 A;  4CI5 A;  3OLS A;  4X1G A;  4IA7 A;  4KZM A;  1I37 A;  2HCD A;  2Q1H A;  1FCZ A;  1HJ1 A;  3V9V A;  1ERE A;  4FN9 A;  4MG9 A;  3VTD A;  4IW6 A;  5EJV A;  2OUZ A;  3O1D A;  4MGC A;  4MGA B;  5SYZ A;  2ZMI A;  3FAL A;  1ILH A;  5KCW A;  3P88 A;  3UVV B;  4XHD A;  3G8O A;  5E0X A;  3JZB A;  3DZY D;  3KMR A;  3UUD A;  2VV4 A;  2ZK3 A;  4XT9 A;  1XDK B;  3RLJ A;  1GWQ A;  1PQ6 A;  1PCG A;  2NV7 A;  5DXE A;  1G1U A;  3VHU A;  2Q7I A;  1N46 A;  1NHZ A;  3CS8 A;  4ZNU A;  1YOW A;  2PIO A;  5IXK A;  1ZEO A;  4IA2 A;  1XAP A;  4PP6 A;  5L11 A;  4CI4 A;  1SJ0 A;  3ADT A;  2JJ3 A;  4IV2 A;  1Y0S A;  2Q61 A;  3K22 A;  3MNE A;  1QKN A;  4PP3 A;  3TY0 A;  3EYB A;  1T63 A;  4OAR A;  1Z5X E;  3A3Z X;  2OZ7 A;  2NW4 A;  2P1T A;  3MNO A;  4J5W A;  1UPV A;  4OIL A;  3WT6 A;  5AAU A;  2PIQ A;  1ZDT A;  3WWR A;  4P6X A;  3GYU A;  3WTQ A;  3ZRB A;  3X1H A;  4OJ9 A;  3VSP A;  2R6Y A;  2GWX A;  3OOK A;  4FHH A;  2J7X A;  4UDB A;  5DL4 A;  5E19 A;  5FQR A;  4A2J A;  3AUQ A;  5GIE A;  4K4J A;  2HBH A;  4XTA A;  2ZL9 A;  3ET2 A;  1XNX A;  3L0J A;  5FQT A;  1S9P A;  2G5O A;  2Q7L A;  3OMP A;  4S15 A;  4NQA B;  1XNN A;  3GWX A;  3BC5 A;  5DWL A;  4DK8 A;  3BEJ A;  4DMA A;  1BSX A;  2QNV A;  3AZ3 A;  5DXB B;  1XJ7 A;  5M96 A;  3ERD A;  3FXV A;  3OMK A;  1YP0 A;  4MG6 A;  4OC7 A;  3UUA A;  1NUO A;  1QKU A;  4LBD A;  2AX6 A;  2ZLA A;  2ZK6 A;  2VSR A;  2XYJ A;  4G1Y A;  5EC9 A;  2ATH A;  4S0S A;  3P8X A;  5KCC A;  3G9E A;  4Y29 A;  4J5X C;  1YMT A;  4DQM A;  3F5C B;  4HEE X;  3E94 A;  4XUH A;  4G20 A;  1T7R A;  3AZ1 A;  3PCU A;  3CJW A;  4MGA A;  4JYH A;  3WFF A;  2P7Z A;  5DVS A;  3VT6 A;  3R5M A;  1L2J A;  5DZI A;  2VV3 A;  4IWC A;  4OHA A;  5DUH A;  3R29 A;  4OEA A;  3DCU A;  4N8R A;  4S14 A;  1XDK A;  2AX7 A;  3WFG A;  5C4T A;  5DV3 A;  5FQS A;  2HFP A;  4ZOM A;  4RWV A;  1GWX A;  3FLI A;  3L3X A;  4IWF A;  4RZE A;  5DZH A;  3TKC A;  1FM6 D;  2O4J A;  1SQN A;  1UHL B;  2NXX A;  3DR1 A;  5DX3 B;  3W0J A;  4IUI A;  3OMO A;  5DVV A;  5KRM A;  1FM6 A;  5DMC A;  1S0Z A;  2J14 A;  4MDD A;  5DIE A;  1N83 A;  5GID A;  4BCR A;  1ZUC A;  4ZJW A;  2NXX E;  4MG8 B;  2GPU A;  1T7T A;  5DV8 A;  2QZO B;  4DM8 A;  3OKI A;  2I4P A;  4XI3 A;  3S9S A;  2ZFX A;  2ZNQ A;  5C4O A;  1R1K D;  2YAT A;  2Q6R A;  3X31 A;  4M8H A;  2PIN A;  4R6S A;  4RAK A;  3W5P A;  4E2J A;  1R1K A;  3D5F A;  3BQD A;  1RJK A;  1T7F A;  3VT8 A;  1IE9 A;  3OMQ A;  3OZJ A;  2HAR A;  2ZKC A;  3OSI A;  1XP1 A;  5DKS A;  5DWE A;  5G3J A;  5KRA A;  5KYA A;  4EM9 A;  1YYE A;  3FS1 A;  4L96 A;  4PF3 A;  5KRL A;  3OOF A;  3RY9 A;  2H79 A;  4K7A A;  4WPF A;  3TX7 B;  2EWP A;  1A52 A;  2ZAS A;  3KMZ A;  4LNW A;  5DXB A;  4G1Z A;  3VI8 A;  1YIM A;  3LMP A;  3NSP A;  4OEZ A;  3L3Z A;  4OZT U;  2NPA A;  2Q5S A;  3QT0 A;  1X7E A;  2XKW A;  3V49 A;  2QXS A;  4IV4 A;  3H52 A;  3R5N A;  2AA7 A;  4WQP A;  5ICK A;  2V0V A;  2GPO A;  4MG7 B;  2AMA A;  2Q7K A;  4OIV A;  3F5C A;  1M13 A;  2QPY A;  5KCU A;  2PKL A;  4LNX A;  2QGT A;  4LTW A;  1MV9 A;  4TV1 B;  5GIC A;  1N4H A;  5KRO A;  3ET3 A;  3VJI A;  1RKH A;  1ZDU A;  2ACL A;  2B50 A;  2YJD A;  4JAZ A;  4EMA A;  3AUR A;  2ZNN A;  2ZXZ A;  4RFW A;  1DKF A;  4WVD A;  1G5Y A;  5G44 A;  1PK5 A;  3MNP A;  2Q5P A;  2QH6 A;  1ZH7 A;  2Q59 A;  2QSE A;  5EI1 A;  3A2I A;  3ZQT A;  1XOW A;  3KPZ A;  2Q60 A;  4IVW A;  2P7G A;  3PEQ A;  4POH A;  4ZNT A;  1UHL A;  4OZR U;  1SKX A;  5DX3 A;  2A3I A;  4DK7 A;  1NQ0 A;  4RZG A;  2AX8 A;  2PJL A;  4KZI A;  5F9B A;  3DZY A;  3A2J A;  4OIU A;  4RMD A;  5A86 A;  3D90 A;  4OFR A;  3IPS A;  4E4K A;  3K6P A;  4MGD A;  1XB7 A;  4JYG A;  1P93 A;  2BJ4 B;  2I0G A;  4WLB A;  2QZO A;  1XLS A;  3CTB A;  2O9I A;  4ITE A;  3VT9 A;  3VRT A;  4ZO1 B;  3UP0 A;  2YLY A;  5HYK A;  5KCT A;  3FUG A;  2Z4B A;  3IMY A;  2Q6S A;  1VJB A;  4G1D A;  1X7J A;  5HCV A;  3W5Q A;  2OAX A;  5DWI A;  4L98 A;  5DVC A;  1XLS E;  2IOK A;  5APK A;  2YFE A;  3LBD A;  1XVP A;  3OMM A;  3W5R A;  3DZU D;  1K4W A;  2AA5 A;  1MVC A;  2P1V A;  3GD2 A;  3L03 A;  2VV1 A;  3DZU A;  3SP6 A;  3CLD A;  5KYJ A;  2ABI A;  3GYT A;  3NOA A;  5I4V A;  2IHQ A;  3D24 A;  4OKB A;  5HJS A;  1OSH A;  3WMH A;  5H1E A;  5DMF A;  1HG4 A;  5DWG A;  3V9Y A;  1YUC A;  3B0R A;  4UDA A;  4PPS A;  4ZNH A;  5ETH A;  1NYX A;  3B67 A;  3OS8 A;  4PRG A;  4QJR A;  1U3Q A;  2YHD A;  3Q95 A;  3E7C A;  3ZR7 A;  1L2I A;  3HLV A;  3GN8 A;  1XQ3 A;  1DB1 A;  3AN4 A;  5DRM A;  2I4J A;  1NDE A;  4MG7 A;  2PIU A;  1MZN A;  4MG5 A;  3WT5 A;  4UDC A;  3B0W A;  3GWS X;  4OKW A;  3V3E A;  1RK3 A;  2ZBS A;  3VT4 A;  2HC4 A;  4TV1 A;  2YLO A;  4IA3 A;  4J5W C;  4MGB A;  2HWQ A;  3OS9 A;  4O8F A;  4A4W A;  1I38 A;  5JI0 D;  1LBD A;  1OVL B;  5JJM B;  4DM6 A;  3AFR A;  2ZY0 A;  5B5B A;  4XAO A;  5DZ1 A;  1FCX A;  2AMB A;  5KRF A;  5KRC A;  1M7W A;  4TUZ B;  3WGP A;  1TXI A;  3VN2 A;  3O1E A;  5E7V A;  1NQ2 A;  3CDS A;  2ZLC A;  2QR9 A;  3UVV A;  2P4Y A;  2PIP L;  2QAB A;  2R6W A;  2XYX A;  3DCT A;  3ET1 A;  4OED A;  4XUM A;  3P89 A;  5AVL A;  1Y9R A;  5DXQ A;  3OSW A;  4PVU A;  5DUG A;  4IA1 A;  1RKG A;  3ERT A;  3AN3 A;  4OJB A;  3VJT A;  1WM0 X;  1XZX X;  1U3S A;  4IU7 A;  3VTC A;  5DWJ A;  5E15 A;  4OZT E;  1S9Q A;  1XIU A;  3N00 A;  4RUO X;  1T76 A;  2BJ4 A;  2JFA B;  3RUT A;  5FQP A;  3W5T A;  4WHF A;  5AAV B;  3K8S A;  1NQ1 A;  4REF A;  1UOM A;  1X7B A;  4JL4 A;  1Z5X U;  1E3G A;  3JZC A;  3D6D A;  3W0H A;  4QE8 A;  3A9E B;  3WJ5 A;  4YT1 A;  1ZGY A; 
#chains in the Genus database with same CATH homology
 4OH5 A;  1OT7 A;  2GPP A;  5APH A;  2XYW A;  3H0A D;  3VT5 A;  3L0E A;  4RUP A;  4RME A;  4F9M A;  3A40 X;  5DU5 A;  2ZMH A;  3ZRA A;  3PRG A;  5DKB A;  3K23 A;  3OKH A;  5CJ6 A;  4ZNW A;  3OLF A;  3OAP A;  4S0T A;  4QE6 A;  5AWK A;  2G0G A;  1R5K A;  5L7G A;  5DK9 A;  3VT7 A;  2P7A A;  2Q5G A;  4YNK A;  2YLP A;  2FVJ A;  2VV4 B;  1NQ7 A;  3W0C A;  1RDT D;  4NIE A;  2QA8 B;  4UDD A;  5EHJ A;  5L7H A;  1QKM A;  5DXK A;  1RDT A;  1FD0 A;  3SZ1 A;  3U9Q A;  2QMV A;  2ZK5 A;  4G21 A;  4DOS A;  3G0W A;  5C4S A;  5G5W A;  2VV0 A;  5E1C A;  5FQV A;  3IXP D;  4A4V A;  4YPQ A;  5KRJ A;  2PIW A;  4R06 A;  5DZ0 A;  3D57 A;  3B0T A;  3CS6 A;  3IXP A;  1OVL A;  4IVY A;  5JJM A;  1H9U A;  3KDU A;  2YJA B;  3GZ9 A;  3HQ5 A;  3R8A A;  1ZAF A;  3V4A A;  3VRW A;  2I0J A;  3VRU A;  5DXG A;  3KYT A;  2ZXN A;  3DT3 A;  4PLD A;  1YOK A;  3F7D A;  3L0L A;  4OK1 A;  5KRK A;  5KRI A;  3X36 A;  3B3K A;  4ZN9 A;  1XV9 B;  4Q13 A;  5DP0 A;  3VTB A;  4RMC A;  5HZC A;  1PDU A;  1I7G A;  5LGA A;  5K13 A;  3PBA A;  5DYD A;  5AVI A;  4M8E A;  3B5R A;  2JFA A;  4WHG A;  3VT3 A;  5L7E A;  1U9E A;  4P6W A;  4REE A;  4G2I A;  2HB8 A;  5AAV A;  2AAX A;  3UUA B;  2AM9 A;  3V3Q A;  1U3R A;  4ZNS A;  4YMQ A;  2HVC A;  4FHI A;  5G45 A;  5IZ0 A;  2Q8S A;  4MG8 A;  2I4Z A;  3A9E A;  3OLL A;  3X1I A;  4IS8 A;  1GS4 A;  3W0Y A;  3P0U A;  1Z95 A;  4ZI1 A;  4G2H A;  3AX8 A;  5B41 A;  5HJP B;  2AO6 A;  5DRJ A;  5APJ A;  1T79 A;  1X7R A;  5JY3 A;  2G0H A;  3FUR A;  4N73 A;  5E0W A;  5DLR A;  4RZF A;  3HM1 A;  4E4Q A;  1S19 A;  5KD9 A;  4CSJ A;  3UUC A;  3VHW A;  3KFC A;  2HAM A;  4ZJR A;  2H77 A;  3A78 A;  4JGV A;  2F4B A;  4POJ A;  1I7I A;  1K74 D;  2P54 A;  4IQR A;  2B1Z A;  3OZ0 A;  2AB2 A;  2REW A;  2QA8 A;  2GIU A;  1LV2 A;  3T03 A;  1ZKY A;  1K74 A;  4J24 A;  5KRH A;  2Q6J A;  1PRG A;  4ONI A;  1XP9 A;  2BAW A;  2P15 A;  3GBK A;  4RUJ A;  5DKG A;  4B7W A;  3UP3 A;  2ZK4 A;  3B65 A;  3KMG A;  1PQ9 A;  2OVM A;  2ZVT A;  4OFU A;  2PIT A;  2AX9 A;  2AYR A;  3HVL A;  3VHV A;  4APU A;  4PWL A;  4PXM A;  5DXP A;  3ADX A;  5EIT A;  4J5X A;  1A28 A;  5GT4 A;  1FM9 D;  1NAV A;  2VST A;  5DUE A;  2GPV A;  3G8I A;  3UU7 B;  2QW4 A;  4QK4 A;  2ZMJ A;  1FM9 A;  1PQC A;  1YJE A;  1XPC A;  2V7C A;  3NSQ A;  4OKT A;  5C4U A;  1QKT A;  1T7M A;  3FC6 B;  1UPW A;  5IAW A;  1XV9 A;  1P8D A;  2B23 A;  3PO9 A;  5EGV A;  4NB6 A;  1G50 A;  3HC5 A;  3R2A A;  3ADS A;  1EXA A;  4ZN7 A;  3B1M A;  4OGH A;  3HO0 A;  3R8D A;  2AWH A;  2J7Y A;  3RUU A;  3CDP A;  4X1F A;  5KCE A;  3OS8 C;  2J4A A;  2OVH A;  2HB7 A;  2P1U A;  4FGY A;  4ITF A;  2VV2 A;  5DY8 A;  2ZK0 A;  2LBD A;  3ILZ A;  3VSO A;  5HYR A;  4PPP A;  4N1Y A;  5G46 A;  3L1B A;  2QE4 A;  2QA6 A;  3ADU A;  2HWR A;  4JYI A;  2G44 A;  4KZJ A;  5DYB A;  5HJP A;  1KNU A;  3RVF A;  2AXA A;  3CWD A;  5ACC A;  3HZF A;  1IE8 A;  3PLZ A;  4OH6 A;  2QTU A;  3B0Q A;  1R20 D;  2FAI A;  2YLQ A;  1YY4 A;  3KWY A;  2ACL B;  2AA6 A;  2Q70 A;  4J26 A;  3AUN A;  4R2U A;  1T73 A;  5KR9 A;  3CS4 A;  4IW8 A;  1M2Z A;  4NY9 A;  1R20 A;  3V9T A;  1DKF B;  1FCY A;  4OJ4 A;  3WT7 A;  1NAX A;  2E2R A;  4MG9 B;  3RLL A;  4Q50 A;  2GL8 A;  3W0I A;  1E3K A;  1T65 A;  4OKX A;  3H0A A;  2Q59 B;  5DXR A;  4HLW A;  3FAL B;  5AZT A;  2QGW A;  2ZK1 A;  3ADV A;  3IPQ A;  1FBY A;  2R40 D;  5KCF A;  5DID A;  5DXM A;  3CQV A;  5DI7 A;  1T5Z A;  2R40 A;  3IA6 A;  4QM0 A;  4N5G A;  4Q0A C;  3VRV A;  3UUD B;  4OZR E;  1NRL A;  2PRG A;  3AZ2 A;  5KCD A;  1T74 A;  4ZO1 X;  3HC6 A;  2OCF A;  4OLM A;  2FSZ A;  2QXM A;  1R6G A;  1Y0X X;  4MGD B;  2B1V A;  5DIG A;  3KBA A;  5DKE A;  2PIV A;  5DZ3 A;  1YIN A;  5G42 A;  3OSA A;  2XHS A;  1YA3 A;  2ZNO A;  1SR7 A;  4PP5 A;  1KV6 A;  1EXX A;  4LSJ A;  3B68 A;  2Q7J A;  2Q3Y A;  3A2H A;  3VJH A;  3ADW A;  4FNE A;  1XQC A;  2IOG A;  3FEI A;  3UU7 A;  1XP6 A;  2GP7 A;  3SP9 A;  1XVP B;  4K6I A;  4NUF A;  2PNU A;  3FC6 A;  4ZNV A;  2VV1 B;  2POB A;  4PLE A;  2AA2 A;  4TUZ A;  3B66 A;  5DTV A;  1S0X A;  3FEJ A;  5LWP A;  3VJS A;  4QL8 A;  3R8I A;  5DV6 A;  5E14 A;  3M7R A;  3OGT A;  1Q4X A;  3ET0 A;  1X78 A;  5AYG A;  1KKQ A;  2O4R A;  1GWR A;  3E00 D;  1K7L A;  5G43 A;  3HOD A;  3W0A A;  3IPU A;  2ZXM A;  1X76 A;  3Q95 B;  5DSH A;  5AWJ A;  5AZV A;  2GTK A;  3E00 A;  1TFC A;  2PIR A;  5AK2 A;  2PIX A;  4OEY A;  3TKM A;  2Q1V A;  2ZK2 A;  2JF9 A;  2W8Y A;  3W0G A;  2HAS A;  1ILG A;  1G2N A;  1OSV A;  1ERR A;  2OM9 A;  2POG A;  2Z4J A;  3KDT A;  3WJ4 A;  4XLD A;  4MGB B;  4RE8 A;  4DOR A;  1PZL A;  2ZNP A;  3DY6 A;  4CI5 A;  3OLS A;  4X1G A;  4IA7 A;  4KZM A;  1I37 A;  2HCD A;  2Q1H A;  1FCZ A;  1HJ1 A;  3V9V A;  1ERE A;  4FN9 A;  4MG9 A;  3VTD A;  4IW6 A;  5EJV A;  2OUZ A;  3O1D A;  4MGC A;  4MGA B;  5SYZ A;  2ZMI A;  3FAL A;  1ILH A;  5KCW A;  3P88 A;  3UVV B;  4XHD A;  3G8O A;  5E0X A;  3JZB A;  3DZY D;  3KMR A;  3UUD A;  2VV4 A;  2ZK3 A;  4XT9 A;  1XDK B;  3RLJ A;  1GWQ A;  1PQ6 A;  1PCG A;  2NV7 A;  5DXE A;  1G1U A;  3VHU A;  2Q7I A;  1N46 A;  1NHZ A;  3CS8 A;  4ZNU A;  1YOW A;  2PIO A;  5IXK A;  1ZEO A;  4IA2 A;  1XAP A;  4PP6 A;  5L11 A;  4CI4 A;  1SJ0 A;  3ADT A;  2JJ3 A;  4IV2 A;  1Y0S A;  2Q61 A;  3K22 A;  3MNE A;  1QKN A;  4PP3 A;  3TY0 A;  3EYB A;  1T63 A;  4OAR A;  1Z5X E;  3A3Z X;  2OZ7 A;  2NW4 A;  2P1T A;  3MNO A;  4J5W A;  1UPV A;  4OIL A;  3WT6 A;  5AAU A;  2PIQ A;  1ZDT A;  3WWR A;  4P6X A;  3GYU A;  3WTQ A;  3ZRB A;  3X1H A;  4OJ9 A;  3VSP A;  2R6Y A;  2GWX A;  3OOK A;  4FHH A;  2J7X A;  4UDB A;  5DL4 A;  5E19 A;  5FQR A;  4A2J A;  3AUQ A;  5GIE A;  4K4J A;  2HBH A;  4XTA A;  2ZL9 A;  3ET2 A;  1XNX A;  3L0J A;  5FQT A;  1S9P A;  2G5O A;  2Q7L A;  3OMP A;  4S15 A;  4NQA B;  1XNN A;  3GWX A;  3BC5 A;  5DWL A;  4DK8 A;  3BEJ A;  4DMA A;  1BSX A;  2QNV A;  3AZ3 A;  5DXB B;  1XJ7 A;  5M96 A;  3ERD A;  3FXV A;  3OMK A;  1YP0 A;  4MG6 A;  4OC7 A;  3UUA A;  1NUO A;  1QKU A;  4LBD A;  2AX6 A;  2ZLA A;  2ZK6 A;  2VSR A;  2XYJ A;  4G1Y A;  5EC9 A;  2ATH A;  4S0S A;  3P8X A;  5KCC A;  3G9E A;  4Y29 A;  4J5X C;  1YMT A;  4DQM A;  3F5C B;  4HEE X;  3E94 A;  4XUH A;  4G20 A;  1T7R A;  3AZ1 A;  3PCU A;  3CJW A;  4MGA A;  4JYH A;  3WFF A;  2P7Z A;  5DVS A;  3VT6 A;  3R5M A;  1L2J A;  5DZI A;  2VV3 A;  4IWC A;  4OHA A;  5DUH A;  3R29 A;  4OEA A;  3DCU A;  4N8R A;  4S14 A;  1XDK A;  2AX7 A;  3WFG A;  5C4T A;  5DV3 A;  5FQS A;  2HFP A;  4ZOM A;  4RWV A;  1GWX A;  3FLI A;  3L3X A;  4IWF A;  4RZE A;  5DZH A;  3TKC A;  1FM6 D;  2O4J A;  1SQN A;  1UHL B;  2NXX A;  3DR1 A;  5DX3 B;  3W0J A;  4IUI A;  3OMO A;  5DVV A;  5KRM A;  1FM6 A;  5DMC A;  1S0Z A;  2J14 A;  4MDD A;  5DIE A;  1N83 A;  5GID A;  4BCR A;  1ZUC A;  4ZJW A;  2NXX E;  4MG8 B;  2GPU A;  1T7T A;  5DV8 A;  2QZO B;  4DM8 A;  3OKI A;  2I4P A;  4XI3 A;  3S9S A;  2ZFX A;  2ZNQ A;  5C4O A;  1R1K D;  2YAT A;  2Q6R A;  3X31 A;  4M8H A;  2PIN A;  4R6S A;  4RAK A;  3W5P A;  4E2J A;  1R1K A;  3D5F A;  3BQD A;  1RJK A;  1T7F A;  3VT8 A;  1IE9 A;  3OMQ A;  3OZJ A;  2HAR A;  2ZKC A;  3OSI A;  1XP1 A;  5DKS A;  5DWE A;  5G3J A;  5KRA A;  5KYA A;  4EM9 A;  1YYE A;  3FS1 A;  4L96 A;  4PF3 A;  5KRL A;  3OOF A;  3RY9 A;  2H79 A;  4K7A A;  4WPF A;  3TX7 B;  2EWP A;  1A52 A;  2ZAS A;  3KMZ A;  4LNW A;  5DXB A;  4G1Z A;  3VI8 A;  1YIM A;  3LMP A;  3NSP A;  4OEZ A;  3L3Z A;  4OZT U;  2NPA A;  2Q5S A;  3QT0 A;  1X7E A;  2XKW A;  3V49 A;  2QXS A;  4IV4 A;  3H52 A;  3R5N A;  2AA7 A;  4WQP A;  5ICK A;  2V0V A;  2GPO A;  4MG7 B;  2AMA A;  2Q7K A;  4OIV A;  3F5C A;  1M13 A;  2QPY A;  5KCU A;  2PKL A;  4LNX A;  2QGT A;  4LTW A;  1MV9 A;  4TV1 B;  5GIC A;  1N4H A;  5KRO A;  3ET3 A;  3VJI A;  1RKH A;  1ZDU A;  2ACL A;  2B50 A;  2YJD A;  4JAZ A;  4EMA A;  3AUR A;  2ZNN A;  2ZXZ A;  4RFW A;  1DKF A;  4WVD A;  1G5Y A;  5G44 A;  1PK5 A;  3MNP A;  2Q5P A;  2QH6 A;  1ZH7 A;  2Q59 A;  2QSE A;  5EI1 A;  3A2I A;  3ZQT A;  1XOW A;  3KPZ A;  2Q60 A;  4IVW A;  2P7G A;  3PEQ A;  4POH A;  4ZNT A;  1UHL A;  4OZR U;  1SKX A;  5DX3 A;  2A3I A;  4DK7 A;  1NQ0 A;  4RZG A;  2AX8 A;  2PJL A;  4KZI A;  5F9B A;  3DZY A;  3A2J A;  4OIU A;  4RMD A;  5A86 A;  3D90 A;  4OFR A;  3IPS A;  4E4K A;  3K6P A;  4MGD A;  1XB7 A;  4JYG A;  1P93 A;  2BJ4 B;  2I0G A;  4WLB A;  2QZO A;  1XLS A;  3CTB A;  2O9I A;  4ITE A;  3VT9 A;  3VRT A;  4ZO1 B;  3UP0 A;  2YLY A;  5HYK A;  5KCT A;  3FUG A;  2Z4B A;  3IMY A;  2Q6S A;  1VJB A;  4G1D A;  1X7J A;  5HCV A;  3W5Q A;  2OAX A;  5DWI A;  4L98 A;  5DVC A;  1XLS E;  2IOK A;  5APK A;  2YFE A;  3LBD A;  1XVP A;  3OMM A;  3W5R A;  3DZU D;  1K4W A;  2AA5 A;  1MVC A;  2P1V A;  3GD2 A;  3L03 A;  2VV1 A;  3DZU A;  3SP6 A;  3CLD A;  5KYJ A;  2ABI A;  3GYT A;  3NOA A;  5I4V A;  2IHQ A;  3D24 A;  4OKB A;  5HJS A;  1OSH A;  3WMH A;  5H1E A;  5DMF A;  1HG4 A;  5DWG A;  3V9Y A;  1YUC A;  3B0R A;  4UDA A;  4PPS A;  4ZNH A;  5ETH A;  1NYX A;  3B67 A;  3OS8 A;  4PRG A;  4QJR A;  1U3Q A;  2YHD A;  3Q95 A;  3E7C A;  3ZR7 A;  1L2I A;  3HLV A;  3GN8 A;  1XQ3 A;  1DB1 A;  3AN4 A;  5DRM A;  2I4J A;  1NDE A;  4MG7 A;  2PIU A;  1MZN A;  4MG5 A;  3WT5 A;  4UDC A;  3B0W A;  3GWS X;  4OKW A;  3V3E A;  1RK3 A;  2ZBS A;  3VT4 A;  2HC4 A;  4TV1 A;  2YLO A;  4IA3 A;  4J5W C;  4MGB A;  2HWQ A;  3OS9 A;  4O8F A;  4A4W A;  1I38 A;  5JI0 D;  1LBD A;  1OVL B;  5JJM B;  4DM6 A;  3AFR A;  2ZY0 A;  5B5B A;  4XAO A;  5DZ1 A;  1FCX A;  2AMB A;  5KRF A;  5KRC A;  1M7W A;  4TUZ B;  3WGP A;  1TXI A;  3VN2 A;  3O1E A;  5E7V A;  1NQ2 A;  3CDS A;  2ZLC A;  2QR9 A;  3UVV A;  2P4Y A;  2PIP L;  2QAB A;  2R6W A;  2XYX A;  3DCT A;  3ET1 A;  4OED A;  4XUM A;  3P89 A;  5AVL A;  1Y9R A;  5DXQ A;  3OSW A;  4PVU A;  5DUG A;  4IA1 A;  1RKG A;  3ERT A;  3AN3 A;  4OJB A;  3VJT A;  1WM0 X;  1XZX X;  1U3S A;  4IU7 A;  3VTC A;  5DWJ A;  5E15 A;  4OZT E;  1S9Q A;  1XIU A;  3N00 A;  4RUO X;  1T76 A;  2BJ4 A;  2JFA B;  3RUT A;  5FQP A;  3W5T A;  4WHF A;  5AAV B;  3K8S A;  1NQ1 A;  4REF A;  1UOM A;  1X7B A;  4JL4 A;  1Z5X U;  1E3G A;  3JZC A;  3D6D A;  3W0H A;  4QE8 A;  3A9E B;  3WJ5 A;  4YT1 A;  1ZGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...