4ZI1A

Human estrogen receptor beta ligand-binding domain in complex with kb095285 and cia12 coactivator peptide
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
230
Chain Sequence
ALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSADSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title TO BE PUBLISHED
rcsb
molecule keywords Estrogen receptor beta
molecule tags Signaling protein
source organism Homo sapiens
total genus 90
structure length 230
sequence length 241
ec nomenclature
pdb deposition date 2015-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4zi1A00
1QKTA 1NQ1A 2QZOA 3DY6A 1PCGA 2A3IA 4XI3A 2P15A 4ZNHA 3JZBA 3ZQTA 2AO6A 2YLOA 4EMAA 4KZIA 3R8IA 3HVLA 2AXAA 5DUGA 2HFPA 3KPZA 2ZK6A 1X7RA 1FD0A 4IA1A 1SQNA 4PPPA 4RZEA 4JL4A 3H0AA 4IW8A 2ZK5A 4J5WA 3GWSX 1YINA 4YNKA 5DUEA 4MG6A 5DWLA 5KCDA 1PZLA 5DU5A 3P88A 4PLDA 3W5PA 3RY9A 1XP6A 2AYRA 3R8AA 1T7FA 1XV9A 3R5NA 3V9YA 3IA6A 2ZNNA 1UPWA 2Q6JA 1FM9A 2JJ3A 4PP3A 2QTUA 1NAXA 1R6GA 5DIEA 5KR9A 2ZMJA 3B0WA 4JYIA 5DXRA 3VT5A 3OS8A 1NAVA 5KRCA 1FCZA 3IPQA 4XT9A 3W5QA 3CJWA 1ZKYA 4R06A 5DXMA 3VTBA 1PDUA 2QMVA 3HM1A 4OJ4A 1FM6A 5E0WA 1A52A 4MG8B 3OMMA 5DLRA 5DP0A 2ZY0A 1EXAA 3OMOA 4MG9B 1I7IA 2AM9A 2R6WA 5GIEA 5JI0D 3OOFA 5HJPB 1R5KA 4N5GA 5JY3A 5E19A 2Q5GA 1Q4XA 5APKA 1T79A 2QSEA 2I4JA 3TY0A 1FCYA 4MG8A 1FBYA 4MG9A 4G1YA 4OZRU 2OM9A 4O8FA 3AZ1A 4WLBA 3DR1A 5DRMA 5DMCA 3SZ1A 4E4QA 2PJLA 3B66A 1X7BA 4G21A 5CJ6A 2QGWA 4WVDA 3VTCA 3W5RA 3L03A 1S19A 3WJ5A 1TFCA 3W0CA 4RFWA 5B5BA 2NV7A 3VJTA 5DIGA 1T73A 2B50A 2GTKA 2GPUA 3K22A 4G1ZA 2GPOA 2Q1HA 1XDKB 2PIUA 1MV9A 3NSQA 4K6IA 4OKWA 4PF3A 4IA2A 3AN4A 1PK5A 4UDBA 1YOKA 1HJ1A 2Q5SA 3R2AA 5KCFA 2HWRA 4MGCA 1RKHA 1ZGYA 1R20D 1XDKA 1M13A 4R6SA 5HZCA 3FALA 2QPYA 1I37A 1NQ2A 4TUZB 2AB2A 4XTAA 5GIDA 1G2NA 3A3ZX 2Q6SA 5EJVA 1L2IA 3W5TA 4ZNSA 5DWEA 1DKFB 2NXXA 5DIDA 3FXVA 1NYXA 3KBAA 4DORA 1I7GA 4TUZA 2BJ4B 5AVIA 1OSVA 3L1BA 1XPCA 5HYKA 2VSTA 2FAIA 3ET1A 5DX3B 1DKFA 4EM9A 2HCDA 3B1MA 5APHA 1GWQA 1IE8A 3D24A 3L0EA 5DWIA 3KFCA 2BJ4A 5DZ3A 3FC6B 4ZNWA 3PBAA 4ZI1A 2YHDA 3IXPA 5DUHA 3A9EB 5AWJA 3V4AA 2I4PA 1R1KA 5KRMA 5ACCA 5M96A 2NW4A 2FSZA 5KCTA 1RKGA 2PIWA 1S0ZA 3FC6A 1T7MA 4X1GA 2QH6A 5EHJA 2LBDA 3P8XA 2Q3YA 3KMGA 3OSWA 2P1VA 2G0HA 1Y9RA 2Q7IA 1ZDUA 4OEAA 4WQPA 3VHWA 2QA6A 3WMHA 4DMAA 3S9SA 1GS4A 4J5XC 3P0UA 4MGAB 3FUGA 4LNXA 5DVCA 3X31A 2PITA 3GWXA 1S9QA 1ZAFA 4OKBA 5DV3A 5DV6A 3UP3A 2ZNOA 3CQVA 3D57A 3VT3A 3WFFA 2IHQA 3UVVB 2ABIA 1GWXA 5G5WA 4P6XA 2JFAB 3G8IA 1P8DA 1DB1A 4MGAA 4OGHA 5DVSA 3OKIA 3ADSA 5GT4A 3V3EA 5DZ0A 2AX8A 2ZXNA 4QK4A 2PRGA 5DZIA 4FHHA 3LMPA 1LV2A 2IOKA 2ZK2A 4KZJA 3UVVA 5IAWA 3KDUA 2JFAA 3KMRA 3L3XA 1VJBA 1K74A 3X36A 2ZMIA 3KWYA 2POGA 3H0AD 3ERDA 3IPUA 3MNPA 4OLMA 2B1VA 2HC4A 3E00A 1U3SA 4RMCA 3UU7A 4E4KA 4F9MA 2PINA 2QXSA 3BEJA 2O9IA 3HO0A 4IWCA 5L7HA 3VSPA 1FM9D 5L11A 4QE8A 4LBDA 1UHLB 3F7DA 3A78A 1ZUCA 1A28A 3ADWA 3K23A 4MGDB 3SP9A 5L7GA 3DZYA 3DCTA 4RUJA 2GPVA 4DQMA 4MG5A 2PIOA 4YMQA 2ZLCA 3CLDA 3OMPA 3VRUA 2Q61A 3HODA 5DYBA 4BCRA 1XB7A 1IE9A 3FEJA 4RWVA 5E1CA 5KCWA 3TX7B 3H52A 3GN8A 4MGDA 1FM6D 4FHIA 4JYGA 1MVCA 5KROA 5K13A 2P7AA 3AZ3A 1GWRA 2JF9A 1XQ3A 2ZNQA 3CS6A 3E7CA 5KRIA 2ACLB 3WJ4A 1X78A 4IWFA 1T7TA 3W0HA 3MNOA 3NOAA 4OHAA 3RVFA 4IQRA 2QXMA 3VJHA 5KRJA 4CI5A 2H79A 3LBDA 2ZK3A 3B68A 3CDSA 2ACLA 5E15A 3K8SA 1XLSE 3RLJA 3V3QA 4ZNUA 3UUDB 2ZXMA 2XKWA 3WT5A 3R29A 4RZFA 3DZUA 3OMKA 1NRLA 4XLDA 3UUAB 4POJA 2VV1B 5HJSA 1HG4A 3B0TA 5AAUA 4OZRE 3VJSA 3JZCA 1KV6A 3VRTA 3V49A 2GP7A 3F5CB 4LSJA 5HJPA 3OZ0A 4OZTU 2J4AA 3UUAA 4UDCA 5DZ1A 2ZMHA 2VV1A 4P6WA 5KCEA 3RUUA 1WM0X 2POBA 4ZJWA 3VRWA 4OARA 2GWXA 2XHSA 3GZ9A 4DM8A 3W0IA 1K7LA 2AWHA 3BC5A 2GPPA 4IVWA 3W0YA 5FQPA 3GYTA 5F9BA 3R8DA 2HARA 2ATHA 2W8YA 3ADUA 5KYJA 3EYBA 2ZLAA 2EWPA 5HYRA 1BSXA 4PRGA 1XOWA 2AA6A 3T03A 5FQRA 3A2HA 5AZVA 4ZJRA 3OGTA 1YIMA 1E3GA 1YP0A 2HWQA 2J14A 2Q5PA 4S15A 2AX9A 2Q60A 4QM0A 1XP1A 2P7GA 2HAMA 1QKMA 2AAXA 3U9QA 4RUOX 4G20A 5KCUA 1YOWA 3IXPD 2R40A 2YLYA 4KZMA 1QKNA 4OEYA 4ZO1B 5DI7A 1R1KD 4A2JA 3FLIA 2I4ZA 4NB6A 3ET3A 3RUTA 3KDTA 5KRLA 1NUOA 2PNUA 1FCXA 3VT4A 1KKQA 2IOGA 3A40X 1YA3A 3B0RA 1T63A 3VHVA 5DWJA 4ITEA 5L7EA 1ERRA 1QKUA 1SJ0A 1U9EA 2Q1VA 4ZNVA 4DK7A 3ADXA 3AZ2A 5DL4A 2OZ7A 2AX7A 4HEEX 4JAZA 5DX3A 2VV4B 4REEA 2Q7JA 4J26A 4MG7B 3OLFA 1T65A 4X1FA 4YPQA 4NUFA 1G50A 3OS9A 1ZDTA 3R5MA 5EITA 3A9EA 2OUZA 4G2IA 1L2JA 4A4VA 4MG7A 2J7XA 2O4JA 5G43A 3W0JA 1XVPB 3VT7A 2YJDA 3WGPA 4QJRA 4RAKA 4OILA 5DKBA 1M7WA 5DSHA 1K74D 1NDEA 2GL8A 2YLPA 4FNEA 3P89A 2ZBSA 5KRKA 3DCUA 1XVPA 4WHFA 3OOKA 3AURA 3HC6A 3AFRA 3OMQA 5DYDA 3X1HA 3PLZA 4J5WC 3VT6A 2ZK0A 3CS8A 3VHUA 3OSIA 2E2RA 3E00D 2J7YA 1OVLB 5DKSA 2PIRA 5DXGA 4J24A 4APUA 1Z5XU 4XUHA 3FEIA 2ZFXA 2XYXA 4OEZA 3VI8A 2I0JA 4ONIA 5LGAA 2ZNPA 3OKHA 3DZYD 2O4RA 3OZJA 1G1UA 3WT6A 4ZNTA 5IZ0A 5KRFA 1OVLA 5SYZA 5C4SA 3ERTA 4S0TA 3OS8C 5I4VA 4YT1A 5DXPA 2R6YA 3RLLA 2HB7A 3PEQA 5JJMB 4NIEA 4PWLA 4RUPA 4OJ9A 2G0GA 3ADVA 4CSJA 2G44A 4UDDA 2NXXE 3AN3A 1XNNA 4S0SA 5C4OA 3GD2A 2YLQA 1M2ZA 3L0JA 3OLLA 4N73A 4PP6A 3CWDA 4WHGA 2HASA 4IW6A 4LTWA 1T7RA 4S14A 2ZASA 4OKTA 5B41A 1NHZA 5G44A 5G45A 1Y0XX 1ILHA 5DY8A 1I38A 5G3JA 3CTBA 1UHLA 5DTVA 1RJKA 4IA3A 2QE4A 2NPAA 3TKCA 2V7CA 3VRVA 5IXKA 3OAPA 4IUIA 3DZUD 2Q70A 5H1EA 2PIQA 3B3KA 2QR9A 2P1TA 2PIVA 4G1DA 2H77A 4IVYA 4J5XA 4OIVA 3AX8A 2Q7KA 3ZRAA 3UP0A 1X76A 3WFGA 5HCVA 3CDPA 5AYGA 1XV9B 3OSAA 4IV2A 4ZOMA 1PQCA 2I0GA 1XZXX 5AK2A 3B65A 1EXXA 3B67A 1YYEA 1UPVA 4UDAA 2HBHA 3FS1A 4OIUA 4Q13A 5DVVA 1PQ9A 5AVLA 4E2JA 4OZTE 3UUDA 1LBDA 3WT7A 2P7ZA 5DV8A 2PKLA 3VT8A 3K6PA 5A86A 3N00A 2B1ZA 4QE6A 3DT3A 3O1DA 1UOMA 4L96A 5KRAA 4TV1B 1E3KA 1X7EA 3QT0A 3F5CA 3G9EA 5AAVB 2B23A 4PVUA 4REFA 2ZKCA 2AA5A 5G46A 4Q50A 3E94A 1XQCA 2R40D 2AMBA 4TV1A 4XAOA 5G42A 5AAVA 4Y29A 2AX6A 2ZK4A 1OSHA 3HQ5A 2Q59B 5GICA 1XIUA 2GIUA 3D5FA 2QNVA 4ITFA 4NY9A 3WWRA 5DXEA 2ZK1A 2PIPL 4NQAB 1N4HA 3O1EA 4XHDA 3L3ZA 4M8HA 5APJA 3MNEA 1EREA 2VV2A 2Q59A 3VN2A 1MZNA 3KMZA 1PRGA 2Q7LA 3D90A 4WPFA 3VTDA 4OC7A 1NQ7A 3V9VA 1S9PA 3ET0A 3FALB 2XYJA 3ZR7A 3KYTA 5DK9A 5KRHA 3VJIA 4OKXA 3VT9A 1U3QA 5LWPA 5C4UA 2AA2A 3HZFA 4PP5A 4M8EA 5E14A 2VSRA 1N83A 2OCFA 3AUNA 4IS8A 4PLEA 4XUMA 3PCUA 5KD9A 3L0LA 4PXMA 2P1UA 4OH5A 2AA7A 2VV0A 4ZO1X 5DMFA 5AZTA 2AMAA 4DOSA 2P4YA 1P93A 1H9UA 2V0VA 3D6DA 4OFRA 1SKXA 2YJAB 4PPSA 1ILGA 1ZEOA 4IU7A 2OVMA 2G5OA 4G2HA 2VV4A 5FQSA 1R20A 2QGTA 5EC9A 4IA7A 5C4TA 4K7AA 1U3RA 3B5RA 2BAWA 4FGYA 3A2IA 3Q95B 4MDDA 1OT7A 5DKEA 3AUQA 3A2JA 5KYAA 1XAPA 5DRJA 3ILZA 4K4JA 5FQVA 2ZVTA 1X7JA 2Z4BA 3ADTA 3BQDA 2F4BA 4OJBA 5ICKA 4B7WA 3TKMA 3Q95A 4IV4A 4Q0AC 4OEDA 3SP6A 2Z4JA 4N8RA 5AWKA 4JGVA 3ET2A 1Z5XE 1T5ZA 5KCCA 2YFEA 5DXQA 4RMEA 1XP9A 5EGVA 4ZN9A 3CS4A 5E7VA 1Y0SA 4RMDA 3HC5A 4RZGA 5DWGA 5DXBB 3PO9A 1YY4A 2QABA 2REWA 3IPSA 4MGBB 5DKGA 1XLSA 1T74A 1ZH7A 2HB8A 2XYWA 3GYUA 2ZXZA 3HLVA 1SR7A 1XNXA 3G8OA 3OLSA 2HVCA 4POHA 5DXKA 3ZRBA 4QL8A 2ZL9A 5DZHA 4A4WA 4RE8A 3UUCA 1S0XA 2YATA 3FURA 5DXBA 4L98A 4LNWA 1RK3A 1G5YA 1XJ7A 1YMTA 4MGBA 1KNUA 1K4WA 1RDTD 2QA8B 4JYHA 4N1YA 5FQTA 5EI1A 2FVJA 1NQ0A 3PRGA 2Q6RA 3IMYA 4R2UA 1Z95A 2PIXA 3WTQA 4OK1A 5JJMA 1T76A 3V9TA 4FN9A 3VSOA 2P54A 3G0WA 1PQ6A 2QA8A 4HLWA 3B0QA 4ZN7A 1YJEA 4OH6A 1N46A 2OVHA 3NSPA 3UU7B 3W0AA 4CI4A 1YUCA 2Q8SA 2VV3A 2QZOB 4DM6A 3X1IA 3M7RA 2OAXA 1RDTA 3W0GA 3GBKA 1TXIA 4DK8A 5E0XA 5ETHA 2QW4A 4OFUA
chains in the Genus database with same CATH superfamily
1QKTA 1NQ1A 2QZOA 3DY6A 1PCGA 2A3IA 4XI3A 2P15A 4ZNHA 3JZBA 3ZQTA 2AO6A 2YLOA 4EMAA 4KZIA 3R8IA 3HVLA 2AXAA 5DUGA 2HFPA 3KPZA 2ZK6A 1X7RA 1FD0A 4IA1A 1SQNA 4PPPA 4RZEA 4JL4A 3H0AA 4IW8A 2ZK5A 4J5WA 3GWSX 1YINA 4YNKA 5DUEA 4MG6A 5DWLA 5KCDA 1PZLA 5DU5A 3P88A 4PLDA 3W5PA 3RY9A 1XP6A 2AYRA 3R8AA 1T7FA 1XV9A 3R5NA 3V9YA 3IA6A 2ZNNA 1UPWA 2Q6JA 1FM9A 2JJ3A 4PP3A 2QTUA 1NAXA 1R6GA 5DIEA 5KR9A 2ZMJA 3B0WA 4JYIA 5DXRA 3VT5A 3OS8A 1NAVA 5KRCA 1FCZA 3IPQA 4XT9A 3W5QA 3CJWA 1ZKYA 4R06A 5DXMA 3VTBA 1PDUA 2QMVA 3HM1A 4OJ4A 1FM6A 5E0WA 1A52A 4MG8B 3OMMA 5DLRA 5DP0A 2ZY0A 1EXAA 3OMOA 4MG9B 1I7IA 2AM9A 2R6WA 5GIEA 5JI0D 3OOFA 5HJPB 1R5KA 4N5GA 5JY3A 5E19A 2Q5GA 1Q4XA 5APKA 1T79A 2QSEA 2I4JA 3TY0A 1FCYA 4MG8A 1FBYA 4MG9A 4G1YA 4OZRU 2OM9A 4O8FA 3AZ1A 4WLBA 3DR1A 5DRMA 5DMCA 3SZ1A 4E4QA 2PJLA 3B66A 1X7BA 4G21A 5CJ6A 2QGWA 4WVDA 3VTCA 3W5RA 3L03A 1S19A 3WJ5A 1TFCA 3W0CA 4RFWA 5B5BA 2NV7A 3VJTA 5DIGA 1T73A 2B50A 2GTKA 2GPUA 3K22A 4G1ZA 2GPOA 2Q1HA 1XDKB 2PIUA 1MV9A 3NSQA 4K6IA 4OKWA 4PF3A 4IA2A 3AN4A 1PK5A 4UDBA 1YOKA 1HJ1A 2Q5SA 3R2AA 5KCFA 2HWRA 4MGCA 1RKHA 1ZGYA 1R20D 1XDKA 1M13A 4R6SA 5HZCA 3FALA 2QPYA 1I37A 1NQ2A 4TUZB 2AB2A 4XTAA 5GIDA 1G2NA 3A3ZX 2Q6SA 5EJVA 1L2IA 3W5TA 4ZNSA 5DWEA 1DKFB 2NXXA 5DIDA 3FXVA 1NYXA 3KBAA 4DORA 1I7GA 4TUZA 2BJ4B 5AVIA 1OSVA 3L1BA 1XPCA 5HYKA 2VSTA 2FAIA 3ET1A 5DX3B 1DKFA 4EM9A 2HCDA 3B1MA 5APHA 1GWQA 1IE8A 3D24A 3L0EA 5DWIA 3KFCA 2BJ4A 5DZ3A 3FC6B 4ZNWA 3PBAA 4ZI1A 2YHDA 3IXPA 5DUHA 3A9EB 5AWJA 3V4AA 2I4PA 1R1KA 5KRMA 5ACCA 5M96A 2NW4A 2FSZA 5KCTA 1RKGA 2PIWA 1S0ZA 3FC6A 1T7MA 4X1GA 2QH6A 5EHJA 2LBDA 3P8XA 2Q3YA 3KMGA 3OSWA 2P1VA 2G0HA 1Y9RA 2Q7IA 1ZDUA 4OEAA 4WQPA 3VHWA 2QA6A 3WMHA 4DMAA 3S9SA 1GS4A 4J5XC 3P0UA 4MGAB 3FUGA 4LNXA 5DVCA 3X31A 2PITA 3GWXA 1S9QA 1ZAFA 4OKBA 5DV3A 5DV6A 3UP3A 2ZNOA 3CQVA 3D57A 3VT3A 3WFFA 2IHQA 3UVVB 2ABIA 1GWXA 5G5WA 4P6XA 2JFAB 3G8IA 1P8DA 1DB1A 4MGAA 4OGHA 5DVSA 3OKIA 3ADSA 5GT4A 3V3EA 5DZ0A 2AX8A 2ZXNA 4QK4A 2PRGA 5DZIA 4FHHA 3LMPA 1LV2A 2IOKA 2ZK2A 4KZJA 3UVVA 5IAWA 3KDUA 2JFAA 3KMRA 3L3XA 1VJBA 1K74A 3X36A 2ZMIA 3KWYA 2POGA 3H0AD 3ERDA 3IPUA 3MNPA 4OLMA 2B1VA 2HC4A 3E00A 1U3SA 4RMCA 3UU7A 4E4KA 4F9MA 2PINA 2QXSA 3BEJA 2O9IA 3HO0A 4IWCA 5L7HA 3VSPA 1FM9D 5L11A 4QE8A 4LBDA 1UHLB 3F7DA 3A78A 1ZUCA 1A28A 3ADWA 3K23A 4MGDB 3SP9A 5L7GA 3DZYA 3DCTA 4RUJA 2GPVA 4DQMA 4MG5A 2PIOA 4YMQA 2ZLCA 3CLDA 3OMPA 3VRUA 2Q61A 3HODA 5DYBA 4BCRA 1XB7A 1IE9A 3FEJA 4RWVA 5E1CA 5KCWA 3TX7B 3H52A 3GN8A 4MGDA 1FM6D 4FHIA 4JYGA 1MVCA 5KROA 5K13A 2P7AA 3AZ3A 1GWRA 2JF9A 1XQ3A 2ZNQA 3CS6A 3E7CA 5KRIA 2ACLB 3WJ4A 1X78A 4IWFA 1T7TA 3W0HA 3MNOA 3NOAA 4OHAA 3RVFA 4IQRA 2QXMA 3VJHA 5KRJA 4CI5A 2H79A 3LBDA 2ZK3A 3B68A 3CDSA 2ACLA 5E15A 3K8SA 1XLSE 3RLJA 3V3QA 4ZNUA 3UUDB 2ZXMA 2XKWA 3WT5A 3R29A 4RZFA 3DZUA 3OMKA 1NRLA 4XLDA 3UUAB 4POJA 2VV1B 5HJSA 1HG4A 3B0TA 5AAUA 4OZRE 3VJSA 3JZCA 1KV6A 3VRTA 3V49A 2GP7A 3F5CB 4LSJA 5HJPA 3OZ0A 4OZTU 2J4AA 3UUAA 4UDCA 5DZ1A 2ZMHA 2VV1A 4P6WA 5KCEA 3RUUA 1WM0X 2POBA 4ZJWA 3VRWA 4OARA 2GWXA 2XHSA 3GZ9A 4DM8A 3W0IA 1K7LA 2AWHA 3BC5A 2GPPA 4IVWA 3W0YA 5FQPA 3GYTA 5F9BA 3R8DA 2HARA 2ATHA 2W8YA 3ADUA 5KYJA 3EYBA 2ZLAA 2EWPA 5HYRA 1BSXA 4PRGA 1XOWA 2AA6A 3T03A 5FQRA 3A2HA 5AZVA 4ZJRA 3OGTA 1YIMA 1E3GA 1YP0A 2HWQA 2J14A 2Q5PA 4S15A 2AX9A 2Q60A 4QM0A 1XP1A 2P7GA 2HAMA 1QKMA 2AAXA 3U9QA 4RUOX 4G20A 5KCUA 1YOWA 3IXPD 2R40A 2YLYA 4KZMA 1QKNA 4OEYA 4ZO1B 5DI7A 1R1KD 4A2JA 3FLIA 2I4ZA 4NB6A 3ET3A 3RUTA 3KDTA 5KRLA 1NUOA 2PNUA 1FCXA 3VT4A 1KKQA 2IOGA 3A40X 1YA3A 3B0RA 1T63A 3VHVA 5DWJA 4ITEA 5L7EA 1ERRA 1QKUA 1SJ0A 1U9EA 2Q1VA 4ZNVA 4DK7A 3ADXA 3AZ2A 5DL4A 2OZ7A 2AX7A 4HEEX 4JAZA 5DX3A 2VV4B 4REEA 2Q7JA 4J26A 4MG7B 3OLFA 1T65A 4X1FA 4YPQA 4NUFA 1G50A 3OS9A 1ZDTA 3R5MA 5EITA 3A9EA 2OUZA 4G2IA 1L2JA 4A4VA 4MG7A 2J7XA 2O4JA 5G43A 3W0JA 1XVPB 3VT7A 2YJDA 3WGPA 4QJRA 4RAKA 4OILA 5DKBA 1M7WA 5DSHA 1K74D 1NDEA 2GL8A 2YLPA 4FNEA 3P89A 2ZBSA 5KRKA 3DCUA 1XVPA 4WHFA 3OOKA 3AURA 3HC6A 3AFRA 3OMQA 5DYDA 3X1HA 3PLZA 4J5WC 3VT6A 2ZK0A 3CS8A 3VHUA 3OSIA 2E2RA 3E00D 2J7YA 1OVLB 5DKSA 2PIRA 5DXGA 4J24A 4APUA 1Z5XU 4XUHA 3FEIA 2ZFXA 2XYXA 4OEZA 3VI8A 2I0JA 4ONIA 5LGAA 2ZNPA 3OKHA 3DZYD 2O4RA 3OZJA 1G1UA 3WT6A 4ZNTA 5IZ0A 5KRFA 1OVLA 5SYZA 5C4SA 3ERTA 4S0TA 3OS8C 5I4VA 4YT1A 5DXPA 2R6YA 3RLLA 2HB7A 3PEQA 5JJMB 4NIEA 4PWLA 4RUPA 4OJ9A 2G0GA 3ADVA 4CSJA 2G44A 4UDDA 2NXXE 3AN3A 1XNNA 4S0SA 5C4OA 3GD2A 2YLQA 1M2ZA 3L0JA 3OLLA 4N73A 4PP6A 3CWDA 4WHGA 2HASA 4IW6A 4LTWA 1T7RA 4S14A 2ZASA 4OKTA 5B41A 1NHZA 5G44A 5G45A 1Y0XX 1ILHA 5DY8A 1I38A 5G3JA 3CTBA 1UHLA 5DTVA 1RJKA 4IA3A 2QE4A 2NPAA 3TKCA 2V7CA 3VRVA 5IXKA 3OAPA 4IUIA 3DZUD 2Q70A 5H1EA 2PIQA 3B3KA 2QR9A 2P1TA 2PIVA 4G1DA 2H77A 4IVYA 4J5XA 4OIVA 3AX8A 2Q7KA 3ZRAA 3UP0A 1X76A 3WFGA 5HCVA 3CDPA 5AYGA 1XV9B 3OSAA 4IV2A 4ZOMA 1PQCA 2I0GA 1XZXX 5AK2A 3B65A 1EXXA 3B67A 1YYEA 1UPVA 4UDAA 2HBHA 3FS1A 4OIUA 4Q13A 5DVVA 1PQ9A 5AVLA 4E2JA 4OZTE 3UUDA 1LBDA 3WT7A 2P7ZA 5DV8A 2PKLA 3VT8A 3K6PA 5A86A 3N00A 2B1ZA 4QE6A 3DT3A 3O1DA 1UOMA 4L96A 5KRAA 4TV1B 1E3KA 1X7EA 3QT0A 3F5CA 3G9EA 5AAVB 2B23A 4PVUA 4REFA 2ZKCA 2AA5A 5G46A 4Q50A 3E94A 1XQCA 2R40D 2AMBA 4TV1A 4XAOA 5G42A 5AAVA 4Y29A 2AX6A 2ZK4A 1OSHA 3HQ5A 2Q59B 5GICA 1XIUA 2GIUA 3D5FA 2QNVA 4ITFA 4NY9A 3WWRA 5DXEA 2ZK1A 2PIPL 4NQAB 1N4HA 3O1EA 4XHDA 3L3ZA 4M8HA 5APJA 3MNEA 1EREA 2VV2A 2Q59A 3VN2A 1MZNA 3KMZA 1PRGA 2Q7LA 3D90A 4WPFA 3VTDA 4OC7A 1NQ7A 3V9VA 1S9PA 3ET0A 3FALB 2XYJA 3ZR7A 3KYTA 5DK9A 5KRHA 3VJIA 4OKXA 3VT9A 1U3QA 5LWPA 5C4UA 2AA2A 3HZFA 4PP5A 4M8EA 5E14A 2VSRA 1N83A 2OCFA 3AUNA 4IS8A 4PLEA 4XUMA 3PCUA 5KD9A 3L0LA 4PXMA 2P1UA 4OH5A 2AA7A 2VV0A 4ZO1X 5DMFA 5AZTA 2AMAA 4DOSA 2P4YA 1P93A 1H9UA 2V0VA 3D6DA 4OFRA 1SKXA 2YJAB 4PPSA 1ILGA 1ZEOA 4IU7A 2OVMA 2G5OA 4G2HA 2VV4A 5FQSA 1R20A 2QGTA 5EC9A 4IA7A 5C4TA 4K7AA 1U3RA 3B5RA 2BAWA 4FGYA 3A2IA 3Q95B 4MDDA 1OT7A 5DKEA 3AUQA 3A2JA 5KYAA 1XAPA 5DRJA 3ILZA 4K4JA 5FQVA 2ZVTA 1X7JA 2Z4BA 3ADTA 3BQDA 2F4BA 4OJBA 5ICKA 4B7WA 3TKMA 3Q95A 4IV4A 4Q0AC 4OEDA 3SP6A 2Z4JA 4N8RA 5AWKA 4JGVA 3ET2A 1Z5XE 1T5ZA 5KCCA 2YFEA 5DXQA 4RMEA 1XP9A 5EGVA 4ZN9A 3CS4A 5E7VA 1Y0SA 4RMDA 3HC5A 4RZGA 5DWGA 5DXBB 3PO9A 1YY4A 2QABA 2REWA 3IPSA 4MGBB 5DKGA 1XLSA 1T74A 1ZH7A 2HB8A 2XYWA 3GYUA 2ZXZA 3HLVA 1SR7A 1XNXA 3G8OA 3OLSA 2HVCA 4POHA 5DXKA 3ZRBA 4QL8A 2ZL9A 5DZHA 4A4WA 4RE8A 3UUCA 1S0XA 2YATA 3FURA 5DXBA 4L98A 4LNWA 1RK3A 1G5YA 1XJ7A 1YMTA 4MGBA 1KNUA 1K4WA 1RDTD 2QA8B 4JYHA 4N1YA 5FQTA 5EI1A 2FVJA 1NQ0A 3PRGA 2Q6RA 3IMYA 4R2UA 1Z95A 2PIXA 3WTQA 4OK1A 5JJMA 1T76A 3V9TA 4FN9A 3VSOA 2P54A 3G0WA 1PQ6A 2QA8A 4HLWA 3B0QA 4ZN7A 1YJEA 4OH6A 1N46A 2OVHA 3NSPA 3UU7B 3W0AA 4CI4A 1YUCA 2Q8SA 2VV3A 2QZOB 4DM6A 3X1IA 3M7RA 2OAXA 1RDTA 3W0GA 3GBKA 1TXIA 4DK8A 5E0XA 5ETHA 2QW4A 4OFUA
chains in the Genus database with same CATH topology
1QKTA 1NQ1A 2QZOA 3DY6A 1PCGA 2A3IA 4XI3A 2P15A 4ZNHA 3JZBA 3ZQTA 2AO6A 2YLOA 4EMAA 4KZIA 3R8IA 3HVLA 2AXAA 5DUGA 2HFPA 3KPZA 2ZK6A 1X7RA 1FD0A 4IA1A 1SQNA 4PPPA 4RZEA 4JL4A 3H0AA 4IW8A 2ZK5A 4J5WA 3GWSX 1YINA 4YNKA 5DUEA 4MG6A 5DWLA 5KCDA 1PZLA 5DU5A 3P88A 4PLDA 3W5PA 3RY9A 1XP6A 2AYRA 3R8AA 1T7FA 1XV9A 3R5NA 3V9YA 3IA6A 2ZNNA 1UPWA 2Q6JA 1FM9A 2JJ3A 4PP3A 2QTUA 1NAXA 1R6GA 5DIEA 5KR9A 2ZMJA 3B0WA 4JYIA 5DXRA 3VT5A 3OS8A 1NAVA 5KRCA 1FCZA 3IPQA 4XT9A 3W5QA 3CJWA 1ZKYA 4R06A 5DXMA 3VTBA 1PDUA 2QMVA 3HM1A 4OJ4A 1FM6A 5E0WA 1A52A 4MG8B 3OMMA 5DLRA 5DP0A 2ZY0A 1EXAA 3OMOA 4MG9B 1I7IA 2AM9A 2R6WA 5GIEA 5JI0D 3OOFA 5HJPB 1R5KA 4N5GA 5JY3A 5E19A 2Q5GA 1Q4XA 5APKA 1T79A 2QSEA 2I4JA 3TY0A 1FCYA 4MG8A 1FBYA 4MG9A 4G1YA 4OZRU 2OM9A 4O8FA 3AZ1A 4WLBA 3DR1A 5DRMA 5DMCA 3SZ1A 4E4QA 2PJLA 3B66A 1X7BA 4G21A 5CJ6A 2QGWA 4WVDA 3VTCA 3W5RA 3L03A 1S19A 3WJ5A 1TFCA 3W0CA 4RFWA 5B5BA 2NV7A 3VJTA 5DIGA 1T73A 2B50A 2GTKA 2GPUA 3K22A 4G1ZA 2GPOA 2Q1HA 1XDKB 2PIUA 1MV9A 3NSQA 4K6IA 4OKWA 4PF3A 4IA2A 3AN4A 1PK5A 4UDBA 1YOKA 1HJ1A 2Q5SA 3R2AA 5KCFA 2HWRA 4MGCA 1RKHA 1ZGYA 1R20D 1XDKA 1M13A 4R6SA 5HZCA 3FALA 2QPYA 1I37A 1NQ2A 4TUZB 2AB2A 4XTAA 5GIDA 1G2NA 3A3ZX 2Q6SA 5EJVA 1L2IA 3W5TA 4ZNSA 5DWEA 1DKFB 2NXXA 5DIDA 3FXVA 1NYXA 3KBAA 4DORA 1I7GA 4TUZA 2BJ4B 5AVIA 1OSVA 3L1BA 1XPCA 5HYKA 2VSTA 2FAIA 3ET1A 5DX3B 1DKFA 4EM9A 2HCDA 3B1MA 5APHA 1GWQA 1IE8A 3D24A 3L0EA 5DWIA 3KFCA 2BJ4A 5DZ3A 3FC6B 4ZNWA 3PBAA 4ZI1A 2YHDA 3IXPA 5DUHA 3A9EB 5AWJA 3V4AA 2I4PA 1R1KA 5KRMA 5ACCA 5M96A 2NW4A 2FSZA 5KCTA 1RKGA 2PIWA 1S0ZA 3FC6A 1T7MA 4X1GA 2QH6A 5EHJA 2LBDA 3P8XA 2Q3YA 3KMGA 3OSWA 2P1VA 2G0HA 1Y9RA 2Q7IA 1ZDUA 4OEAA 4WQPA 3VHWA 2QA6A 3WMHA 4DMAA 3S9SA 1GS4A 4J5XC 3P0UA 4MGAB 3FUGA 4LNXA 5DVCA 3X31A 2PITA 3GWXA 1S9QA 1ZAFA 4OKBA 5DV3A 5DV6A 3UP3A 2ZNOA 3CQVA 3D57A 3VT3A 3WFFA 2IHQA 3UVVB 2ABIA 1GWXA 5G5WA 4P6XA 2JFAB 3G8IA 1P8DA 1DB1A 4MGAA 4OGHA 5DVSA 3OKIA 3ADSA 5GT4A 3V3EA 5DZ0A 2AX8A 2ZXNA 4QK4A 2PRGA 5DZIA 4FHHA 3LMPA 1LV2A 2IOKA 2ZK2A 4KZJA 3UVVA 5IAWA 3KDUA 2JFAA 3KMRA 3L3XA 1VJBA 1K74A 3X36A 2ZMIA 3KWYA 2POGA 3H0AD 3ERDA 3IPUA 3MNPA 4OLMA 2B1VA 2HC4A 3E00A 1U3SA 4RMCA 3UU7A 4E4KA 4F9MA 2PINA 2QXSA 3BEJA 2O9IA 3HO0A 4IWCA 5L7HA 3VSPA 1FM9D 5L11A 4QE8A 4LBDA 1UHLB 3F7DA 3A78A 1ZUCA 1A28A 3ADWA 3K23A 4MGDB 3SP9A 5L7GA 3DZYA 3DCTA 4RUJA 2GPVA 4DQMA 4MG5A 2PIOA 4YMQA 2ZLCA 3CLDA 3OMPA 3VRUA 2Q61A 3HODA 5DYBA 4BCRA 1XB7A 1IE9A 3FEJA 4RWVA 5E1CA 5KCWA 3TX7B 3H52A 3GN8A 4MGDA 1FM6D 4FHIA 4JYGA 1MVCA 5KROA 5K13A 2P7AA 3AZ3A 1GWRA 2JF9A 1XQ3A 2ZNQA 3CS6A 3E7CA 5KRIA 2ACLB 3WJ4A 1X78A 4IWFA 1T7TA 3W0HA 3MNOA 3NOAA 4OHAA 3RVFA 4IQRA 2QXMA 3VJHA 5KRJA 4CI5A 2H79A 3LBDA 2ZK3A 3B68A 3CDSA 2ACLA 5E15A 3K8SA 1XLSE 3RLJA 3V3QA 4ZNUA 3UUDB 2ZXMA 2XKWA 3WT5A 3R29A 4RZFA 3DZUA 3OMKA 1NRLA 4XLDA 3UUAB 4POJA 2VV1B 5HJSA 1HG4A 3B0TA 5AAUA 4OZRE 3VJSA 3JZCA 1KV6A 3VRTA 3V49A 2GP7A 3F5CB 4LSJA 5HJPA 3OZ0A 4OZTU 2J4AA 3UUAA 4UDCA 5DZ1A 2ZMHA 2VV1A 4P6WA 5KCEA 3RUUA 1WM0X 2POBA 4ZJWA 3VRWA 4OARA 2GWXA 2XHSA 3GZ9A 4DM8A 3W0IA 1K7LA 2AWHA 3BC5A 2GPPA 4IVWA 3W0YA 5FQPA 3GYTA 5F9BA 3R8DA 2HARA 2ATHA 2W8YA 3ADUA 5KYJA 3EYBA 2ZLAA 2EWPA 5HYRA 1BSXA 4PRGA 1XOWA 2AA6A 3T03A 5FQRA 3A2HA 5AZVA 4ZJRA 3OGTA 1YIMA 1E3GA 1YP0A 2HWQA 2J14A 2Q5PA 4S15A 2AX9A 2Q60A 4QM0A 1XP1A 2P7GA 2HAMA 1QKMA 2AAXA 3U9QA 4RUOX 4G20A 5KCUA 1YOWA 3IXPD 2R40A 2YLYA 4KZMA 1QKNA 4OEYA 4ZO1B 5DI7A 1R1KD 4A2JA 3FLIA 2I4ZA 4NB6A 3ET3A 3RUTA 3KDTA 5KRLA 1NUOA 2PNUA 1FCXA 3VT4A 1KKQA 2IOGA 3A40X 1YA3A 3B0RA 1T63A 3VHVA 5DWJA 4ITEA 5L7EA 1ERRA 1QKUA 1SJ0A 1U9EA 2Q1VA 4ZNVA 4DK7A 3ADXA 3AZ2A 5DL4A 2OZ7A 2AX7A 4HEEX 4JAZA 5DX3A 2VV4B 4REEA 2Q7JA 4J26A 4MG7B 3OLFA 1T65A 4X1FA 4YPQA 4NUFA 1G50A 3OS9A 1ZDTA 3R5MA 5EITA 3A9EA 2OUZA 4G2IA 1L2JA 4A4VA 4MG7A 2J7XA 2O4JA 5G43A 3W0JA 1XVPB 3VT7A 2YJDA 3WGPA 4QJRA 4RAKA 4OILA 5DKBA 1M7WA 5DSHA 1K74D 1NDEA 2GL8A 2YLPA 4FNEA 3P89A 2ZBSA 5KRKA 3DCUA 1XVPA 4WHFA 3OOKA 3AURA 3HC6A 3AFRA 3OMQA 5DYDA 3X1HA 3PLZA 4J5WC 3VT6A 2ZK0A 3CS8A 3VHUA 3OSIA 2E2RA 3E00D 2J7YA 1OVLB 5DKSA 2PIRA 5DXGA 4J24A 4APUA 1Z5XU 4XUHA 3FEIA 2ZFXA 2XYXA 4OEZA 3VI8A 2I0JA 4ONIA 5LGAA 2ZNPA 3OKHA 3DZYD 2O4RA 3OZJA 1G1UA 3WT6A 4ZNTA 5IZ0A 5KRFA 1OVLA 5SYZA 5C4SA 3ERTA 4S0TA 3OS8C 5I4VA 4YT1A 5DXPA 2R6YA 3RLLA 2HB7A 3PEQA 5JJMB 4NIEA 4PWLA 4RUPA 4OJ9A 2G0GA 3ADVA 4CSJA 2G44A 4UDDA 2NXXE 3AN3A 1XNNA 4S0SA 5C4OA 3GD2A 2YLQA 1M2ZA 3L0JA 3OLLA 4N73A 4PP6A 3CWDA 4WHGA 2HASA 4IW6A 4LTWA 1T7RA 4S14A 2ZASA 4OKTA 5B41A 1NHZA 5G44A 5G45A 1Y0XX 1ILHA 5DY8A 1I38A 5G3JA 3CTBA 1UHLA 5DTVA 1RJKA 4IA3A 2QE4A 2NPAA 3TKCA 2V7CA 3VRVA 5IXKA 3OAPA 4IUIA 3DZUD 2Q70A 5H1EA 2PIQA 3B3KA 2QR9A 2P1TA 2PIVA 4G1DA 2H77A 4IVYA 4J5XA 4OIVA 3AX8A 2Q7KA 3ZRAA 3UP0A 1X76A 3WFGA 5HCVA 3CDPA 5AYGA 1XV9B 3OSAA 4IV2A 4ZOMA 1PQCA 2I0GA 1XZXX 5AK2A 3B65A 1EXXA 3B67A 1YYEA 1UPVA 4UDAA 2HBHA 3FS1A 4OIUA 4Q13A 5DVVA 1PQ9A 5AVLA 4E2JA 4OZTE 3UUDA 1LBDA 3WT7A 2P7ZA 5DV8A 2PKLA 3VT8A 3K6PA 5A86A 3N00A 2B1ZA 4QE6A 3DT3A 3O1DA 1UOMA 4L96A 5KRAA 4TV1B 1E3KA 1X7EA 3QT0A 3F5CA 3G9EA 5AAVB 2B23A 4PVUA 4REFA 2ZKCA 2AA5A 5G46A 4Q50A 3E94A 1XQCA 2R40D 2AMBA 4TV1A 4XAOA 5G42A 5AAVA 4Y29A 2AX6A 2ZK4A 1OSHA 3HQ5A 2Q59B 5GICA 1XIUA 2GIUA 3D5FA 2QNVA 4ITFA 4NY9A 3WWRA 5DXEA 2ZK1A 2PIPL 4NQAB 1N4HA 3O1EA 4XHDA 3L3ZA 4M8HA 5APJA 3MNEA 1EREA 2VV2A 2Q59A 3VN2A 1MZNA 3KMZA 1PRGA 2Q7LA 3D90A 4WPFA 3VTDA 4OC7A 1NQ7A 3V9VA 1S9PA 3ET0A 3FALB 2XYJA 3ZR7A 3KYTA 5DK9A 5KRHA 3VJIA 4OKXA 3VT9A 1U3QA 5LWPA 5C4UA 2AA2A 3HZFA 4PP5A 4M8EA 5E14A 2VSRA 1N83A 2OCFA 3AUNA 4IS8A 4PLEA 4XUMA 3PCUA 5KD9A 3L0LA 4PXMA 2P1UA 4OH5A 2AA7A 2VV0A 4ZO1X 5DMFA 5AZTA 2AMAA 4DOSA 2P4YA 1P93A 1H9UA 2V0VA 3D6DA 4OFRA 1SKXA 2YJAB 4PPSA 1ILGA 1ZEOA 4IU7A 2OVMA 2G5OA 4G2HA 2VV4A 5FQSA 1R20A 2QGTA 5EC9A 4IA7A 5C4TA 4K7AA 1U3RA 3B5RA 2BAWA 4FGYA 3A2IA 3Q95B 4MDDA 1OT7A 5DKEA 3AUQA 3A2JA 5KYAA 1XAPA 5DRJA 3ILZA 4K4JA 5FQVA 2ZVTA 1X7JA 2Z4BA 3ADTA 3BQDA 2F4BA 4OJBA 5ICKA 4B7WA 3TKMA 3Q95A 4IV4A 4Q0AC 4OEDA 3SP6A 2Z4JA 4N8RA 5AWKA 4JGVA 3ET2A 1Z5XE 1T5ZA 5KCCA 2YFEA 5DXQA 4RMEA 1XP9A 5EGVA 4ZN9A 3CS4A 5E7VA 1Y0SA 4RMDA 3HC5A 4RZGA 5DWGA 5DXBB 3PO9A 1YY4A 2QABA 2REWA 3IPSA 4MGBB 5DKGA 1XLSA 1T74A 1ZH7A 2HB8A 2XYWA 3GYUA 2ZXZA 3HLVA 1SR7A 1XNXA 3G8OA 3OLSA 2HVCA 4POHA 5DXKA 3ZRBA 4QL8A 2ZL9A 5DZHA 4A4WA 4RE8A 3UUCA 1S0XA 2YATA 3FURA 5DXBA 4L98A 4LNWA 1RK3A 1G5YA 1XJ7A 1YMTA 4MGBA 1KNUA 1K4WA 1RDTD 2QA8B 4JYHA 4N1YA 5FQTA 5EI1A 2FVJA 1NQ0A 3PRGA 2Q6RA 3IMYA 4R2UA 1Z95A 2PIXA 3WTQA 4OK1A 5JJMA 1T76A 3V9TA 4FN9A 3VSOA 2P54A 3G0WA 1PQ6A 2QA8A 4HLWA 3B0QA 4ZN7A 1YJEA 4OH6A 1N46A 2OVHA 3NSPA 3UU7B 3W0AA 4CI4A 1YUCA 2Q8SA 2VV3A 2QZOB 4DM6A 3X1IA 3M7RA 2OAXA 1RDTA 3W0GA 3GBKA 1TXIA 4DK8A 5E0XA 5ETHA 2QW4A 4OFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKT A;  1NQ1 A;  2QZO A;  3DY6 A;  1PCG A;  2A3I A;  4XI3 A;  2P15 A;  4ZNH A;  3JZB A;  3ZQT A;  2AO6 A;  2YLO A;  4EMA A;  4KZI A;  3R8I A;  3HVL A;  2AXA A;  5DUG A;  2HFP A;  3KPZ A;  2ZK6 A;  1X7R A;  1FD0 A;  4IA1 A;  1SQN A;  4PPP A;  4RZE A;  4JL4 A;  3H0A A;  4IW8 A;  2ZK5 A;  4J5W A;  3GWS X;  1YIN A;  4YNK A;  5DUE A;  4MG6 A;  5DWL A;  5KCD A;  1PZL A;  5DU5 A;  3P88 A;  4PLD A;  3W5P A;  3RY9 A;  1XP6 A;  2AYR A;  3R8A A;  1T7F A;  1XV9 A;  3R5N A;  3V9Y A;  3IA6 A;  2ZNN A;  1UPW A;  2Q6J A;  1FM9 A;  2JJ3 A;  4PP3 A;  2QTU A;  1NAX A;  1R6G A;  5DIE A;  5KR9 A;  2ZMJ A;  3B0W A;  4JYI A;  5DXR A;  3VT5 A;  3OS8 A;  1NAV A;  5KRC A;  1FCZ A;  3IPQ A;  4XT9 A;  3W5Q A;  3CJW A;  1ZKY A;  4R06 A;  5DXM A;  3VTB A;  1PDU A;  2QMV A;  3HM1 A;  4OJ4 A;  1FM6 A;  5E0W A;  1A52 A;  4MG8 B;  3OMM A;  5DLR A;  5DP0 A;  2ZY0 A;  1EXA A;  3OMO A;  4MG9 B;  1I7I A;  2AM9 A;  2R6W A;  5GIE A;  5JI0 D;  3OOF A;  5HJP B;  1R5K A;  4N5G A;  5JY3 A;  5E19 A;  2Q5G A;  1Q4X A;  5APK A;  1T79 A;  2QSE A;  2I4J A;  3TY0 A;  1FCY A;  4MG8 A;  1FBY A;  4MG9 A;  4G1Y A;  4OZR U;  2OM9 A;  4O8F A;  3AZ1 A;  4WLB A;  3DR1 A;  5DRM A;  5DMC A;  3SZ1 A;  4E4Q A;  2PJL A;  3B66 A;  1X7B A;  4G21 A;  5CJ6 A;  2QGW A;  4WVD A;  3VTC A;  3W5R A;  3L03 A;  1S19 A;  3WJ5 A;  1TFC A;  3W0C A;  4RFW A;  5B5B A;  2NV7 A;  3VJT A;  5DIG A;  1T73 A;  2B50 A;  2GTK A;  2GPU A;  3K22 A;  4G1Z A;  2GPO A;  2Q1H A;  1XDK B;  2PIU A;  1MV9 A;  3NSQ A;  4K6I A;  4OKW A;  4PF3 A;  4IA2 A;  3AN4 A;  1PK5 A;  4UDB A;  1YOK A;  1HJ1 A;  2Q5S A;  3R2A A;  5KCF A;  2HWR A;  4MGC A;  1RKH A;  1ZGY A;  1R20 D;  1XDK A;  1M13 A;  4R6S A;  5HZC A;  3FAL A;  2QPY A;  1I37 A;  1NQ2 A;  4TUZ B;  2AB2 A;  4XTA A;  5GID A;  1G2N A;  3A3Z X;  2Q6S A;  5EJV A;  1L2I A;  3W5T A;  4ZNS A;  5DWE A;  1DKF B;  2NXX A;  5DID A;  3FXV A;  1NYX A;  3KBA A;  4DOR A;  1I7G A;  4TUZ A;  2BJ4 B;  5AVI A;  1OSV A;  3L1B A;  1XPC A;  5HYK A;  2VST A;  2FAI A;  3ET1 A;  5DX3 B;  1DKF A;  4EM9 A;  2HCD A;  3B1M A;  5APH A;  1GWQ A;  1IE8 A;  3D24 A;  3L0E A;  5DWI A;  3KFC A;  2BJ4 A;  5DZ3 A;  3FC6 B;  4ZNW A;  3PBA A;  4ZI1 A;  2YHD A;  3IXP A;  5DUH A;  3A9E B;  5AWJ A;  3V4A A;  2I4P A;  1R1K A;  5KRM A;  5ACC A;  5M96 A;  2NW4 A;  2FSZ A;  5KCT A;  1RKG A;  2PIW A;  1S0Z A;  3FC6 A;  1T7M A;  4X1G A;  2QH6 A;  5EHJ A;  2LBD A;  3P8X A;  2Q3Y A;  3KMG A;  3OSW A;  2P1V A;  2G0H A;  1Y9R A;  2Q7I A;  1ZDU A;  4OEA A;  4WQP A;  3VHW A;  2QA6 A;  3WMH A;  4DMA A;  3S9S A;  1GS4 A;  4J5X C;  3P0U A;  4MGA B;  3FUG A;  4LNX A;  5DVC A;  3X31 A;  2PIT A;  3GWX A;  1S9Q A;  1ZAF A;  4OKB A;  5DV3 A;  5DV6 A;  3UP3 A;  2ZNO A;  3CQV A;  3D57 A;  3VT3 A;  3WFF A;  2IHQ A;  3UVV B;  2ABI A;  1GWX A;  5G5W A;  4P6X A;  2JFA B;  3G8I A;  1P8D A;  1DB1 A;  4MGA A;  4OGH A;  5DVS A;  3OKI A;  3ADS A;  5GT4 A;  3V3E A;  5DZ0 A;  2AX8 A;  2ZXN A;  4QK4 A;  2PRG A;  5DZI A;  4FHH A;  3LMP A;  1LV2 A;  2IOK A;  2ZK2 A;  4KZJ A;  3UVV A;  5IAW A;  3KDU A;  2JFA A;  3KMR A;  3L3X A;  1VJB A;  1K74 A;  3X36 A;  2ZMI A;  3KWY A;  2POG A;  3H0A D;  3ERD A;  3IPU A;  3MNP A;  4OLM A;  2B1V A;  2HC4 A;  3E00 A;  1U3S A;  4RMC A;  3UU7 A;  4E4K A;  4F9M A;  2PIN A;  2QXS A;  3BEJ A;  2O9I A;  3HO0 A;  4IWC A;  5L7H A;  3VSP A;  1FM9 D;  5L11 A;  4QE8 A;  4LBD A;  1UHL B;  3F7D A;  3A78 A;  1ZUC A;  1A28 A;  3ADW A;  3K23 A;  4MGD B;  3SP9 A;  5L7G A;  3DZY A;  3DCT A;  4RUJ A;  2GPV A;  4DQM A;  4MG5 A;  2PIO A;  4YMQ A;  2ZLC A;  3CLD A;  3OMP A;  3VRU A;  2Q61 A;  3HOD A;  5DYB A;  4BCR A;  1XB7 A;  1IE9 A;  3FEJ A;  4RWV A;  5E1C A;  5KCW A;  3TX7 B;  3H52 A;  3GN8 A;  4MGD A;  1FM6 D;  4FHI A;  4JYG A;  1MVC A;  5KRO A;  5K13 A;  2P7A A;  3AZ3 A;  1GWR A;  2JF9 A;  1XQ3 A;  2ZNQ A;  3CS6 A;  3E7C A;  5KRI A;  2ACL B;  3WJ4 A;  1X78 A;  4IWF A;  1T7T A;  3W0H A;  3MNO A;  3NOA A;  4OHA A;  3RVF A;  4IQR A;  2QXM A;  3VJH A;  5KRJ A;  4CI5 A;  2H79 A;  3LBD A;  2ZK3 A;  3B68 A;  3CDS A;  2ACL A;  5E15 A;  3K8S A;  1XLS E;  3RLJ A;  3V3Q A;  4ZNU A;  3UUD B;  2ZXM A;  2XKW A;  3WT5 A;  3R29 A;  4RZF A;  3DZU A;  3OMK A;  1NRL A;  4XLD A;  3UUA B;  4POJ A;  2VV1 B;  5HJS A;  1HG4 A;  3B0T A;  5AAU A;  4OZR E;  3VJS A;  3JZC A;  1KV6 A;  3VRT A;  3V49 A;  2GP7 A;  3F5C B;  4LSJ A;  5HJP A;  3OZ0 A;  4OZT U;  2J4A A;  3UUA A;  4UDC A;  5DZ1 A;  2ZMH A;  2VV1 A;  4P6W A;  5KCE A;  3RUU A;  1WM0 X;  2POB A;  4ZJW A;  3VRW A;  4OAR A;  2GWX A;  2XHS A;  3GZ9 A;  4DM8 A;  3W0I A;  1K7L A;  2AWH A;  3BC5 A;  2GPP A;  4IVW A;  3W0Y A;  5FQP A;  3GYT A;  5F9B A;  3R8D A;  2HAR A;  2ATH A;  2W8Y A;  3ADU A;  5KYJ A;  3EYB A;  2ZLA A;  2EWP A;  5HYR A;  1BSX A;  4PRG A;  1XOW A;  2AA6 A;  3T03 A;  5FQR A;  3A2H A;  5AZV A;  4ZJR A;  3OGT A;  1YIM A;  1E3G A;  1YP0 A;  2HWQ A;  2J14 A;  2Q5P A;  4S15 A;  2AX9 A;  2Q60 A;  4QM0 A;  1XP1 A;  2P7G A;  2HAM A;  1QKM A;  2AAX A;  3U9Q A;  4RUO X;  4G20 A;  5KCU A;  1YOW A;  3IXP D;  2R40 A;  2YLY A;  4KZM A;  1QKN A;  4OEY A;  4ZO1 B;  5DI7 A;  1R1K D;  4A2J A;  3FLI A;  2I4Z A;  4NB6 A;  3ET3 A;  3RUT A;  3KDT A;  5KRL A;  1NUO A;  2PNU A;  1FCX A;  3VT4 A;  1KKQ A;  2IOG A;  3A40 X;  1YA3 A;  3B0R A;  1T63 A;  3VHV A;  5DWJ A;  4ITE A;  5L7E A;  1ERR A;  1QKU A;  1SJ0 A;  1U9E A;  2Q1V A;  4ZNV A;  4DK7 A;  3ADX A;  3AZ2 A;  5DL4 A;  2OZ7 A;  2AX7 A;  4HEE X;  4JAZ A;  5DX3 A;  2VV4 B;  4REE A;  2Q7J A;  4J26 A;  4MG7 B;  3OLF A;  1T65 A;  4X1F A;  4YPQ A;  4NUF A;  1G50 A;  3OS9 A;  1ZDT A;  3R5M A;  5EIT A;  3A9E A;  2OUZ A;  4G2I A;  1L2J A;  4A4V A;  4MG7 A;  2J7X A;  2O4J A;  5G43 A;  3W0J A;  1XVP B;  3VT7 A;  2YJD A;  3WGP A;  4QJR A;  4RAK A;  4OIL A;  5DKB A;  1M7W A;  5DSH A;  1K74 D;  1NDE A;  2GL8 A;  2YLP A;  4FNE A;  3P89 A;  2ZBS A;  5KRK A;  3DCU A;  1XVP A;  4WHF A;  3OOK A;  3AUR A;  3HC6 A;  3AFR A;  3OMQ A;  5DYD A;  3X1H A;  3PLZ A;  4J5W C;  3VT6 A;  2ZK0 A;  3CS8 A;  3VHU A;  3OSI A;  2E2R A;  3E00 D;  2J7Y A;  1OVL B;  5DKS A;  2PIR A;  5DXG A;  4J24 A;  4APU A;  1Z5X U;  4XUH A;  3FEI A;  2ZFX A;  2XYX A;  4OEZ A;  3VI8 A;  2I0J A;  4ONI A;  5LGA A;  2ZNP A;  3OKH A;  3DZY D;  2O4R A;  3OZJ A;  1G1U A;  3WT6 A;  4ZNT A;  5IZ0 A;  5KRF A;  1OVL A;  5SYZ A;  5C4S A;  3ERT A;  4S0T A;  3OS8 C;  5I4V A;  4YT1 A;  5DXP A;  2R6Y A;  3RLL A;  2HB7 A;  3PEQ A;  5JJM B;  4NIE A;  4PWL A;  4RUP A;  4OJ9 A;  2G0G A;  3ADV A;  4CSJ A;  2G44 A;  4UDD A;  2NXX E;  3AN3 A;  1XNN A;  4S0S A;  5C4O A;  3GD2 A;  2YLQ A;  1M2Z A;  3L0J A;  3OLL A;  4N73 A;  4PP6 A;  3CWD A;  4WHG A;  2HAS A;  4IW6 A;  4LTW A;  1T7R A;  4S14 A;  2ZAS A;  4OKT A;  5B41 A;  1NHZ A;  5G44 A;  5G45 A;  1Y0X X;  1ILH A;  5DY8 A;  1I38 A;  5G3J A;  3CTB A;  1UHL A;  5DTV A;  1RJK A;  4IA3 A;  2QE4 A;  2NPA A;  3TKC A;  2V7C A;  3VRV A;  5IXK A;  3OAP A;  4IUI A;  3DZU D;  2Q70 A;  5H1E A;  2PIQ A;  3B3K A;  2QR9 A;  2P1T A;  2PIV A;  4G1D A;  2H77 A;  4IVY A;  4J5X A;  4OIV A;  3AX8 A;  2Q7K A;  3ZRA A;  3UP0 A;  1X76 A;  3WFG A;  5HCV A;  3CDP A;  5AYG A;  1XV9 B;  3OSA A;  4IV2 A;  4ZOM A;  1PQC A;  2I0G A;  1XZX X;  5AK2 A;  3B65 A;  1EXX A;  3B67 A;  1YYE A;  1UPV A;  4UDA A;  2HBH A;  3FS1 A;  4OIU A;  4Q13 A;  5DVV A;  1PQ9 A;  5AVL A;  4E2J A;  4OZT E;  3UUD A;  1LBD A;  3WT7 A;  2P7Z A;  5DV8 A;  2PKL A;  3VT8 A;  3K6P A;  5A86 A;  3N00 A;  2B1Z A;  4QE6 A;  3DT3 A;  3O1D A;  1UOM A;  4L96 A;  5KRA A;  4TV1 B;  1E3K A;  1X7E A;  3QT0 A;  3F5C A;  3G9E A;  5AAV B;  2B23 A;  4PVU A;  4REF A;  2ZKC A;  2AA5 A;  5G46 A;  4Q50 A;  3E94 A;  1XQC A;  2R40 D;  2AMB A;  4TV1 A;  4XAO A;  5G42 A;  5AAV A;  4Y29 A;  2AX6 A;  2ZK4 A;  1OSH A;  3HQ5 A;  2Q59 B;  5GIC A;  1XIU A;  2GIU A;  3D5F A;  2QNV A;  4ITF A;  4NY9 A;  3WWR A;  5DXE A;  2ZK1 A;  2PIP L;  4NQA B;  1N4H A;  3O1E A;  4XHD A;  3L3Z A;  4M8H A;  5APJ A;  3MNE A;  1ERE A;  2VV2 A;  2Q59 A;  3VN2 A;  1MZN A;  3KMZ A;  1PRG A;  2Q7L A;  3D90 A;  4WPF A;  3VTD A;  4OC7 A;  1NQ7 A;  3V9V A;  1S9P A;  3ET0 A;  3FAL B;  2XYJ A;  3ZR7 A;  3KYT A;  5DK9 A;  5KRH A;  3VJI A;  4OKX A;  3VT9 A;  1U3Q A;  5LWP A;  5C4U A;  2AA2 A;  3HZF A;  4PP5 A;  4M8E A;  5E14 A;  2VSR A;  1N83 A;  2OCF A;  3AUN A;  4IS8 A;  4PLE A;  4XUM A;  3PCU A;  5KD9 A;  3L0L A;  4PXM A;  2P1U A;  4OH5 A;  2AA7 A;  2VV0 A;  4ZO1 X;  5DMF A;  5AZT A;  2AMA A;  4DOS A;  2P4Y A;  1P93 A;  1H9U A;  2V0V A;  3D6D A;  4OFR A;  1SKX A;  2YJA B;  4PPS A;  1ILG A;  1ZEO A;  4IU7 A;  2OVM A;  2G5O A;  4G2H A;  2VV4 A;  5FQS A;  1R20 A;  2QGT A;  5EC9 A;  4IA7 A;  5C4T A;  4K7A A;  1U3R A;  3B5R A;  2BAW A;  4FGY A;  3A2I A;  3Q95 B;  4MDD A;  1OT7 A;  5DKE A;  3AUQ A;  3A2J A;  5KYA A;  1XAP A;  5DRJ A;  3ILZ A;  4K4J A;  5FQV A;  2ZVT A;  1X7J A;  2Z4B A;  3ADT A;  3BQD A;  2F4B A;  4OJB A;  5ICK A;  4B7W A;  3TKM A;  3Q95 A;  4IV4 A;  4Q0A C;  4OED A;  3SP6 A;  2Z4J A;  4N8R A;  5AWK A;  4JGV A;  3ET2 A;  1Z5X E;  1T5Z A;  5KCC A;  2YFE A;  5DXQ A;  4RME A;  1XP9 A;  5EGV A;  4ZN9 A;  3CS4 A;  5E7V A;  1Y0S A;  4RMD A;  3HC5 A;  4RZG A;  5DWG A;  5DXB B;  3PO9 A;  1YY4 A;  2QAB A;  2REW A;  3IPS A;  4MGB B;  5DKG A;  1XLS A;  1T74 A;  1ZH7 A;  2HB8 A;  2XYW A;  3GYU A;  2ZXZ A;  3HLV A;  1SR7 A;  1XNX A;  3G8O A;  3OLS A;  2HVC A;  4POH A;  5DXK A;  3ZRB A;  4QL8 A;  2ZL9 A;  5DZH A;  4A4W A;  4RE8 A;  3UUC A;  1S0X A;  2YAT A;  3FUR A;  5DXB A;  4L98 A;  4LNW A;  1RK3 A;  1G5Y A;  1XJ7 A;  1YMT A;  4MGB A;  1KNU A;  1K4W A;  1RDT D;  2QA8 B;  4JYH A;  4N1Y A;  5FQT A;  5EI1 A;  2FVJ A;  1NQ0 A;  3PRG A;  2Q6R A;  3IMY A;  4R2U A;  1Z95 A;  2PIX A;  3WTQ A;  4OK1 A;  5JJM A;  1T76 A;  3V9T A;  4FN9 A;  3VSO A;  2P54 A;  3G0W A;  1PQ6 A;  2QA8 A;  4HLW A;  3B0Q A;  4ZN7 A;  1YJE A;  4OH6 A;  1N46 A;  2OVH A;  3NSP A;  3UU7 B;  3W0A A;  4CI4 A;  1YUC A;  2Q8S A;  2VV3 A;  2QZO B;  4DM6 A;  3X1I A;  3M7R A;  2OAX A;  1RDT A;  3W0G A;  3GBK A;  1TXI A;  4DK8 A;  5E0X A;  5ETH A;  2QW4 A;  4OFU A; 
#chains in the Genus database with same CATH topology
 1QKT A;  1NQ1 A;  2QZO A;  3DY6 A;  1PCG A;  2A3I A;  4XI3 A;  2P15 A;  4ZNH A;  3JZB A;  3ZQT A;  2AO6 A;  2YLO A;  4EMA A;  4KZI A;  3R8I A;  3HVL A;  2AXA A;  5DUG A;  2HFP A;  3KPZ A;  2ZK6 A;  1X7R A;  1FD0 A;  4IA1 A;  1SQN A;  4PPP A;  4RZE A;  4JL4 A;  3H0A A;  4IW8 A;  2ZK5 A;  4J5W A;  3GWS X;  1YIN A;  4YNK A;  5DUE A;  4MG6 A;  5DWL A;  5KCD A;  1PZL A;  5DU5 A;  3P88 A;  4PLD A;  3W5P A;  3RY9 A;  1XP6 A;  2AYR A;  3R8A A;  1T7F A;  1XV9 A;  3R5N A;  3V9Y A;  3IA6 A;  2ZNN A;  1UPW A;  2Q6J A;  1FM9 A;  2JJ3 A;  4PP3 A;  2QTU A;  1NAX A;  1R6G A;  5DIE A;  5KR9 A;  2ZMJ A;  3B0W A;  4JYI A;  5DXR A;  3VT5 A;  3OS8 A;  1NAV A;  5KRC A;  1FCZ A;  3IPQ A;  4XT9 A;  3W5Q A;  3CJW A;  1ZKY A;  4R06 A;  5DXM A;  3VTB A;  1PDU A;  2QMV A;  3HM1 A;  4OJ4 A;  1FM6 A;  5E0W A;  1A52 A;  4MG8 B;  3OMM A;  5DLR A;  5DP0 A;  2ZY0 A;  1EXA A;  3OMO A;  4MG9 B;  1I7I A;  2AM9 A;  2R6W A;  5GIE A;  5JI0 D;  3OOF A;  5HJP B;  1R5K A;  4N5G A;  5JY3 A;  5E19 A;  2Q5G A;  1Q4X A;  5APK A;  1T79 A;  2QSE A;  2I4J A;  3TY0 A;  1FCY A;  4MG8 A;  1FBY A;  4MG9 A;  4G1Y A;  4OZR U;  2OM9 A;  4O8F A;  3AZ1 A;  4WLB A;  3DR1 A;  5DRM A;  5DMC A;  3SZ1 A;  4E4Q A;  2PJL A;  3B66 A;  1X7B A;  4G21 A;  5CJ6 A;  2QGW A;  4WVD A;  3VTC A;  3W5R A;  3L03 A;  1S19 A;  3WJ5 A;  1TFC A;  3W0C A;  4RFW A;  5B5B A;  2NV7 A;  3VJT A;  5DIG A;  1T73 A;  2B50 A;  2GTK A;  2GPU A;  3K22 A;  4G1Z A;  2GPO A;  2Q1H A;  1XDK B;  2PIU A;  1MV9 A;  3NSQ A;  4K6I A;  4OKW A;  4PF3 A;  4IA2 A;  3AN4 A;  1PK5 A;  4UDB A;  1YOK A;  1HJ1 A;  2Q5S A;  3R2A A;  5KCF A;  2HWR A;  4MGC A;  1RKH A;  1ZGY A;  1R20 D;  1XDK A;  1M13 A;  4R6S A;  5HZC A;  3FAL A;  2QPY A;  1I37 A;  1NQ2 A;  4TUZ B;  2AB2 A;  4XTA A;  5GID A;  1G2N A;  3A3Z X;  2Q6S A;  5EJV A;  1L2I A;  3W5T A;  4ZNS A;  5DWE A;  1DKF B;  2NXX A;  5DID A;  3FXV A;  1NYX A;  3KBA A;  4DOR A;  1I7G A;  4TUZ A;  2BJ4 B;  5AVI A;  1OSV A;  3L1B A;  1XPC A;  5HYK A;  2VST A;  2FAI A;  3ET1 A;  5DX3 B;  1DKF A;  4EM9 A;  2HCD A;  3B1M A;  5APH A;  1GWQ A;  1IE8 A;  3D24 A;  3L0E A;  5DWI A;  3KFC A;  2BJ4 A;  5DZ3 A;  3FC6 B;  4ZNW A;  3PBA A;  4ZI1 A;  2YHD A;  3IXP A;  5DUH A;  3A9E B;  5AWJ A;  3V4A A;  2I4P A;  1R1K A;  5KRM A;  5ACC A;  5M96 A;  2NW4 A;  2FSZ A;  5KCT A;  1RKG A;  2PIW A;  1S0Z A;  3FC6 A;  1T7M A;  4X1G A;  2QH6 A;  5EHJ A;  2LBD A;  3P8X A;  2Q3Y A;  3KMG A;  3OSW A;  2P1V A;  2G0H A;  1Y9R A;  2Q7I A;  1ZDU A;  4OEA A;  4WQP A;  3VHW A;  2QA6 A;  3WMH A;  4DMA A;  3S9S A;  1GS4 A;  4J5X C;  3P0U A;  4MGA B;  3FUG A;  4LNX A;  5DVC A;  3X31 A;  2PIT A;  3GWX A;  1S9Q A;  1ZAF A;  4OKB A;  5DV3 A;  5DV6 A;  3UP3 A;  2ZNO A;  3CQV A;  3D57 A;  3VT3 A;  3WFF A;  2IHQ A;  3UVV B;  2ABI A;  1GWX A;  5G5W A;  4P6X A;  2JFA B;  3G8I A;  1P8D A;  1DB1 A;  4MGA A;  4OGH A;  5DVS A;  3OKI A;  3ADS A;  5GT4 A;  3V3E A;  5DZ0 A;  2AX8 A;  2ZXN A;  4QK4 A;  2PRG A;  5DZI A;  4FHH A;  3LMP A;  1LV2 A;  2IOK A;  2ZK2 A;  4KZJ A;  3UVV A;  5IAW A;  3KDU A;  2JFA A;  3KMR A;  3L3X A;  1VJB A;  1K74 A;  3X36 A;  2ZMI A;  3KWY A;  2POG A;  3H0A D;  3ERD A;  3IPU A;  3MNP A;  4OLM A;  2B1V A;  2HC4 A;  3E00 A;  1U3S A;  4RMC A;  3UU7 A;  4E4K A;  4F9M A;  2PIN A;  2QXS A;  3BEJ A;  2O9I A;  3HO0 A;  4IWC A;  5L7H A;  3VSP A;  1FM9 D;  5L11 A;  4QE8 A;  4LBD A;  1UHL B;  3F7D A;  3A78 A;  1ZUC A;  1A28 A;  3ADW A;  3K23 A;  4MGD B;  3SP9 A;  5L7G A;  3DZY A;  3DCT A;  4RUJ A;  2GPV A;  4DQM A;  4MG5 A;  2PIO A;  4YMQ A;  2ZLC A;  3CLD A;  3OMP A;  3VRU A;  2Q61 A;  3HOD A;  5DYB A;  4BCR A;  1XB7 A;  1IE9 A;  3FEJ A;  4RWV A;  5E1C A;  5KCW A;  3TX7 B;  3H52 A;  3GN8 A;  4MGD A;  1FM6 D;  4FHI A;  4JYG A;  1MVC A;  5KRO A;  5K13 A;  2P7A A;  3AZ3 A;  1GWR A;  2JF9 A;  1XQ3 A;  2ZNQ A;  3CS6 A;  3E7C A;  5KRI A;  2ACL B;  3WJ4 A;  1X78 A;  4IWF A;  1T7T A;  3W0H A;  3MNO A;  3NOA A;  4OHA A;  3RVF A;  4IQR A;  2QXM A;  3VJH A;  5KRJ A;  4CI5 A;  2H79 A;  3LBD A;  2ZK3 A;  3B68 A;  3CDS A;  2ACL A;  5E15 A;  3K8S A;  1XLS E;  3RLJ A;  3V3Q A;  4ZNU A;  3UUD B;  2ZXM A;  2XKW A;  3WT5 A;  3R29 A;  4RZF A;  3DZU A;  3OMK A;  1NRL A;  4XLD A;  3UUA B;  4POJ A;  2VV1 B;  5HJS A;  1HG4 A;  3B0T A;  5AAU A;  4OZR E;  3VJS A;  3JZC A;  1KV6 A;  3VRT A;  3V49 A;  2GP7 A;  3F5C B;  4LSJ A;  5HJP A;  3OZ0 A;  4OZT U;  2J4A A;  3UUA A;  4UDC A;  5DZ1 A;  2ZMH A;  2VV1 A;  4P6W A;  5KCE A;  3RUU A;  1WM0 X;  2POB A;  4ZJW A;  3VRW A;  4OAR A;  2GWX A;  2XHS A;  3GZ9 A;  4DM8 A;  3W0I A;  1K7L A;  2AWH A;  3BC5 A;  2GPP A;  4IVW A;  3W0Y A;  5FQP A;  3GYT A;  5F9B A;  3R8D A;  2HAR A;  2ATH A;  2W8Y A;  3ADU A;  5KYJ A;  3EYB A;  2ZLA A;  2EWP A;  5HYR A;  1BSX A;  4PRG A;  1XOW A;  2AA6 A;  3T03 A;  5FQR A;  3A2H A;  5AZV A;  4ZJR A;  3OGT A;  1YIM A;  1E3G A;  1YP0 A;  2HWQ A;  2J14 A;  2Q5P A;  4S15 A;  2AX9 A;  2Q60 A;  4QM0 A;  1XP1 A;  2P7G A;  2HAM A;  1QKM A;  2AAX A;  3U9Q A;  4RUO X;  4G20 A;  5KCU A;  1YOW A;  3IXP D;  2R40 A;  2YLY A;  4KZM A;  1QKN A;  4OEY A;  4ZO1 B;  5DI7 A;  1R1K D;  4A2J A;  3FLI A;  2I4Z A;  4NB6 A;  3ET3 A;  3RUT A;  3KDT A;  5KRL A;  1NUO A;  2PNU A;  1FCX A;  3VT4 A;  1KKQ A;  2IOG A;  3A40 X;  1YA3 A;  3B0R A;  1T63 A;  3VHV A;  5DWJ A;  4ITE A;  5L7E A;  1ERR A;  1QKU A;  1SJ0 A;  1U9E A;  2Q1V A;  4ZNV A;  4DK7 A;  3ADX A;  3AZ2 A;  5DL4 A;  2OZ7 A;  2AX7 A;  4HEE X;  4JAZ A;  5DX3 A;  2VV4 B;  4REE A;  2Q7J A;  4J26 A;  4MG7 B;  3OLF A;  1T65 A;  4X1F A;  4YPQ A;  4NUF A;  1G50 A;  3OS9 A;  1ZDT A;  3R5M A;  5EIT A;  3A9E A;  2OUZ A;  4G2I A;  1L2J A;  4A4V A;  4MG7 A;  2J7X A;  2O4J A;  5G43 A;  3W0J A;  1XVP B;  3VT7 A;  2YJD A;  3WGP A;  4QJR A;  4RAK A;  4OIL A;  5DKB A;  1M7W A;  5DSH A;  1K74 D;  1NDE A;  2GL8 A;  2YLP A;  4FNE A;  3P89 A;  2ZBS A;  5KRK A;  3DCU A;  1XVP A;  4WHF A;  3OOK A;  3AUR A;  3HC6 A;  3AFR A;  3OMQ A;  5DYD A;  3X1H A;  3PLZ A;  4J5W C;  3VT6 A;  2ZK0 A;  3CS8 A;  3VHU A;  3OSI A;  2E2R A;  3E00 D;  2J7Y A;  1OVL B;  5DKS A;  2PIR A;  5DXG A;  4J24 A;  4APU A;  1Z5X U;  4XUH A;  3FEI A;  2ZFX A;  2XYX A;  4OEZ A;  3VI8 A;  2I0J A;  4ONI A;  5LGA A;  2ZNP A;  3OKH A;  3DZY D;  2O4R A;  3OZJ A;  1G1U A;  3WT6 A;  4ZNT A;  5IZ0 A;  5KRF A;  1OVL A;  5SYZ A;  5C4S A;  3ERT A;  4S0T A;  3OS8 C;  5I4V A;  4YT1 A;  5DXP A;  2R6Y A;  3RLL A;  2HB7 A;  3PEQ A;  5JJM B;  4NIE A;  4PWL A;  4RUP A;  4OJ9 A;  2G0G A;  3ADV A;  4CSJ A;  2G44 A;  4UDD A;  2NXX E;  3AN3 A;  1XNN A;  4S0S A;  5C4O A;  3GD2 A;  2YLQ A;  1M2Z A;  3L0J A;  3OLL A;  4N73 A;  4PP6 A;  3CWD A;  4WHG A;  2HAS A;  4IW6 A;  4LTW A;  1T7R A;  4S14 A;  2ZAS A;  4OKT A;  5B41 A;  1NHZ A;  5G44 A;  5G45 A;  1Y0X X;  1ILH A;  5DY8 A;  1I38 A;  5G3J A;  3CTB A;  1UHL A;  5DTV A;  1RJK A;  4IA3 A;  2QE4 A;  2NPA A;  3TKC A;  2V7C A;  3VRV A;  5IXK A;  3OAP A;  4IUI A;  3DZU D;  2Q70 A;  5H1E A;  2PIQ A;  3B3K A;  2QR9 A;  2P1T A;  2PIV A;  4G1D A;  2H77 A;  4IVY A;  4J5X A;  4OIV A;  3AX8 A;  2Q7K A;  3ZRA A;  3UP0 A;  1X76 A;  3WFG A;  5HCV A;  3CDP A;  5AYG A;  1XV9 B;  3OSA A;  4IV2 A;  4ZOM A;  1PQC A;  2I0G A;  1XZX X;  5AK2 A;  3B65 A;  1EXX A;  3B67 A;  1YYE A;  1UPV A;  4UDA A;  2HBH A;  3FS1 A;  4OIU A;  4Q13 A;  5DVV A;  1PQ9 A;  5AVL A;  4E2J A;  4OZT E;  3UUD A;  1LBD A;  3WT7 A;  2P7Z A;  5DV8 A;  2PKL A;  3VT8 A;  3K6P A;  5A86 A;  3N00 A;  2B1Z A;  4QE6 A;  3DT3 A;  3O1D A;  1UOM A;  4L96 A;  5KRA A;  4TV1 B;  1E3K A;  1X7E A;  3QT0 A;  3F5C A;  3G9E A;  5AAV B;  2B23 A;  4PVU A;  4REF A;  2ZKC A;  2AA5 A;  5G46 A;  4Q50 A;  3E94 A;  1XQC A;  2R40 D;  2AMB A;  4TV1 A;  4XAO A;  5G42 A;  5AAV A;  4Y29 A;  2AX6 A;  2ZK4 A;  1OSH A;  3HQ5 A;  2Q59 B;  5GIC A;  1XIU A;  2GIU A;  3D5F A;  2QNV A;  4ITF A;  4NY9 A;  3WWR A;  5DXE A;  2ZK1 A;  2PIP L;  4NQA B;  1N4H A;  3O1E A;  4XHD A;  3L3Z A;  4M8H A;  5APJ A;  3MNE A;  1ERE A;  2VV2 A;  2Q59 A;  3VN2 A;  1MZN A;  3KMZ A;  1PRG A;  2Q7L A;  3D90 A;  4WPF A;  3VTD A;  4OC7 A;  1NQ7 A;  3V9V A;  1S9P A;  3ET0 A;  3FAL B;  2XYJ A;  3ZR7 A;  3KYT A;  5DK9 A;  5KRH A;  3VJI A;  4OKX A;  3VT9 A;  1U3Q A;  5LWP A;  5C4U A;  2AA2 A;  3HZF A;  4PP5 A;  4M8E A;  5E14 A;  2VSR A;  1N83 A;  2OCF A;  3AUN A;  4IS8 A;  4PLE A;  4XUM A;  3PCU A;  5KD9 A;  3L0L A;  4PXM A;  2P1U A;  4OH5 A;  2AA7 A;  2VV0 A;  4ZO1 X;  5DMF A;  5AZT A;  2AMA A;  4DOS A;  2P4Y A;  1P93 A;  1H9U A;  2V0V A;  3D6D A;  4OFR A;  1SKX A;  2YJA B;  4PPS A;  1ILG A;  1ZEO A;  4IU7 A;  2OVM A;  2G5O A;  4G2H A;  2VV4 A;  5FQS A;  1R20 A;  2QGT A;  5EC9 A;  4IA7 A;  5C4T A;  4K7A A;  1U3R A;  3B5R A;  2BAW A;  4FGY A;  3A2I A;  3Q95 B;  4MDD A;  1OT7 A;  5DKE A;  3AUQ A;  3A2J A;  5KYA A;  1XAP A;  5DRJ A;  3ILZ A;  4K4J A;  5FQV A;  2ZVT A;  1X7J A;  2Z4B A;  3ADT A;  3BQD A;  2F4B A;  4OJB A;  5ICK A;  4B7W A;  3TKM A;  3Q95 A;  4IV4 A;  4Q0A C;  4OED A;  3SP6 A;  2Z4J A;  4N8R A;  5AWK A;  4JGV A;  3ET2 A;  1Z5X E;  1T5Z A;  5KCC A;  2YFE A;  5DXQ A;  4RME A;  1XP9 A;  5EGV A;  4ZN9 A;  3CS4 A;  5E7V A;  1Y0S A;  4RMD A;  3HC5 A;  4RZG A;  5DWG A;  5DXB B;  3PO9 A;  1YY4 A;  2QAB A;  2REW A;  3IPS A;  4MGB B;  5DKG A;  1XLS A;  1T74 A;  1ZH7 A;  2HB8 A;  2XYW A;  3GYU A;  2ZXZ A;  3HLV A;  1SR7 A;  1XNX A;  3G8O A;  3OLS A;  2HVC A;  4POH A;  5DXK A;  3ZRB A;  4QL8 A;  2ZL9 A;  5DZH A;  4A4W A;  4RE8 A;  3UUC A;  1S0X A;  2YAT A;  3FUR A;  5DXB A;  4L98 A;  4LNW A;  1RK3 A;  1G5Y A;  1XJ7 A;  1YMT A;  4MGB A;  1KNU A;  1K4W A;  1RDT D;  2QA8 B;  4JYH A;  4N1Y A;  5FQT A;  5EI1 A;  2FVJ A;  1NQ0 A;  3PRG A;  2Q6R A;  3IMY A;  4R2U A;  1Z95 A;  2PIX A;  3WTQ A;  4OK1 A;  5JJM A;  1T76 A;  3V9T A;  4FN9 A;  3VSO A;  2P54 A;  3G0W A;  1PQ6 A;  2QA8 A;  4HLW A;  3B0Q A;  4ZN7 A;  1YJE A;  4OH6 A;  1N46 A;  2OVH A;  3NSP A;  3UU7 B;  3W0A A;  4CI4 A;  1YUC A;  2Q8S A;  2VV3 A;  2QZO B;  4DM6 A;  3X1I A;  3M7R A;  2OAX A;  1RDT A;  3W0G A;  3GBK A;  1TXI A;  4DK8 A;  5E0X A;  5ETH A;  2QW4 A;  4OFU A; 
#chains in the Genus database with same CATH homology
 1QKT A;  1NQ1 A;  2QZO A;  3DY6 A;  1PCG A;  2A3I A;  4XI3 A;  2P15 A;  4ZNH A;  3JZB A;  3ZQT A;  2AO6 A;  2YLO A;  4EMA A;  4KZI A;  3R8I A;  3HVL A;  2AXA A;  5DUG A;  2HFP A;  3KPZ A;  2ZK6 A;  1X7R A;  1FD0 A;  4IA1 A;  1SQN A;  4PPP A;  4RZE A;  4JL4 A;  3H0A A;  4IW8 A;  2ZK5 A;  4J5W A;  3GWS X;  1YIN A;  4YNK A;  5DUE A;  4MG6 A;  5DWL A;  5KCD A;  1PZL A;  5DU5 A;  3P88 A;  4PLD A;  3W5P A;  3RY9 A;  1XP6 A;  2AYR A;  3R8A A;  1T7F A;  1XV9 A;  3R5N A;  3V9Y A;  3IA6 A;  2ZNN A;  1UPW A;  2Q6J A;  1FM9 A;  2JJ3 A;  4PP3 A;  2QTU A;  1NAX A;  1R6G A;  5DIE A;  5KR9 A;  2ZMJ A;  3B0W A;  4JYI A;  5DXR A;  3VT5 A;  3OS8 A;  1NAV A;  5KRC A;  1FCZ A;  3IPQ A;  4XT9 A;  3W5Q A;  3CJW A;  1ZKY A;  4R06 A;  5DXM A;  3VTB A;  1PDU A;  2QMV A;  3HM1 A;  4OJ4 A;  1FM6 A;  5E0W A;  1A52 A;  4MG8 B;  3OMM A;  5DLR A;  5DP0 A;  2ZY0 A;  1EXA A;  3OMO A;  4MG9 B;  1I7I A;  2AM9 A;  2R6W A;  5GIE A;  5JI0 D;  3OOF A;  5HJP B;  1R5K A;  4N5G A;  5JY3 A;  5E19 A;  2Q5G A;  1Q4X A;  5APK A;  1T79 A;  2QSE A;  2I4J A;  3TY0 A;  1FCY A;  4MG8 A;  1FBY A;  4MG9 A;  4G1Y A;  4OZR U;  2OM9 A;  4O8F A;  3AZ1 A;  4WLB A;  3DR1 A;  5DRM A;  5DMC A;  3SZ1 A;  4E4Q A;  2PJL A;  3B66 A;  1X7B A;  4G21 A;  5CJ6 A;  2QGW A;  4WVD A;  3VTC A;  3W5R A;  3L03 A;  1S19 A;  3WJ5 A;  1TFC A;  3W0C A;  4RFW A;  5B5B A;  2NV7 A;  3VJT A;  5DIG A;  1T73 A;  2B50 A;  2GTK A;  2GPU A;  3K22 A;  4G1Z A;  2GPO A;  2Q1H A;  1XDK B;  2PIU A;  1MV9 A;  3NSQ A;  4K6I A;  4OKW A;  4PF3 A;  4IA2 A;  3AN4 A;  1PK5 A;  4UDB A;  1YOK A;  1HJ1 A;  2Q5S A;  3R2A A;  5KCF A;  2HWR A;  4MGC A;  1RKH A;  1ZGY A;  1R20 D;  1XDK A;  1M13 A;  4R6S A;  5HZC A;  3FAL A;  2QPY A;  1I37 A;  1NQ2 A;  4TUZ B;  2AB2 A;  4XTA A;  5GID A;  1G2N A;  3A3Z X;  2Q6S A;  5EJV A;  1L2I A;  3W5T A;  4ZNS A;  5DWE A;  1DKF B;  2NXX A;  5DID A;  3FXV A;  1NYX A;  3KBA A;  4DOR A;  1I7G A;  4TUZ A;  2BJ4 B;  5AVI A;  1OSV A;  3L1B A;  1XPC A;  5HYK A;  2VST A;  2FAI A;  3ET1 A;  5DX3 B;  1DKF A;  4EM9 A;  2HCD A;  3B1M A;  5APH A;  1GWQ A;  1IE8 A;  3D24 A;  3L0E A;  5DWI A;  3KFC A;  2BJ4 A;  5DZ3 A;  3FC6 B;  4ZNW A;  3PBA A;  4ZI1 A;  2YHD A;  3IXP A;  5DUH A;  3A9E B;  5AWJ A;  3V4A A;  2I4P A;  1R1K A;  5KRM A;  5ACC A;  5M96 A;  2NW4 A;  2FSZ A;  5KCT A;  1RKG A;  2PIW A;  1S0Z A;  3FC6 A;  1T7M A;  4X1G A;  2QH6 A;  5EHJ A;  2LBD A;  3P8X A;  2Q3Y A;  3KMG A;  3OSW A;  2P1V A;  2G0H A;  1Y9R A;  2Q7I A;  1ZDU A;  4OEA A;  4WQP A;  3VHW A;  2QA6 A;  3WMH A;  4DMA A;  3S9S A;  1GS4 A;  4J5X C;  3P0U A;  4MGA B;  3FUG A;  4LNX A;  5DVC A;  3X31 A;  2PIT A;  3GWX A;  1S9Q A;  1ZAF A;  4OKB A;  5DV3 A;  5DV6 A;  3UP3 A;  2ZNO A;  3CQV A;  3D57 A;  3VT3 A;  3WFF A;  2IHQ A;  3UVV B;  2ABI A;  1GWX A;  5G5W A;  4P6X A;  2JFA B;  3G8I A;  1P8D A;  1DB1 A;  4MGA A;  4OGH A;  5DVS A;  3OKI A;  3ADS A;  5GT4 A;  3V3E A;  5DZ0 A;  2AX8 A;  2ZXN A;  4QK4 A;  2PRG A;  5DZI A;  4FHH A;  3LMP A;  1LV2 A;  2IOK A;  2ZK2 A;  4KZJ A;  3UVV A;  5IAW A;  3KDU A;  2JFA A;  3KMR A;  3L3X A;  1VJB A;  1K74 A;  3X36 A;  2ZMI A;  3KWY A;  2POG A;  3H0A D;  3ERD A;  3IPU A;  3MNP A;  4OLM A;  2B1V A;  2HC4 A;  3E00 A;  1U3S A;  4RMC A;  3UU7 A;  4E4K A;  4F9M A;  2PIN A;  2QXS A;  3BEJ A;  2O9I A;  3HO0 A;  4IWC A;  5L7H A;  3VSP A;  1FM9 D;  5L11 A;  4QE8 A;  4LBD A;  1UHL B;  3F7D A;  3A78 A;  1ZUC A;  1A28 A;  3ADW A;  3K23 A;  4MGD B;  3SP9 A;  5L7G A;  3DZY A;  3DCT A;  4RUJ A;  2GPV A;  4DQM A;  4MG5 A;  2PIO A;  4YMQ A;  2ZLC A;  3CLD A;  3OMP A;  3VRU A;  2Q61 A;  3HOD A;  5DYB A;  4BCR A;  1XB7 A;  1IE9 A;  3FEJ A;  4RWV A;  5E1C A;  5KCW A;  3TX7 B;  3H52 A;  3GN8 A;  4MGD A;  1FM6 D;  4FHI A;  4JYG A;  1MVC A;  5KRO A;  5K13 A;  2P7A A;  3AZ3 A;  1GWR A;  2JF9 A;  1XQ3 A;  2ZNQ A;  3CS6 A;  3E7C A;  5KRI A;  2ACL B;  3WJ4 A;  1X78 A;  4IWF A;  1T7T A;  3W0H A;  3MNO A;  3NOA A;  4OHA A;  3RVF A;  4IQR A;  2QXM A;  3VJH A;  5KRJ A;  4CI5 A;  2H79 A;  3LBD A;  2ZK3 A;  3B68 A;  3CDS A;  2ACL A;  5E15 A;  3K8S A;  1XLS E;  3RLJ A;  3V3Q A;  4ZNU A;  3UUD B;  2ZXM A;  2XKW A;  3WT5 A;  3R29 A;  4RZF A;  3DZU A;  3OMK A;  1NRL A;  4XLD A;  3UUA B;  4POJ A;  2VV1 B;  5HJS A;  1HG4 A;  3B0T A;  5AAU A;  4OZR E;  3VJS A;  3JZC A;  1KV6 A;  3VRT A;  3V49 A;  2GP7 A;  3F5C B;  4LSJ A;  5HJP A;  3OZ0 A;  4OZT U;  2J4A A;  3UUA A;  4UDC A;  5DZ1 A;  2ZMH A;  2VV1 A;  4P6W A;  5KCE A;  3RUU A;  1WM0 X;  2POB A;  4ZJW A;  3VRW A;  4OAR A;  2GWX A;  2XHS A;  3GZ9 A;  4DM8 A;  3W0I A;  1K7L A;  2AWH A;  3BC5 A;  2GPP A;  4IVW A;  3W0Y A;  5FQP A;  3GYT A;  5F9B A;  3R8D A;  2HAR A;  2ATH A;  2W8Y A;  3ADU A;  5KYJ A;  3EYB A;  2ZLA A;  2EWP A;  5HYR A;  1BSX A;  4PRG A;  1XOW A;  2AA6 A;  3T03 A;  5FQR A;  3A2H A;  5AZV A;  4ZJR A;  3OGT A;  1YIM A;  1E3G A;  1YP0 A;  2HWQ A;  2J14 A;  2Q5P A;  4S15 A;  2AX9 A;  2Q60 A;  4QM0 A;  1XP1 A;  2P7G A;  2HAM A;  1QKM A;  2AAX A;  3U9Q A;  4RUO X;  4G20 A;  5KCU A;  1YOW A;  3IXP D;  2R40 A;  2YLY A;  4KZM A;  1QKN A;  4OEY A;  4ZO1 B;  5DI7 A;  1R1K D;  4A2J A;  3FLI A;  2I4Z A;  4NB6 A;  3ET3 A;  3RUT A;  3KDT A;  5KRL A;  1NUO A;  2PNU A;  1FCX A;  3VT4 A;  1KKQ A;  2IOG A;  3A40 X;  1YA3 A;  3B0R A;  1T63 A;  3VHV A;  5DWJ A;  4ITE A;  5L7E A;  1ERR A;  1QKU A;  1SJ0 A;  1U9E A;  2Q1V A;  4ZNV A;  4DK7 A;  3ADX A;  3AZ2 A;  5DL4 A;  2OZ7 A;  2AX7 A;  4HEE X;  4JAZ A;  5DX3 A;  2VV4 B;  4REE A;  2Q7J A;  4J26 A;  4MG7 B;  3OLF A;  1T65 A;  4X1F A;  4YPQ A;  4NUF A;  1G50 A;  3OS9 A;  1ZDT A;  3R5M A;  5EIT A;  3A9E A;  2OUZ A;  4G2I A;  1L2J A;  4A4V A;  4MG7 A;  2J7X A;  2O4J A;  5G43 A;  3W0J A;  1XVP B;  3VT7 A;  2YJD A;  3WGP A;  4QJR A;  4RAK A;  4OIL A;  5DKB A;  1M7W A;  5DSH A;  1K74 D;  1NDE A;  2GL8 A;  2YLP A;  4FNE A;  3P89 A;  2ZBS A;  5KRK A;  3DCU A;  1XVP A;  4WHF A;  3OOK A;  3AUR A;  3HC6 A;  3AFR A;  3OMQ A;  5DYD A;  3X1H A;  3PLZ A;  4J5W C;  3VT6 A;  2ZK0 A;  3CS8 A;  3VHU A;  3OSI A;  2E2R A;  3E00 D;  2J7Y A;  1OVL B;  5DKS A;  2PIR A;  5DXG A;  4J24 A;  4APU A;  1Z5X U;  4XUH A;  3FEI A;  2ZFX A;  2XYX A;  4OEZ A;  3VI8 A;  2I0J A;  4ONI A;  5LGA A;  2ZNP A;  3OKH A;  3DZY D;  2O4R A;  3OZJ A;  1G1U A;  3WT6 A;  4ZNT A;  5IZ0 A;  5KRF A;  1OVL A;  5SYZ A;  5C4S A;  3ERT A;  4S0T A;  3OS8 C;  5I4V A;  4YT1 A;  5DXP A;  2R6Y A;  3RLL A;  2HB7 A;  3PEQ A;  5JJM B;  4NIE A;  4PWL A;  4RUP A;  4OJ9 A;  2G0G A;  3ADV A;  4CSJ A;  2G44 A;  4UDD A;  2NXX E;  3AN3 A;  1XNN A;  4S0S A;  5C4O A;  3GD2 A;  2YLQ A;  1M2Z A;  3L0J A;  3OLL A;  4N73 A;  4PP6 A;  3CWD A;  4WHG A;  2HAS A;  4IW6 A;  4LTW A;  1T7R A;  4S14 A;  2ZAS A;  4OKT A;  5B41 A;  1NHZ A;  5G44 A;  5G45 A;  1Y0X X;  1ILH A;  5DY8 A;  1I38 A;  5G3J A;  3CTB A;  1UHL A;  5DTV A;  1RJK A;  4IA3 A;  2QE4 A;  2NPA A;  3TKC A;  2V7C A;  3VRV A;  5IXK A;  3OAP A;  4IUI A;  3DZU D;  2Q70 A;  5H1E A;  2PIQ A;  3B3K A;  2QR9 A;  2P1T A;  2PIV A;  4G1D A;  2H77 A;  4IVY A;  4J5X A;  4OIV A;  3AX8 A;  2Q7K A;  3ZRA A;  3UP0 A;  1X76 A;  3WFG A;  5HCV A;  3CDP A;  5AYG A;  1XV9 B;  3OSA A;  4IV2 A;  4ZOM A;  1PQC A;  2I0G A;  1XZX X;  5AK2 A;  3B65 A;  1EXX A;  3B67 A;  1YYE A;  1UPV A;  4UDA A;  2HBH A;  3FS1 A;  4OIU A;  4Q13 A;  5DVV A;  1PQ9 A;  5AVL A;  4E2J A;  4OZT E;  3UUD A;  1LBD A;  3WT7 A;  2P7Z A;  5DV8 A;  2PKL A;  3VT8 A;  3K6P A;  5A86 A;  3N00 A;  2B1Z A;  4QE6 A;  3DT3 A;  3O1D A;  1UOM A;  4L96 A;  5KRA A;  4TV1 B;  1E3K A;  1X7E A;  3QT0 A;  3F5C A;  3G9E A;  5AAV B;  2B23 A;  4PVU A;  4REF A;  2ZKC A;  2AA5 A;  5G46 A;  4Q50 A;  3E94 A;  1XQC A;  2R40 D;  2AMB A;  4TV1 A;  4XAO A;  5G42 A;  5AAV A;  4Y29 A;  2AX6 A;  2ZK4 A;  1OSH A;  3HQ5 A;  2Q59 B;  5GIC A;  1XIU A;  2GIU A;  3D5F A;  2QNV A;  4ITF A;  4NY9 A;  3WWR A;  5DXE A;  2ZK1 A;  2PIP L;  4NQA B;  1N4H A;  3O1E A;  4XHD A;  3L3Z A;  4M8H A;  5APJ A;  3MNE A;  1ERE A;  2VV2 A;  2Q59 A;  3VN2 A;  1MZN A;  3KMZ A;  1PRG A;  2Q7L A;  3D90 A;  4WPF A;  3VTD A;  4OC7 A;  1NQ7 A;  3V9V A;  1S9P A;  3ET0 A;  3FAL B;  2XYJ A;  3ZR7 A;  3KYT A;  5DK9 A;  5KRH A;  3VJI A;  4OKX A;  3VT9 A;  1U3Q A;  5LWP A;  5C4U A;  2AA2 A;  3HZF A;  4PP5 A;  4M8E A;  5E14 A;  2VSR A;  1N83 A;  2OCF A;  3AUN A;  4IS8 A;  4PLE A;  4XUM A;  3PCU A;  5KD9 A;  3L0L A;  4PXM A;  2P1U A;  4OH5 A;  2AA7 A;  2VV0 A;  4ZO1 X;  5DMF A;  5AZT A;  2AMA A;  4DOS A;  2P4Y A;  1P93 A;  1H9U A;  2V0V A;  3D6D A;  4OFR A;  1SKX A;  2YJA B;  4PPS A;  1ILG A;  1ZEO A;  4IU7 A;  2OVM A;  2G5O A;  4G2H A;  2VV4 A;  5FQS A;  1R20 A;  2QGT A;  5EC9 A;  4IA7 A;  5C4T A;  4K7A A;  1U3R A;  3B5R A;  2BAW A;  4FGY A;  3A2I A;  3Q95 B;  4MDD A;  1OT7 A;  5DKE A;  3AUQ A;  3A2J A;  5KYA A;  1XAP A;  5DRJ A;  3ILZ A;  4K4J A;  5FQV A;  2ZVT A;  1X7J A;  2Z4B A;  3ADT A;  3BQD A;  2F4B A;  4OJB A;  5ICK A;  4B7W A;  3TKM A;  3Q95 A;  4IV4 A;  4Q0A C;  4OED A;  3SP6 A;  2Z4J A;  4N8R A;  5AWK A;  4JGV A;  3ET2 A;  1Z5X E;  1T5Z A;  5KCC A;  2YFE A;  5DXQ A;  4RME A;  1XP9 A;  5EGV A;  4ZN9 A;  3CS4 A;  5E7V A;  1Y0S A;  4RMD A;  3HC5 A;  4RZG A;  5DWG A;  5DXB B;  3PO9 A;  1YY4 A;  2QAB A;  2REW A;  3IPS A;  4MGB B;  5DKG A;  1XLS A;  1T74 A;  1ZH7 A;  2HB8 A;  2XYW A;  3GYU A;  2ZXZ A;  3HLV A;  1SR7 A;  1XNX A;  3G8O A;  3OLS A;  2HVC A;  4POH A;  5DXK A;  3ZRB A;  4QL8 A;  2ZL9 A;  5DZH A;  4A4W A;  4RE8 A;  3UUC A;  1S0X A;  2YAT A;  3FUR A;  5DXB A;  4L98 A;  4LNW A;  1RK3 A;  1G5Y A;  1XJ7 A;  1YMT A;  4MGB A;  1KNU A;  1K4W A;  1RDT D;  2QA8 B;  4JYH A;  4N1Y A;  5FQT A;  5EI1 A;  2FVJ A;  1NQ0 A;  3PRG A;  2Q6R A;  3IMY A;  4R2U A;  1Z95 A;  2PIX A;  3WTQ A;  4OK1 A;  5JJM A;  1T76 A;  3V9T A;  4FN9 A;  3VSO A;  2P54 A;  3G0W A;  1PQ6 A;  2QA8 A;  4HLW A;  3B0Q A;  4ZN7 A;  1YJE A;  4OH6 A;  1N46 A;  2OVH A;  3NSP A;  3UU7 B;  3W0A A;  4CI4 A;  1YUC A;  2Q8S A;  2VV3 A;  2QZO B;  4DM6 A;  3X1I A;  3M7R A;  2OAX A;  1RDT A;  3W0G A;  3GBK A;  1TXI A;  4DK8 A;  5E0X A;  5ETH A;  2QW4 A;  4OFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...