2VV1B

Hppargamma ligand binding domain in complex with 4-hdha
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
265
structure length
239
Chain Sequence
SDLRALAKHLYDSYIKSFPLTKAKARAILTGKDKSPFVIYDMNSLMMGEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTPLLQEIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Activation of Pparg by Oxidised Fatty Acids
pubmed doi rcsb
molecule keywords PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA
molecule tags Receptor
source organism Homo sapiens
total genus 84
structure length 239
sequence length 265
ec nomenclature
pdb deposition date 2008-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2vv1B00
3F5CA 2HAMA 4PVUA 2BJ4B 5H1EA 4PP3A 2GIUA 4OJBA 4WVDA 2POBA 2PIXA 3GWXA 3X36A 1U3QA 2QXMA 3HC6A 5DKEA 3VRUA 3BC5A 3V3EA 2AWHA 3A78A 3CWDA 4QE8A 4RMCA 5DXBB 3CTBA 1K74A 1XDKB 3G8IA 3VT6A 3HODA 2ZL9A 1YINA 5GT4A 1RDTA 3VT3A 3WT7A 3E94A 4IW8A 5HJSA 2ZNQA 1A52A 4RZFA 1YP0A 5DMFA 5EHJA 3OGTA 5SYZA 4LBDA 5DRJA 2R6WA 5CJ6A 3AX8A 3WFGA 5C4SA 1UHLB 4ITEA 3VT5A 4Q13A 3ET3A 3AN3A 4OZTE 1XB7A 5DKGA 1A28A 5DV3A 2FSZA 3PLZA 2PNUA 1XNXA 4MGAA 5IXKA 1M13A 3K23A 2ZK6A 3E7CA 3HC5A 4S14A 5L7HA 5B5BA 2R6YA 3RVFA 1GWRA 1PCGA 3L3XA 5DKSA 5KCDA 2YLOA 4RUOX 3P88A 3CS4A 5KCUA 2Q59B 3WMHA 2J7XA 3K22A 1UPVA 4J5XA 3VHVA 4G1DA 2J7YA 4S15A 4R2UA 2P1UA 4JYHA 3CQVA 5DZHA 4RAKA 3M7RA 1YJEA 4EMAA 3OS8A 1KNUA 2QR9A 3ADWA 4PPPA 5APJA 3F5CB 3W0YA 1T74A 1NQ7A 3D90A 4Y29A 5HYKA 2NPAA 5DVVA 4POJA 3ADVA 3B1MA 3X1HA 4NQAB 4F9MA 1DKFB 1QKMA 2VV0A 4OARA 4OEDA 3W5RA 3SP6A 3ADUA 2YLPA 4S0TA 2QGWA 1XQCA 4FHIA 3E00A 2ZK5A 1ZUCA 3A40X 1RJKA 2PIUA 4OZRE 3WGPA 2REWA 5EI1A 5AAUA 2NV7A 1S19A 4XI3A 1ZDTA 1E3KA 4OLMA 5AAVB 5ETHA 5DXGA 4OFUA 2ZK3A 2H77A 5DXRA 5DWGA 2VV4A 3IPQA 5KR9A 1FM6A 5DZIA 1ZKYA 4MG9B 2AYRA 5ACCA 1U9EA 3HO0A 3VT9A 2YATA 3IA6A 3CDPA 3D57A 3HM1A 3RLJA 1XP6A 5DL4A 4MGAB 1KKQA 5IZ0A 1OT7A 2QPYA 3B67A 1T7TA 4QL8A 1OVLB 3WJ5A 4RE8A 2FAIA 3W0JA 2P1VA 3KWYA 3W0AA 1FD0A 1QKTA 2Q7LA 2QE4A 2XYJA 3W0CA 4IVYA 4ZNTA 4DQMA 1M2ZA 5DZ1A 4MG8A 2ZK4A 3FEIA 3OSAA 4POHA 3DCTA 5DZ0A 5KROA 2I4ZA 2R40D 3S9SA 5DK9A 5DXBA 3VT4A 5DX3B 3VTDA 3WT6A 1QKNA 1XDKA 1G5YA 2R40A 1I7GA 5E15A 5EC9A 5AK2A 1TFCA 3ADXA 2AA6A 3T03A 4DMAA 4QJRA 5DUEA 5AWJA 3FLIA 1X7RA 2YLQA 2AA2A 1G2NA 4K6IA 1QKUA 4X1GA 4A4VA 2GTKA 2VSRA 3VJSA 2NXXE 4WQPA 4DK8A 1GWXA 5DIEA 1UHLA 3UUAB 5KRFA 5DYBA 5DP0A 3EYBA 3PRGA 2QZOB 5AWKA 5KRJA 2Q5GA 4PXMA 3UU7B 3KDTA 1H9UA 4KZMA 4UDCA 1XNNA 2Q1VA 3V9TA 3AZ1A 5FQVA 1GS4A 2I0GA 2P7AA 2Q8SA 4WPFA 5KRMA 4ZOMA 5GIDA 2Q59A 5L7GA 3P89A 2JJ3A 3V49A 4P6XA 1SKXA 2AX6A 2HARA 2P4YA 2Z4JA 5APHA 5KRHA 4IU7A 2IHQA 1WM0X 2O4JA 1YYEA 1EXXA 4MG8B 3PEQA 5DUGA 3B3KA 4XLDA 2P1TA 3A2IA 1DKFA 2HC4A 4NUFA 1K74D 4RMDA 3UVVB 1RDTD 3VT8A 4ZNSA 2ZMHA 2Z4BA 4REFA 5K13A 1FCXA 3OMKA 3OS8C 4MG7B 1MVCA 4ZNHA 1UPWA 1SQNA 3PCUA 1T7MA 1G1UA 5KCEA 5AAVA 4RZGA 2ZNPA 4PWLA 5F9BA 2FVJA 4LNXA 4LSJA 1PQCA 4G21A 4YNKA 5EJVA 4MG9A 4FNEA 4E2JA 1ZAFA 5L7EA 1BSXA 3IPSA 5HJPB 4KZIA 3BEJA 3OZ0A 3VSOA 3GYUA 5DV8A 3W0GA 5DXQA 2QMVA 2HFPA 1N83A 3L0LA 1HJ1A 3IXPD 4IWFA 4PLEA 1OVLA 5G3JA 2I0JA 2V0VA 2ZVTA 3ERTA 3OLLA 2Q70A 5LWPA 3IXPA 5G44A 3OMQA 5DIDA 1Z95A 5DVSA 3P8XA 1S9PA 2NXXA 2PIWA 3AZ3A 2Q60A 4K7AA 3W5PA 4BCRA 3P0UA 2YFEA 2O9IA 3A9EB 2VV1B 5DVCA 4WHGA 2IOGA 2QA8B 3ZR7A 3D5FA 4JAZA 3B5RA 3R8AA 3CLDA 3GN8A 3KYTA 1R6GA 5DI7A 3KFCA 3R8DA 2PJLA 3A2HA 4N73A 2YJDA 4XAOA 5DV6A 3E00D 4G20A 2E2RA 3OMOA 5DX3A 1E3GA 1T79A 2OM9A 4HEEX 1ILGA 2AX9A 2HB8A 1XOWA 5FQTA 2AX7A 3AFRA 3FC6A 5L11A 3OS9A 3ZRAA 5JY3A 2QA6A 3CJWA 3UUDB 2Q1HA 3ERDA 3K6PA 1NDEA 4XUHA 1FM6D 3A3ZX 1X7JA 3OZJA 4RMEA 3VSPA 3TY0A 3UUAA 4XTAA 5G42A 3V4AA 3V3QA 3TKMA 2V7CA 2W8YA 4OHAA 2YHDA 2QZOA 1NUOA 4DOSA 3UU7A 5E0WA 3MNPA 3DZUA 1PK5A 4LTWA 2QNVA 4OC7A 5KRKA 2P7ZA 1K7LA 5I4VA 4MGCA 1EREA 2NW4A 2OUZA 2Q5PA 4IUIA 5B41A 1RK3A 3FURA 4OK1A 2ZMIA 3R5MA 3X31A 3FEJA 4MG5A 2HCDA 2ZMJA 2LBDA 5DYDA 4RWVA 3PO9A 5HYRA 3OKHA 1T5ZA 4N8RA 3KDUA 5AVLA 2PITA 2OVHA 2IOKA 3MNEA 2QGTA 4M8HA 5DZ3A 2AB2A 1FCZA 2ZFXA 3AN4A 3LMPA 3OMMA 1NHZA 4P6WA 3Q95B 5A86A 2ZLAA 4J5WC 1U3SA 5DKBA 4WLBA 2PKLA 5C4OA 3R2AA 2ZXZA 2ZASA 3H0AA 3WT5A 2VV2A 1X76A 2QTUA 1I37A 2PIOA 1S9QA 3G0WA 4IW6A 4NB6A 5DXKA 1R5KA 3UVVA 1NAVA 2Q5SA 4PP6A 5DTVA 5E7VA 3ADSA 3JZBA 1XAPA 4MG7A 4CSJA 1ZH7A 2GPOA 3FC6B 2QSEA 2Q7IA 4Q0AC 4OJ4A 5EGVA 1SR7A 2PINA 4ZJRA 1T7FA 2ZBSA 3DCUA 3O1EA 4OKXA 2ATHA 5E19A 5G5WA 1GWQA 1IE8A 1P93A 3GZ9A 1VJBA 2P15A 3CS8A 3FS1A 2GP7A 2ABIA 4XUMA 5KCCA 4X1FA 3F7DA 4IS8A 3KPZA 4UDDA 3GD2A 3B0RA 1NQ0A 4QE6A 1FBYA 2POGA 5HJPA 5KRIA 1XP1A 3DR1A 2Q61A 2AMBA 3L1BA 1LV2A 4JYIA 1R1KD 3G8OA 3AURA 2ZKCA 5DY8A 4R6SA 4OKTA 4OEAA 5LGAA 4OEZA 4G1ZA 4ZNVA 5DMCA 4MGDB 2ZNNA 4ZO1B 4YPQA 1NQ2A 1R1KA 3AUNA 4L96A 2XHSA 4ZJWA 3FUGA 4ZN7A 1ERRA 3HVLA 4MGBB 1XVPB 2F4BA 1PDUA 3A9EA 2VV1A 4REEA 1Y0XX 2QA8A 2XKWA 5DLRA 1XIUA 1T65A 5KRCA 3AUQA 4LNWA 5ICKA 3KBAA 1Z5XU 1ZDUA 3G9EA 1RKGA 4WHFA 2ZK0A 2Q7JA 4PLDA 1T7RA 2AA7A 5AYGA 5AZTA 3W0IA 3OSIA 2ZK2A 5JI0D 2XYWA 3W5TA 2Q6JA 4J5XC 3WFFA 2ACLB 3BQDA 3CDSA 1I38A 3ET2A 5IAWA 2VSTA 3V9VA 4RFWA 5G45A 3U9QA 2PRGA 4OIVA 4OGHA 5KCWA 4MG6A 3UUDA 4FGYA 1TXIA 4A4WA 2O4RA 2PIVA 1DB1A 4UDBA 5KYAA 4E4QA 1FM9A 4UDAA 4OH5A 3KMGA 1XLSE 4NIEA 3N00A 4ZNWA 5DXEA 2EWPA 1P8DA 1YOWA 2QABA 5DUHA 4EM9A 1L2JA 3ET0A 4Q50A 4RUJA 5GIEA 3DZYD 1YUCA 3D6DA 2OCFA 3NSPA 4TUZB 1N46A 4IV4A 5KCTA 2VV3A 3KMZA 4IV2A 3DZYA 4XHDA 2GPUA 1X78A 2AA5A 4S0SA 5GICA 1NRLA 5KRAA 2HVCA 2HASA 1X7BA 1XJ7A 1SJ0A 1HG4A 4HLWA 4K4JA 4DM6A 1YOKA 3FALB 4TV1B 1OSHA 1S0ZA 3UP3A 2AO6A 3VJIA 5JJMB 2GPPA 3Q95A 2QW4A 3OAPA 1XV9B 3VRVA 3DY6A 1YA3A 3H52A 2J4AA 2HBHA 2JFAB 2YJAB 3GWSX 3L0EA 4ITFA 5E14A 3X1IA 1PQ9A 3B68A 1MV9A 1OSVA 4DORA 4N5GA 4L98A 1PRGA 4OFRA 3UUCA 5G43A 4J26A 4B7WA 3WWRA 3UP0A 1M7WA 3B0WA 3VHWA 3OSWA 4E4KA 4KZJA 4PRGA 4FHHA 4N1YA 2G44A 3CS6A 3L3ZA 2ZNOA 2J14A 3W0HA 2G5OA 4M8EA 4G2HA 3ZQTA 1L2IA 1Y9RA 3TKCA 1RKHA 3DZUD 4IQRA 3L0JA 4JL4A 5DXMA 3W5QA 3VJTA 4PF3A 3VTBA 3ADTA 5DWLA 4G2IA 1YIMA 1YMTA 4IVWA 4DK7A 3R5NA 4YMQA 5KYJA 2AX8A 2Q7KA 5M96A 4YT1A 4QM0A 3DT3A 3NOAA 4XT9A 3ZRBA 1KV6A 4IWCA 3ILZA 3R29A 1Z5XE 4MGDA 4OKWA 3OLFA 4PPSA 5FQPA 4QK4A 1NQ1A 5DRMA 5C4TA 2I4PA 3VI8A 1LBDA 1U3RA 3V9YA 4FN9A 4MGBA 2AM9A 4ZI1A 1XVPA 1I7IA 5C4UA 1XZXX 3RY9A 1IE9A 1K4WA 3K8SA 3B0QA 2ZXNA 4CI5A 5AVIA 1XLSA 4DM8A 3VTCA 2A3IA 3H0AD 4ONIA 3AZ2A 3HQ5A 1FCYA 4G1YA 3OMPA 3B66A 2HWQA 3NSQA 3JZCA 3R8IA 5AZVA 4OJ9A 1XP9A 2ZK1A 2QXSA 5FQSA 3OOKA 4R06A 1N4HA 2ACLA 4O8FA 4OH6A 3VN2A 2G0GA 2PIPL 5KD9A 4OILA 1PZLA 3RUTA 2XYXA 5HCVA 3B0TA 2Q3YA 3D24A 3WTQA 5DWEA 2B23A 3GYTA 5E1CA 3SZ1A 2P7GA 1NYXA 4OZTU 1R20D 2HWRA 3SP9A 4MDDA 1PQ6A 1Y0SA 2AXAA 3HLVA 2BJ4A 3OKIA 5DWIA 4JYGA 5DU5A 5EITA 2B1ZA 1T76A 4NY9A 1R20A 4OKBA 2OZ7A 2PIQA 3IPUA 1UOMA 3GBKA 4TUZA 4APUA 4RUPA 1MZNA 3MNOA 2G0HA 2YLYA 4J24A 3KMRA 3OLSA 3PBAA 3VHUA 5E0XA 2OVMA 2OAXA 2BAWA 3O1DA 2B1VA 4IA1A 4RZEA 4CI4A 1X7EA 5G46A 3OOFA 3VJHA 4IA7A 2GWXA 3RUUA 3L03A 5DWJA 2P54A 2Q6SA 3FALA 4TV1A 2AMAA 2AAXA 5JJMA 3VT7A 3VRTA 3ET1A 3VRWA 2JF9A 1XV9A 3WJ4A 2GL8A 1XPCA 1EXAA 2VV4B 3TX7B 2JFAA 4ZNUA 5DSHA 4ZN9A 1S0XA 2PIRA 3LBDA 2GPVA 4OZRU 1ZEOA 1Q4XA 5HZCA 3B65A 1G50A 1XQ3A 4IA2A 5KCFA 1ILHA 2ZLCA 3A2JA 3IMYA 4J5WA 5FQRA 4JGVA 4IA3A 5DIGA 2B50A 3FXVA 2ZXMA 5DXPA 5KRLA 1FM9D 1T73A 4OEYA 3HZFA 1ZGYA 3QT0A 2HB7A 1T63A 4ZO1X 2I4JA 4OIUA 4PP5A 1YY4A 5APKA 2H79A 2Q6RA 2QH6A 4A2JA 1NAXA 3RLLA 2ZY0A
chains in the Genus database with same CATH superfamily
3F5CA 2HAMA 4PVUA 2BJ4B 5H1EA 4PP3A 2GIUA 4OJBA 4WVDA 2POBA 2PIXA 3GWXA 3X36A 1U3QA 2QXMA 3HC6A 5DKEA 3VRUA 3BC5A 3V3EA 2AWHA 3A78A 3CWDA 4QE8A 4RMCA 5DXBB 3CTBA 1K74A 1XDKB 3G8IA 3VT6A 3HODA 2ZL9A 1YINA 5GT4A 1RDTA 3VT3A 3WT7A 3E94A 4IW8A 5HJSA 2ZNQA 1A52A 4RZFA 1YP0A 5DMFA 5EHJA 3OGTA 5SYZA 4LBDA 5DRJA 2R6WA 5CJ6A 3AX8A 3WFGA 5C4SA 1UHLB 4ITEA 3VT5A 4Q13A 3ET3A 3AN3A 4OZTE 1XB7A 5DKGA 1A28A 5DV3A 2FSZA 3PLZA 2PNUA 1XNXA 4MGAA 5IXKA 1M13A 3K23A 2ZK6A 3E7CA 3HC5A 4S14A 5L7HA 5B5BA 2R6YA 3RVFA 1GWRA 1PCGA 3L3XA 5DKSA 5KCDA 2YLOA 4RUOX 3P88A 3CS4A 5KCUA 2Q59B 3WMHA 2J7XA 3K22A 1UPVA 4J5XA 3VHVA 4G1DA 2J7YA 4S15A 4R2UA 2P1UA 4JYHA 3CQVA 5DZHA 4RAKA 3M7RA 1YJEA 4EMAA 3OS8A 1KNUA 2QR9A 3ADWA 4PPPA 5APJA 3F5CB 3W0YA 1T74A 1NQ7A 3D90A 4Y29A 5HYKA 2NPAA 5DVVA 4POJA 3ADVA 3B1MA 3X1HA 4NQAB 4F9MA 1DKFB 1QKMA 2VV0A 4OARA 4OEDA 3W5RA 3SP6A 3ADUA 2YLPA 4S0TA 2QGWA 1XQCA 4FHIA 3E00A 2ZK5A 1ZUCA 3A40X 1RJKA 2PIUA 4OZRE 3WGPA 2REWA 5EI1A 5AAUA 2NV7A 1S19A 4XI3A 1ZDTA 1E3KA 4OLMA 5AAVB 5ETHA 5DXGA 4OFUA 2ZK3A 2H77A 5DXRA 5DWGA 2VV4A 3IPQA 5KR9A 1FM6A 5DZIA 1ZKYA 4MG9B 2AYRA 5ACCA 1U9EA 3HO0A 3VT9A 2YATA 3IA6A 3CDPA 3D57A 3HM1A 3RLJA 1XP6A 5DL4A 4MGAB 1KKQA 5IZ0A 1OT7A 2QPYA 3B67A 1T7TA 4QL8A 1OVLB 3WJ5A 4RE8A 2FAIA 3W0JA 2P1VA 3KWYA 3W0AA 1FD0A 1QKTA 2Q7LA 2QE4A 2XYJA 3W0CA 4IVYA 4ZNTA 4DQMA 1M2ZA 5DZ1A 4MG8A 2ZK4A 3FEIA 3OSAA 4POHA 3DCTA 5DZ0A 5KROA 2I4ZA 2R40D 3S9SA 5DK9A 5DXBA 3VT4A 5DX3B 3VTDA 3WT6A 1QKNA 1XDKA 1G5YA 2R40A 1I7GA 5E15A 5EC9A 5AK2A 1TFCA 3ADXA 2AA6A 3T03A 4DMAA 4QJRA 5DUEA 5AWJA 3FLIA 1X7RA 2YLQA 2AA2A 1G2NA 4K6IA 1QKUA 4X1GA 4A4VA 2GTKA 2VSRA 3VJSA 2NXXE 4WQPA 4DK8A 1GWXA 5DIEA 1UHLA 3UUAB 5KRFA 5DYBA 5DP0A 3EYBA 3PRGA 2QZOB 5AWKA 5KRJA 2Q5GA 4PXMA 3UU7B 3KDTA 1H9UA 4KZMA 4UDCA 1XNNA 2Q1VA 3V9TA 3AZ1A 5FQVA 1GS4A 2I0GA 2P7AA 2Q8SA 4WPFA 5KRMA 4ZOMA 5GIDA 2Q59A 5L7GA 3P89A 2JJ3A 3V49A 4P6XA 1SKXA 2AX6A 2HARA 2P4YA 2Z4JA 5APHA 5KRHA 4IU7A 2IHQA 1WM0X 2O4JA 1YYEA 1EXXA 4MG8B 3PEQA 5DUGA 3B3KA 4XLDA 2P1TA 3A2IA 1DKFA 2HC4A 4NUFA 1K74D 4RMDA 3UVVB 1RDTD 3VT8A 4ZNSA 2ZMHA 2Z4BA 4REFA 5K13A 1FCXA 3OMKA 3OS8C 4MG7B 1MVCA 4ZNHA 1UPWA 1SQNA 3PCUA 1T7MA 1G1UA 5KCEA 5AAVA 4RZGA 2ZNPA 4PWLA 5F9BA 2FVJA 4LNXA 4LSJA 1PQCA 4G21A 4YNKA 5EJVA 4MG9A 4FNEA 4E2JA 1ZAFA 5L7EA 1BSXA 3IPSA 5HJPB 4KZIA 3BEJA 3OZ0A 3VSOA 3GYUA 5DV8A 3W0GA 5DXQA 2QMVA 2HFPA 1N83A 3L0LA 1HJ1A 3IXPD 4IWFA 4PLEA 1OVLA 5G3JA 2I0JA 2V0VA 2ZVTA 3ERTA 3OLLA 2Q70A 5LWPA 3IXPA 5G44A 3OMQA 5DIDA 1Z95A 5DVSA 3P8XA 1S9PA 2NXXA 2PIWA 3AZ3A 2Q60A 4K7AA 3W5PA 4BCRA 3P0UA 2YFEA 2O9IA 3A9EB 2VV1B 5DVCA 4WHGA 2IOGA 2QA8B 3ZR7A 3D5FA 4JAZA 3B5RA 3R8AA 3CLDA 3GN8A 3KYTA 1R6GA 5DI7A 3KFCA 3R8DA 2PJLA 3A2HA 4N73A 2YJDA 4XAOA 5DV6A 3E00D 4G20A 2E2RA 3OMOA 5DX3A 1E3GA 1T79A 2OM9A 4HEEX 1ILGA 2AX9A 2HB8A 1XOWA 5FQTA 2AX7A 3AFRA 3FC6A 5L11A 3OS9A 3ZRAA 5JY3A 2QA6A 3CJWA 3UUDB 2Q1HA 3ERDA 3K6PA 1NDEA 4XUHA 1FM6D 3A3ZX 1X7JA 3OZJA 4RMEA 3VSPA 3TY0A 3UUAA 4XTAA 5G42A 3V4AA 3V3QA 3TKMA 2V7CA 2W8YA 4OHAA 2YHDA 2QZOA 1NUOA 4DOSA 3UU7A 5E0WA 3MNPA 3DZUA 1PK5A 4LTWA 2QNVA 4OC7A 5KRKA 2P7ZA 1K7LA 5I4VA 4MGCA 1EREA 2NW4A 2OUZA 2Q5PA 4IUIA 5B41A 1RK3A 3FURA 4OK1A 2ZMIA 3R5MA 3X31A 3FEJA 4MG5A 2HCDA 2ZMJA 2LBDA 5DYDA 4RWVA 3PO9A 5HYRA 3OKHA 1T5ZA 4N8RA 3KDUA 5AVLA 2PITA 2OVHA 2IOKA 3MNEA 2QGTA 4M8HA 5DZ3A 2AB2A 1FCZA 2ZFXA 3AN4A 3LMPA 3OMMA 1NHZA 4P6WA 3Q95B 5A86A 2ZLAA 4J5WC 1U3SA 5DKBA 4WLBA 2PKLA 5C4OA 3R2AA 2ZXZA 2ZASA 3H0AA 3WT5A 2VV2A 1X76A 2QTUA 1I37A 2PIOA 1S9QA 3G0WA 4IW6A 4NB6A 5DXKA 1R5KA 3UVVA 1NAVA 2Q5SA 4PP6A 5DTVA 5E7VA 3ADSA 3JZBA 1XAPA 4MG7A 4CSJA 1ZH7A 2GPOA 3FC6B 2QSEA 2Q7IA 4Q0AC 4OJ4A 5EGVA 1SR7A 2PINA 4ZJRA 1T7FA 2ZBSA 3DCUA 3O1EA 4OKXA 2ATHA 5E19A 5G5WA 1GWQA 1IE8A 1P93A 3GZ9A 1VJBA 2P15A 3CS8A 3FS1A 2GP7A 2ABIA 4XUMA 5KCCA 4X1FA 3F7DA 4IS8A 3KPZA 4UDDA 3GD2A 3B0RA 1NQ0A 4QE6A 1FBYA 2POGA 5HJPA 5KRIA 1XP1A 3DR1A 2Q61A 2AMBA 3L1BA 1LV2A 4JYIA 1R1KD 3G8OA 3AURA 2ZKCA 5DY8A 4R6SA 4OKTA 4OEAA 5LGAA 4OEZA 4G1ZA 4ZNVA 5DMCA 4MGDB 2ZNNA 4ZO1B 4YPQA 1NQ2A 1R1KA 3AUNA 4L96A 2XHSA 4ZJWA 3FUGA 4ZN7A 1ERRA 3HVLA 4MGBB 1XVPB 2F4BA 1PDUA 3A9EA 2VV1A 4REEA 1Y0XX 2QA8A 2XKWA 5DLRA 1XIUA 1T65A 5KRCA 3AUQA 4LNWA 5ICKA 3KBAA 1Z5XU 1ZDUA 3G9EA 1RKGA 4WHFA 2ZK0A 2Q7JA 4PLDA 1T7RA 2AA7A 5AYGA 5AZTA 3W0IA 3OSIA 2ZK2A 5JI0D 2XYWA 3W5TA 2Q6JA 4J5XC 3WFFA 2ACLB 3BQDA 3CDSA 1I38A 3ET2A 5IAWA 2VSTA 3V9VA 4RFWA 5G45A 3U9QA 2PRGA 4OIVA 4OGHA 5KCWA 4MG6A 3UUDA 4FGYA 1TXIA 4A4WA 2O4RA 2PIVA 1DB1A 4UDBA 5KYAA 4E4QA 1FM9A 4UDAA 4OH5A 3KMGA 1XLSE 4NIEA 3N00A 4ZNWA 5DXEA 2EWPA 1P8DA 1YOWA 2QABA 5DUHA 4EM9A 1L2JA 3ET0A 4Q50A 4RUJA 5GIEA 3DZYD 1YUCA 3D6DA 2OCFA 3NSPA 4TUZB 1N46A 4IV4A 5KCTA 2VV3A 3KMZA 4IV2A 3DZYA 4XHDA 2GPUA 1X78A 2AA5A 4S0SA 5GICA 1NRLA 5KRAA 2HVCA 2HASA 1X7BA 1XJ7A 1SJ0A 1HG4A 4HLWA 4K4JA 4DM6A 1YOKA 3FALB 4TV1B 1OSHA 1S0ZA 3UP3A 2AO6A 3VJIA 5JJMB 2GPPA 3Q95A 2QW4A 3OAPA 1XV9B 3VRVA 3DY6A 1YA3A 3H52A 2J4AA 2HBHA 2JFAB 2YJAB 3GWSX 3L0EA 4ITFA 5E14A 3X1IA 1PQ9A 3B68A 1MV9A 1OSVA 4DORA 4N5GA 4L98A 1PRGA 4OFRA 3UUCA 5G43A 4J26A 4B7WA 3WWRA 3UP0A 1M7WA 3B0WA 3VHWA 3OSWA 4E4KA 4KZJA 4PRGA 4FHHA 4N1YA 2G44A 3CS6A 3L3ZA 2ZNOA 2J14A 3W0HA 2G5OA 4M8EA 4G2HA 3ZQTA 1L2IA 1Y9RA 3TKCA 1RKHA 3DZUD 4IQRA 3L0JA 4JL4A 5DXMA 3W5QA 3VJTA 4PF3A 3VTBA 3ADTA 5DWLA 4G2IA 1YIMA 1YMTA 4IVWA 4DK7A 3R5NA 4YMQA 5KYJA 2AX8A 2Q7KA 5M96A 4YT1A 4QM0A 3DT3A 3NOAA 4XT9A 3ZRBA 1KV6A 4IWCA 3ILZA 3R29A 1Z5XE 4MGDA 4OKWA 3OLFA 4PPSA 5FQPA 4QK4A 1NQ1A 5DRMA 5C4TA 2I4PA 3VI8A 1LBDA 1U3RA 3V9YA 4FN9A 4MGBA 2AM9A 4ZI1A 1XVPA 1I7IA 5C4UA 1XZXX 3RY9A 1IE9A 1K4WA 3K8SA 3B0QA 2ZXNA 4CI5A 5AVIA 1XLSA 4DM8A 3VTCA 2A3IA 3H0AD 4ONIA 3AZ2A 3HQ5A 1FCYA 4G1YA 3OMPA 3B66A 2HWQA 3NSQA 3JZCA 3R8IA 5AZVA 4OJ9A 1XP9A 2ZK1A 2QXSA 5FQSA 3OOKA 4R06A 1N4HA 2ACLA 4O8FA 4OH6A 3VN2A 2G0GA 2PIPL 5KD9A 4OILA 1PZLA 3RUTA 2XYXA 5HCVA 3B0TA 2Q3YA 3D24A 3WTQA 5DWEA 2B23A 3GYTA 5E1CA 3SZ1A 2P7GA 1NYXA 4OZTU 1R20D 2HWRA 3SP9A 4MDDA 1PQ6A 1Y0SA 2AXAA 3HLVA 2BJ4A 3OKIA 5DWIA 4JYGA 5DU5A 5EITA 2B1ZA 1T76A 4NY9A 1R20A 4OKBA 2OZ7A 2PIQA 3IPUA 1UOMA 3GBKA 4TUZA 4APUA 4RUPA 1MZNA 3MNOA 2G0HA 2YLYA 4J24A 3KMRA 3OLSA 3PBAA 3VHUA 5E0XA 2OVMA 2OAXA 2BAWA 3O1DA 2B1VA 4IA1A 4RZEA 4CI4A 1X7EA 5G46A 3OOFA 3VJHA 4IA7A 2GWXA 3RUUA 3L03A 5DWJA 2P54A 2Q6SA 3FALA 4TV1A 2AMAA 2AAXA 5JJMA 3VT7A 3VRTA 3ET1A 3VRWA 2JF9A 1XV9A 3WJ4A 2GL8A 1XPCA 1EXAA 2VV4B 3TX7B 2JFAA 4ZNUA 5DSHA 4ZN9A 1S0XA 2PIRA 3LBDA 2GPVA 4OZRU 1ZEOA 1Q4XA 5HZCA 3B65A 1G50A 1XQ3A 4IA2A 5KCFA 1ILHA 2ZLCA 3A2JA 3IMYA 4J5WA 5FQRA 4JGVA 4IA3A 5DIGA 2B50A 3FXVA 2ZXMA 5DXPA 5KRLA 1FM9D 1T73A 4OEYA 3HZFA 1ZGYA 3QT0A 2HB7A 1T63A 4ZO1X 2I4JA 4OIUA 4PP5A 1YY4A 5APKA 2H79A 2Q6RA 2QH6A 4A2JA 1NAXA 3RLLA 2ZY0A
chains in the Genus database with same CATH topology
3F5CA 2HAMA 4PVUA 2BJ4B 5H1EA 4PP3A 2GIUA 4OJBA 4WVDA 2POBA 2PIXA 3GWXA 3X36A 1U3QA 2QXMA 3HC6A 5DKEA 3VRUA 3BC5A 3V3EA 2AWHA 3A78A 3CWDA 4QE8A 4RMCA 5DXBB 3CTBA 1K74A 1XDKB 3G8IA 3VT6A 3HODA 2ZL9A 1YINA 5GT4A 1RDTA 3VT3A 3WT7A 3E94A 4IW8A 5HJSA 2ZNQA 1A52A 4RZFA 1YP0A 5DMFA 5EHJA 3OGTA 5SYZA 4LBDA 5DRJA 2R6WA 5CJ6A 3AX8A 3WFGA 5C4SA 1UHLB 4ITEA 3VT5A 4Q13A 3ET3A 3AN3A 4OZTE 1XB7A 5DKGA 1A28A 5DV3A 2FSZA 3PLZA 2PNUA 1XNXA 4MGAA 5IXKA 1M13A 3K23A 2ZK6A 3E7CA 3HC5A 4S14A 5L7HA 5B5BA 2R6YA 3RVFA 1GWRA 1PCGA 3L3XA 5DKSA 5KCDA 2YLOA 4RUOX 3P88A 3CS4A 5KCUA 2Q59B 3WMHA 2J7XA 3K22A 1UPVA 4J5XA 3VHVA 4G1DA 2J7YA 4S15A 4R2UA 2P1UA 4JYHA 3CQVA 5DZHA 4RAKA 3M7RA 1YJEA 4EMAA 3OS8A 1KNUA 2QR9A 3ADWA 4PPPA 5APJA 3F5CB 3W0YA 1T74A 1NQ7A 3D90A 4Y29A 5HYKA 2NPAA 5DVVA 4POJA 3ADVA 3B1MA 3X1HA 4NQAB 4F9MA 1DKFB 1QKMA 2VV0A 4OARA 4OEDA 3W5RA 3SP6A 3ADUA 2YLPA 4S0TA 2QGWA 1XQCA 4FHIA 3E00A 2ZK5A 1ZUCA 3A40X 1RJKA 2PIUA 4OZRE 3WGPA 2REWA 5EI1A 5AAUA 2NV7A 1S19A 4XI3A 1ZDTA 1E3KA 4OLMA 5AAVB 5ETHA 5DXGA 4OFUA 2ZK3A 2H77A 5DXRA 5DWGA 2VV4A 3IPQA 5KR9A 1FM6A 5DZIA 1ZKYA 4MG9B 2AYRA 5ACCA 1U9EA 3HO0A 3VT9A 2YATA 3IA6A 3CDPA 3D57A 3HM1A 3RLJA 1XP6A 5DL4A 4MGAB 1KKQA 5IZ0A 1OT7A 2QPYA 3B67A 1T7TA 4QL8A 1OVLB 3WJ5A 4RE8A 2FAIA 3W0JA 2P1VA 3KWYA 3W0AA 1FD0A 1QKTA 2Q7LA 2QE4A 2XYJA 3W0CA 4IVYA 4ZNTA 4DQMA 1M2ZA 5DZ1A 4MG8A 2ZK4A 3FEIA 3OSAA 4POHA 3DCTA 5DZ0A 5KROA 2I4ZA 2R40D 3S9SA 5DK9A 5DXBA 3VT4A 5DX3B 3VTDA 3WT6A 1QKNA 1XDKA 1G5YA 2R40A 1I7GA 5E15A 5EC9A 5AK2A 1TFCA 3ADXA 2AA6A 3T03A 4DMAA 4QJRA 5DUEA 5AWJA 3FLIA 1X7RA 2YLQA 2AA2A 1G2NA 4K6IA 1QKUA 4X1GA 4A4VA 2GTKA 2VSRA 3VJSA 2NXXE 4WQPA 4DK8A 1GWXA 5DIEA 1UHLA 3UUAB 5KRFA 5DYBA 5DP0A 3EYBA 3PRGA 2QZOB 5AWKA 5KRJA 2Q5GA 4PXMA 3UU7B 3KDTA 1H9UA 4KZMA 4UDCA 1XNNA 2Q1VA 3V9TA 3AZ1A 5FQVA 1GS4A 2I0GA 2P7AA 2Q8SA 4WPFA 5KRMA 4ZOMA 5GIDA 2Q59A 5L7GA 3P89A 2JJ3A 3V49A 4P6XA 1SKXA 2AX6A 2HARA 2P4YA 2Z4JA 5APHA 5KRHA 4IU7A 2IHQA 1WM0X 2O4JA 1YYEA 1EXXA 4MG8B 3PEQA 5DUGA 3B3KA 4XLDA 2P1TA 3A2IA 1DKFA 2HC4A 4NUFA 1K74D 4RMDA 3UVVB 1RDTD 3VT8A 4ZNSA 2ZMHA 2Z4BA 4REFA 5K13A 1FCXA 3OMKA 3OS8C 4MG7B 1MVCA 4ZNHA 1UPWA 1SQNA 3PCUA 1T7MA 1G1UA 5KCEA 5AAVA 4RZGA 2ZNPA 4PWLA 5F9BA 2FVJA 4LNXA 4LSJA 1PQCA 4G21A 4YNKA 5EJVA 4MG9A 4FNEA 4E2JA 1ZAFA 5L7EA 1BSXA 3IPSA 5HJPB 4KZIA 3BEJA 3OZ0A 3VSOA 3GYUA 5DV8A 3W0GA 5DXQA 2QMVA 2HFPA 1N83A 3L0LA 1HJ1A 3IXPD 4IWFA 4PLEA 1OVLA 5G3JA 2I0JA 2V0VA 2ZVTA 3ERTA 3OLLA 2Q70A 5LWPA 3IXPA 5G44A 3OMQA 5DIDA 1Z95A 5DVSA 3P8XA 1S9PA 2NXXA 2PIWA 3AZ3A 2Q60A 4K7AA 3W5PA 4BCRA 3P0UA 2YFEA 2O9IA 3A9EB 2VV1B 5DVCA 4WHGA 2IOGA 2QA8B 3ZR7A 3D5FA 4JAZA 3B5RA 3R8AA 3CLDA 3GN8A 3KYTA 1R6GA 5DI7A 3KFCA 3R8DA 2PJLA 3A2HA 4N73A 2YJDA 4XAOA 5DV6A 3E00D 4G20A 2E2RA 3OMOA 5DX3A 1E3GA 1T79A 2OM9A 4HEEX 1ILGA 2AX9A 2HB8A 1XOWA 5FQTA 2AX7A 3AFRA 3FC6A 5L11A 3OS9A 3ZRAA 5JY3A 2QA6A 3CJWA 3UUDB 2Q1HA 3ERDA 3K6PA 1NDEA 4XUHA 1FM6D 3A3ZX 1X7JA 3OZJA 4RMEA 3VSPA 3TY0A 3UUAA 4XTAA 5G42A 3V4AA 3V3QA 3TKMA 2V7CA 2W8YA 4OHAA 2YHDA 2QZOA 1NUOA 4DOSA 3UU7A 5E0WA 3MNPA 3DZUA 1PK5A 4LTWA 2QNVA 4OC7A 5KRKA 2P7ZA 1K7LA 5I4VA 4MGCA 1EREA 2NW4A 2OUZA 2Q5PA 4IUIA 5B41A 1RK3A 3FURA 4OK1A 2ZMIA 3R5MA 3X31A 3FEJA 4MG5A 2HCDA 2ZMJA 2LBDA 5DYDA 4RWVA 3PO9A 5HYRA 3OKHA 1T5ZA 4N8RA 3KDUA 5AVLA 2PITA 2OVHA 2IOKA 3MNEA 2QGTA 4M8HA 5DZ3A 2AB2A 1FCZA 2ZFXA 3AN4A 3LMPA 3OMMA 1NHZA 4P6WA 3Q95B 5A86A 2ZLAA 4J5WC 1U3SA 5DKBA 4WLBA 2PKLA 5C4OA 3R2AA 2ZXZA 2ZASA 3H0AA 3WT5A 2VV2A 1X76A 2QTUA 1I37A 2PIOA 1S9QA 3G0WA 4IW6A 4NB6A 5DXKA 1R5KA 3UVVA 1NAVA 2Q5SA 4PP6A 5DTVA 5E7VA 3ADSA 3JZBA 1XAPA 4MG7A 4CSJA 1ZH7A 2GPOA 3FC6B 2QSEA 2Q7IA 4Q0AC 4OJ4A 5EGVA 1SR7A 2PINA 4ZJRA 1T7FA 2ZBSA 3DCUA 3O1EA 4OKXA 2ATHA 5E19A 5G5WA 1GWQA 1IE8A 1P93A 3GZ9A 1VJBA 2P15A 3CS8A 3FS1A 2GP7A 2ABIA 4XUMA 5KCCA 4X1FA 3F7DA 4IS8A 3KPZA 4UDDA 3GD2A 3B0RA 1NQ0A 4QE6A 1FBYA 2POGA 5HJPA 5KRIA 1XP1A 3DR1A 2Q61A 2AMBA 3L1BA 1LV2A 4JYIA 1R1KD 3G8OA 3AURA 2ZKCA 5DY8A 4R6SA 4OKTA 4OEAA 5LGAA 4OEZA 4G1ZA 4ZNVA 5DMCA 4MGDB 2ZNNA 4ZO1B 4YPQA 1NQ2A 1R1KA 3AUNA 4L96A 2XHSA 4ZJWA 3FUGA 4ZN7A 1ERRA 3HVLA 4MGBB 1XVPB 2F4BA 1PDUA 3A9EA 2VV1A 4REEA 1Y0XX 2QA8A 2XKWA 5DLRA 1XIUA 1T65A 5KRCA 3AUQA 4LNWA 5ICKA 3KBAA 1Z5XU 1ZDUA 3G9EA 1RKGA 4WHFA 2ZK0A 2Q7JA 4PLDA 1T7RA 2AA7A 5AYGA 5AZTA 3W0IA 3OSIA 2ZK2A 5JI0D 2XYWA 3W5TA 2Q6JA 4J5XC 3WFFA 2ACLB 3BQDA 3CDSA 1I38A 3ET2A 5IAWA 2VSTA 3V9VA 4RFWA 5G45A 3U9QA 2PRGA 4OIVA 4OGHA 5KCWA 4MG6A 3UUDA 4FGYA 1TXIA 4A4WA 2O4RA 2PIVA 1DB1A 4UDBA 5KYAA 4E4QA 1FM9A 4UDAA 4OH5A 3KMGA 1XLSE 4NIEA 3N00A 4ZNWA 5DXEA 2EWPA 1P8DA 1YOWA 2QABA 5DUHA 4EM9A 1L2JA 3ET0A 4Q50A 4RUJA 5GIEA 3DZYD 1YUCA 3D6DA 2OCFA 3NSPA 4TUZB 1N46A 4IV4A 5KCTA 2VV3A 3KMZA 4IV2A 3DZYA 4XHDA 2GPUA 1X78A 2AA5A 4S0SA 5GICA 1NRLA 5KRAA 2HVCA 2HASA 1X7BA 1XJ7A 1SJ0A 1HG4A 4HLWA 4K4JA 4DM6A 1YOKA 3FALB 4TV1B 1OSHA 1S0ZA 3UP3A 2AO6A 3VJIA 5JJMB 2GPPA 3Q95A 2QW4A 3OAPA 1XV9B 3VRVA 3DY6A 1YA3A 3H52A 2J4AA 2HBHA 2JFAB 2YJAB 3GWSX 3L0EA 4ITFA 5E14A 3X1IA 1PQ9A 3B68A 1MV9A 1OSVA 4DORA 4N5GA 4L98A 1PRGA 4OFRA 3UUCA 5G43A 4J26A 4B7WA 3WWRA 3UP0A 1M7WA 3B0WA 3VHWA 3OSWA 4E4KA 4KZJA 4PRGA 4FHHA 4N1YA 2G44A 3CS6A 3L3ZA 2ZNOA 2J14A 3W0HA 2G5OA 4M8EA 4G2HA 3ZQTA 1L2IA 1Y9RA 3TKCA 1RKHA 3DZUD 4IQRA 3L0JA 4JL4A 5DXMA 3W5QA 3VJTA 4PF3A 3VTBA 3ADTA 5DWLA 4G2IA 1YIMA 1YMTA 4IVWA 4DK7A 3R5NA 4YMQA 5KYJA 2AX8A 2Q7KA 5M96A 4YT1A 4QM0A 3DT3A 3NOAA 4XT9A 3ZRBA 1KV6A 4IWCA 3ILZA 3R29A 1Z5XE 4MGDA 4OKWA 3OLFA 4PPSA 5FQPA 4QK4A 1NQ1A 5DRMA 5C4TA 2I4PA 3VI8A 1LBDA 1U3RA 3V9YA 4FN9A 4MGBA 2AM9A 4ZI1A 1XVPA 1I7IA 5C4UA 1XZXX 3RY9A 1IE9A 1K4WA 3K8SA 3B0QA 2ZXNA 4CI5A 5AVIA 1XLSA 4DM8A 3VTCA 2A3IA 3H0AD 4ONIA 3AZ2A 3HQ5A 1FCYA 4G1YA 3OMPA 3B66A 2HWQA 3NSQA 3JZCA 3R8IA 5AZVA 4OJ9A 1XP9A 2ZK1A 2QXSA 5FQSA 3OOKA 4R06A 1N4HA 2ACLA 4O8FA 4OH6A 3VN2A 2G0GA 2PIPL 5KD9A 4OILA 1PZLA 3RUTA 2XYXA 5HCVA 3B0TA 2Q3YA 3D24A 3WTQA 5DWEA 2B23A 3GYTA 5E1CA 3SZ1A 2P7GA 1NYXA 4OZTU 1R20D 2HWRA 3SP9A 4MDDA 1PQ6A 1Y0SA 2AXAA 3HLVA 2BJ4A 3OKIA 5DWIA 4JYGA 5DU5A 5EITA 2B1ZA 1T76A 4NY9A 1R20A 4OKBA 2OZ7A 2PIQA 3IPUA 1UOMA 3GBKA 4TUZA 4APUA 4RUPA 1MZNA 3MNOA 2G0HA 2YLYA 4J24A 3KMRA 3OLSA 3PBAA 3VHUA 5E0XA 2OVMA 2OAXA 2BAWA 3O1DA 2B1VA 4IA1A 4RZEA 4CI4A 1X7EA 5G46A 3OOFA 3VJHA 4IA7A 2GWXA 3RUUA 3L03A 5DWJA 2P54A 2Q6SA 3FALA 4TV1A 2AMAA 2AAXA 5JJMA 3VT7A 3VRTA 3ET1A 3VRWA 2JF9A 1XV9A 3WJ4A 2GL8A 1XPCA 1EXAA 2VV4B 3TX7B 2JFAA 4ZNUA 5DSHA 4ZN9A 1S0XA 2PIRA 3LBDA 2GPVA 4OZRU 1ZEOA 1Q4XA 5HZCA 3B65A 1G50A 1XQ3A 4IA2A 5KCFA 1ILHA 2ZLCA 3A2JA 3IMYA 4J5WA 5FQRA 4JGVA 4IA3A 5DIGA 2B50A 3FXVA 2ZXMA 5DXPA 5KRLA 1FM9D 1T73A 4OEYA 3HZFA 1ZGYA 3QT0A 2HB7A 1T63A 4ZO1X 2I4JA 4OIUA 4PP5A 1YY4A 5APKA 2H79A 2Q6RA 2QH6A 4A2JA 1NAXA 3RLLA 2ZY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5C A;  2HAM A;  4PVU A;  2BJ4 B;  5H1E A;  4PP3 A;  2GIU A;  4OJB A;  4WVD A;  2POB A;  2PIX A;  3GWX A;  3X36 A;  1U3Q A;  2QXM A;  3HC6 A;  5DKE A;  3VRU A;  3BC5 A;  3V3E A;  2AWH A;  3A78 A;  3CWD A;  4QE8 A;  4RMC A;  5DXB B;  3CTB A;  1K74 A;  1XDK B;  3G8I A;  3VT6 A;  3HOD A;  2ZL9 A;  1YIN A;  5GT4 A;  1RDT A;  3VT3 A;  3WT7 A;  3E94 A;  4IW8 A;  5HJS A;  2ZNQ A;  1A52 A;  4RZF A;  1YP0 A;  5DMF A;  5EHJ A;  3OGT A;  5SYZ A;  4LBD A;  5DRJ A;  2R6W A;  5CJ6 A;  3AX8 A;  3WFG A;  5C4S A;  1UHL B;  4ITE A;  3VT5 A;  4Q13 A;  3ET3 A;  3AN3 A;  4OZT E;  1XB7 A;  5DKG A;  1A28 A;  5DV3 A;  2FSZ A;  3PLZ A;  2PNU A;  1XNX A;  4MGA A;  5IXK A;  1M13 A;  3K23 A;  2ZK6 A;  3E7C A;  3HC5 A;  4S14 A;  5L7H A;  5B5B A;  2R6Y A;  3RVF A;  1GWR A;  1PCG A;  3L3X A;  5DKS A;  5KCD A;  2YLO A;  4RUO X;  3P88 A;  3CS4 A;  5KCU A;  2Q59 B;  3WMH A;  2J7X A;  3K22 A;  1UPV A;  4J5X A;  3VHV A;  4G1D A;  2J7Y A;  4S15 A;  4R2U A;  2P1U A;  4JYH A;  3CQV A;  5DZH A;  4RAK A;  3M7R A;  1YJE A;  4EMA A;  3OS8 A;  1KNU A;  2QR9 A;  3ADW A;  4PPP A;  5APJ A;  3F5C B;  3W0Y A;  1T74 A;  1NQ7 A;  3D90 A;  4Y29 A;  5HYK A;  2NPA A;  5DVV A;  4POJ A;  3ADV A;  3B1M A;  3X1H A;  4NQA B;  4F9M A;  1DKF B;  1QKM A;  2VV0 A;  4OAR A;  4OED A;  3W5R A;  3SP6 A;  3ADU A;  2YLP A;  4S0T A;  2QGW A;  1XQC A;  4FHI A;  3E00 A;  2ZK5 A;  1ZUC A;  3A40 X;  1RJK A;  2PIU A;  4OZR E;  3WGP A;  2REW A;  5EI1 A;  5AAU A;  2NV7 A;  1S19 A;  4XI3 A;  1ZDT A;  1E3K A;  4OLM A;  5AAV B;  5ETH A;  5DXG A;  4OFU A;  2ZK3 A;  2H77 A;  5DXR A;  5DWG A;  2VV4 A;  3IPQ A;  5KR9 A;  1FM6 A;  5DZI A;  1ZKY A;  4MG9 B;  2AYR A;  5ACC A;  1U9E A;  3HO0 A;  3VT9 A;  2YAT A;  3IA6 A;  3CDP A;  3D57 A;  3HM1 A;  3RLJ A;  1XP6 A;  5DL4 A;  4MGA B;  1KKQ A;  5IZ0 A;  1OT7 A;  2QPY A;  3B67 A;  1T7T A;  4QL8 A;  1OVL B;  3WJ5 A;  4RE8 A;  2FAI A;  3W0J A;  2P1V A;  3KWY A;  3W0A A;  1FD0 A;  1QKT A;  2Q7L A;  2QE4 A;  2XYJ A;  3W0C A;  4IVY A;  4ZNT A;  4DQM A;  1M2Z A;  5DZ1 A;  4MG8 A;  2ZK4 A;  3FEI A;  3OSA A;  4POH A;  3DCT A;  5DZ0 A;  5KRO A;  2I4Z A;  2R40 D;  3S9S A;  5DK9 A;  5DXB A;  3VT4 A;  5DX3 B;  3VTD A;  3WT6 A;  1QKN A;  1XDK A;  1G5Y A;  2R40 A;  1I7G A;  5E15 A;  5EC9 A;  5AK2 A;  1TFC A;  3ADX A;  2AA6 A;  3T03 A;  4DMA A;  4QJR A;  5DUE A;  5AWJ A;  3FLI A;  1X7R A;  2YLQ A;  2AA2 A;  1G2N A;  4K6I A;  1QKU A;  4X1G A;  4A4V A;  2GTK A;  2VSR A;  3VJS A;  2NXX E;  4WQP A;  4DK8 A;  1GWX A;  5DIE A;  1UHL A;  3UUA B;  5KRF A;  5DYB A;  5DP0 A;  3EYB A;  3PRG A;  2QZO B;  5AWK A;  5KRJ A;  2Q5G A;  4PXM A;  3UU7 B;  3KDT A;  1H9U A;  4KZM A;  4UDC A;  1XNN A;  2Q1V A;  3V9T A;  3AZ1 A;  5FQV A;  1GS4 A;  2I0G A;  2P7A A;  2Q8S A;  4WPF A;  5KRM A;  4ZOM A;  5GID A;  2Q59 A;  5L7G A;  3P89 A;  2JJ3 A;  3V49 A;  4P6X A;  1SKX A;  2AX6 A;  2HAR A;  2P4Y A;  2Z4J A;  5APH A;  5KRH A;  4IU7 A;  2IHQ A;  1WM0 X;  2O4J A;  1YYE A;  1EXX A;  4MG8 B;  3PEQ A;  5DUG A;  3B3K A;  4XLD A;  2P1T A;  3A2I A;  1DKF A;  2HC4 A;  4NUF A;  1K74 D;  4RMD A;  3UVV B;  1RDT D;  3VT8 A;  4ZNS A;  2ZMH A;  2Z4B A;  4REF A;  5K13 A;  1FCX A;  3OMK A;  3OS8 C;  4MG7 B;  1MVC A;  4ZNH A;  1UPW A;  1SQN A;  3PCU A;  1T7M A;  1G1U A;  5KCE A;  5AAV A;  4RZG A;  2ZNP A;  4PWL A;  5F9B A;  2FVJ A;  4LNX A;  4LSJ A;  1PQC A;  4G21 A;  4YNK A;  5EJV A;  4MG9 A;  4FNE A;  4E2J A;  1ZAF A;  5L7E A;  1BSX A;  3IPS A;  5HJP B;  4KZI A;  3BEJ A;  3OZ0 A;  3VSO A;  3GYU A;  5DV8 A;  3W0G A;  5DXQ A;  2QMV A;  2HFP A;  1N83 A;  3L0L A;  1HJ1 A;  3IXP D;  4IWF A;  4PLE A;  1OVL A;  5G3J A;  2I0J A;  2V0V A;  2ZVT A;  3ERT A;  3OLL A;  2Q70 A;  5LWP A;  3IXP A;  5G44 A;  3OMQ A;  5DID A;  1Z95 A;  5DVS A;  3P8X A;  1S9P A;  2NXX A;  2PIW A;  3AZ3 A;  2Q60 A;  4K7A A;  3W5P A;  4BCR A;  3P0U A;  2YFE A;  2O9I A;  3A9E B;  2VV1 B;  5DVC A;  4WHG A;  2IOG A;  2QA8 B;  3ZR7 A;  3D5F A;  4JAZ A;  3B5R A;  3R8A A;  3CLD A;  3GN8 A;  3KYT A;  1R6G A;  5DI7 A;  3KFC A;  3R8D A;  2PJL A;  3A2H A;  4N73 A;  2YJD A;  4XAO A;  5DV6 A;  3E00 D;  4G20 A;  2E2R A;  3OMO A;  5DX3 A;  1E3G A;  1T79 A;  2OM9 A;  4HEE X;  1ILG A;  2AX9 A;  2HB8 A;  1XOW A;  5FQT A;  2AX7 A;  3AFR A;  3FC6 A;  5L11 A;  3OS9 A;  3ZRA A;  5JY3 A;  2QA6 A;  3CJW A;  3UUD B;  2Q1H A;  3ERD A;  3K6P A;  1NDE A;  4XUH A;  1FM6 D;  3A3Z X;  1X7J A;  3OZJ A;  4RME A;  3VSP A;  3TY0 A;  3UUA A;  4XTA A;  5G42 A;  3V4A A;  3V3Q A;  3TKM A;  2V7C A;  2W8Y A;  4OHA A;  2YHD A;  2QZO A;  1NUO A;  4DOS A;  3UU7 A;  5E0W A;  3MNP A;  3DZU A;  1PK5 A;  4LTW A;  2QNV A;  4OC7 A;  5KRK A;  2P7Z A;  1K7L A;  5I4V A;  4MGC A;  1ERE A;  2NW4 A;  2OUZ A;  2Q5P A;  4IUI A;  5B41 A;  1RK3 A;  3FUR A;  4OK1 A;  2ZMI A;  3R5M A;  3X31 A;  3FEJ A;  4MG5 A;  2HCD A;  2ZMJ A;  2LBD A;  5DYD A;  4RWV A;  3PO9 A;  5HYR A;  3OKH A;  1T5Z A;  4N8R A;  3KDU A;  5AVL A;  2PIT A;  2OVH A;  2IOK A;  3MNE A;  2QGT A;  4M8H A;  5DZ3 A;  2AB2 A;  1FCZ A;  2ZFX A;  3AN4 A;  3LMP A;  3OMM A;  1NHZ A;  4P6W A;  3Q95 B;  5A86 A;  2ZLA A;  4J5W C;  1U3S A;  5DKB A;  4WLB A;  2PKL A;  5C4O A;  3R2A A;  2ZXZ A;  2ZAS A;  3H0A A;  3WT5 A;  2VV2 A;  1X76 A;  2QTU A;  1I37 A;  2PIO A;  1S9Q A;  3G0W A;  4IW6 A;  4NB6 A;  5DXK A;  1R5K A;  3UVV A;  1NAV A;  2Q5S A;  4PP6 A;  5DTV A;  5E7V A;  3ADS A;  3JZB A;  1XAP A;  4MG7 A;  4CSJ A;  1ZH7 A;  2GPO A;  3FC6 B;  2QSE A;  2Q7I A;  4Q0A C;  4OJ4 A;  5EGV A;  1SR7 A;  2PIN A;  4ZJR A;  1T7F A;  2ZBS A;  3DCU A;  3O1E A;  4OKX A;  2ATH A;  5E19 A;  5G5W A;  1GWQ A;  1IE8 A;  1P93 A;  3GZ9 A;  1VJB A;  2P15 A;  3CS8 A;  3FS1 A;  2GP7 A;  2ABI A;  4XUM A;  5KCC A;  4X1F A;  3F7D A;  4IS8 A;  3KPZ A;  4UDD A;  3GD2 A;  3B0R A;  1NQ0 A;  4QE6 A;  1FBY A;  2POG A;  5HJP A;  5KRI A;  1XP1 A;  3DR1 A;  2Q61 A;  2AMB A;  3L1B A;  1LV2 A;  4JYI A;  1R1K D;  3G8O A;  3AUR A;  2ZKC A;  5DY8 A;  4R6S A;  4OKT A;  4OEA A;  5LGA A;  4OEZ A;  4G1Z A;  4ZNV A;  5DMC A;  4MGD B;  2ZNN A;  4ZO1 B;  4YPQ A;  1NQ2 A;  1R1K A;  3AUN A;  4L96 A;  2XHS A;  4ZJW A;  3FUG A;  4ZN7 A;  1ERR A;  3HVL A;  4MGB B;  1XVP B;  2F4B A;  1PDU A;  3A9E A;  2VV1 A;  4REE A;  1Y0X X;  2QA8 A;  2XKW A;  5DLR A;  1XIU A;  1T65 A;  5KRC A;  3AUQ A;  4LNW A;  5ICK A;  3KBA A;  1Z5X U;  1ZDU A;  3G9E A;  1RKG A;  4WHF A;  2ZK0 A;  2Q7J A;  4PLD A;  1T7R A;  2AA7 A;  5AYG A;  5AZT A;  3W0I A;  3OSI A;  2ZK2 A;  5JI0 D;  2XYW A;  3W5T A;  2Q6J A;  4J5X C;  3WFF A;  2ACL B;  3BQD A;  3CDS A;  1I38 A;  3ET2 A;  5IAW A;  2VST A;  3V9V A;  4RFW A;  5G45 A;  3U9Q A;  2PRG A;  4OIV A;  4OGH A;  5KCW A;  4MG6 A;  3UUD A;  4FGY A;  1TXI A;  4A4W A;  2O4R A;  2PIV A;  1DB1 A;  4UDB A;  5KYA A;  4E4Q A;  1FM9 A;  4UDA A;  4OH5 A;  3KMG A;  1XLS E;  4NIE A;  3N00 A;  4ZNW A;  5DXE A;  2EWP A;  1P8D A;  1YOW A;  2QAB A;  5DUH A;  4EM9 A;  1L2J A;  3ET0 A;  4Q50 A;  4RUJ A;  5GIE A;  3DZY D;  1YUC A;  3D6D A;  2OCF A;  3NSP A;  4TUZ B;  1N46 A;  4IV4 A;  5KCT A;  2VV3 A;  3KMZ A;  4IV2 A;  3DZY A;  4XHD A;  2GPU A;  1X78 A;  2AA5 A;  4S0S A;  5GIC A;  1NRL A;  5KRA A;  2HVC A;  2HAS A;  1X7B A;  1XJ7 A;  1SJ0 A;  1HG4 A;  4HLW A;  4K4J A;  4DM6 A;  1YOK A;  3FAL B;  4TV1 B;  1OSH A;  1S0Z A;  3UP3 A;  2AO6 A;  3VJI A;  5JJM B;  2GPP A;  3Q95 A;  2QW4 A;  3OAP A;  1XV9 B;  3VRV A;  3DY6 A;  1YA3 A;  3H52 A;  2J4A A;  2HBH A;  2JFA B;  2YJA B;  3GWS X;  3L0E A;  4ITF A;  5E14 A;  3X1I A;  1PQ9 A;  3B68 A;  1MV9 A;  1OSV A;  4DOR A;  4N5G A;  4L98 A;  1PRG A;  4OFR A;  3UUC A;  5G43 A;  4J26 A;  4B7W A;  3WWR A;  3UP0 A;  1M7W A;  3B0W A;  3VHW A;  3OSW A;  4E4K A;  4KZJ A;  4PRG A;  4FHH A;  4N1Y A;  2G44 A;  3CS6 A;  3L3Z A;  2ZNO A;  2J14 A;  3W0H A;  2G5O A;  4M8E A;  4G2H A;  3ZQT A;  1L2I A;  1Y9R A;  3TKC A;  1RKH A;  3DZU D;  4IQR A;  3L0J A;  4JL4 A;  5DXM A;  3W5Q A;  3VJT A;  4PF3 A;  3VTB A;  3ADT A;  5DWL A;  4G2I A;  1YIM A;  1YMT A;  4IVW A;  4DK7 A;  3R5N A;  4YMQ A;  5KYJ A;  2AX8 A;  2Q7K A;  5M96 A;  4YT1 A;  4QM0 A;  3DT3 A;  3NOA A;  4XT9 A;  3ZRB A;  1KV6 A;  4IWC A;  3ILZ A;  3R29 A;  1Z5X E;  4MGD A;  4OKW A;  3OLF A;  4PPS A;  5FQP A;  4QK4 A;  1NQ1 A;  5DRM A;  5C4T A;  2I4P A;  3VI8 A;  1LBD A;  1U3R A;  3V9Y A;  4FN9 A;  4MGB A;  2AM9 A;  4ZI1 A;  1XVP A;  1I7I A;  5C4U A;  1XZX X;  3RY9 A;  1IE9 A;  1K4W A;  3K8S A;  3B0Q A;  2ZXN A;  4CI5 A;  5AVI A;  1XLS A;  4DM8 A;  3VTC A;  2A3I A;  3H0A D;  4ONI A;  3AZ2 A;  3HQ5 A;  1FCY A;  4G1Y A;  3OMP A;  3B66 A;  2HWQ A;  3NSQ A;  3JZC A;  3R8I A;  5AZV A;  4OJ9 A;  1XP9 A;  2ZK1 A;  2QXS A;  5FQS A;  3OOK A;  4R06 A;  1N4H A;  2ACL A;  4O8F A;  4OH6 A;  3VN2 A;  2G0G A;  2PIP L;  5KD9 A;  4OIL A;  1PZL A;  3RUT A;  2XYX A;  5HCV A;  3B0T A;  2Q3Y A;  3D24 A;  3WTQ A;  5DWE A;  2B23 A;  3GYT A;  5E1C A;  3SZ1 A;  2P7G A;  1NYX A;  4OZT U;  1R20 D;  2HWR A;  3SP9 A;  4MDD A;  1PQ6 A;  1Y0S A;  2AXA A;  3HLV A;  2BJ4 A;  3OKI A;  5DWI A;  4JYG A;  5DU5 A;  5EIT A;  2B1Z A;  1T76 A;  4NY9 A;  1R20 A;  4OKB A;  2OZ7 A;  2PIQ A;  3IPU A;  1UOM A;  3GBK A;  4TUZ A;  4APU A;  4RUP A;  1MZN A;  3MNO A;  2G0H A;  2YLY A;  4J24 A;  3KMR A;  3OLS A;  3PBA A;  3VHU A;  5E0X A;  2OVM A;  2OAX A;  2BAW A;  3O1D A;  2B1V A;  4IA1 A;  4RZE A;  4CI4 A;  1X7E A;  5G46 A;  3OOF A;  3VJH A;  4IA7 A;  2GWX A;  3RUU A;  3L03 A;  5DWJ A;  2P54 A;  2Q6S A;  3FAL A;  4TV1 A;  2AMA A;  2AAX A;  5JJM A;  3VT7 A;  3VRT A;  3ET1 A;  3VRW A;  2JF9 A;  1XV9 A;  3WJ4 A;  2GL8 A;  1XPC A;  1EXA A;  2VV4 B;  3TX7 B;  2JFA A;  4ZNU A;  5DSH A;  4ZN9 A;  1S0X A;  2PIR A;  3LBD A;  2GPV A;  4OZR U;  1ZEO A;  1Q4X A;  5HZC A;  3B65 A;  1G50 A;  1XQ3 A;  4IA2 A;  5KCF A;  1ILH A;  2ZLC A;  3A2J A;  3IMY A;  4J5W A;  5FQR A;  4JGV A;  4IA3 A;  5DIG A;  2B50 A;  3FXV A;  2ZXM A;  5DXP A;  5KRL A;  1FM9 D;  1T73 A;  4OEY A;  3HZF A;  1ZGY A;  3QT0 A;  2HB7 A;  1T63 A;  4ZO1 X;  2I4J A;  4OIU A;  4PP5 A;  1YY4 A;  5APK A;  2H79 A;  2Q6R A;  2QH6 A;  4A2J A;  1NAX A;  3RLL A;  2ZY0 A; 
#chains in the Genus database with same CATH topology
 3F5C A;  2HAM A;  4PVU A;  2BJ4 B;  5H1E A;  4PP3 A;  2GIU A;  4OJB A;  4WVD A;  2POB A;  2PIX A;  3GWX A;  3X36 A;  1U3Q A;  2QXM A;  3HC6 A;  5DKE A;  3VRU A;  3BC5 A;  3V3E A;  2AWH A;  3A78 A;  3CWD A;  4QE8 A;  4RMC A;  5DXB B;  3CTB A;  1K74 A;  1XDK B;  3G8I A;  3VT6 A;  3HOD A;  2ZL9 A;  1YIN A;  5GT4 A;  1RDT A;  3VT3 A;  3WT7 A;  3E94 A;  4IW8 A;  5HJS A;  2ZNQ A;  1A52 A;  4RZF A;  1YP0 A;  5DMF A;  5EHJ A;  3OGT A;  5SYZ A;  4LBD A;  5DRJ A;  2R6W A;  5CJ6 A;  3AX8 A;  3WFG A;  5C4S A;  1UHL B;  4ITE A;  3VT5 A;  4Q13 A;  3ET3 A;  3AN3 A;  4OZT E;  1XB7 A;  5DKG A;  1A28 A;  5DV3 A;  2FSZ A;  3PLZ A;  2PNU A;  1XNX A;  4MGA A;  5IXK A;  1M13 A;  3K23 A;  2ZK6 A;  3E7C A;  3HC5 A;  4S14 A;  5L7H A;  5B5B A;  2R6Y A;  3RVF A;  1GWR A;  1PCG A;  3L3X A;  5DKS A;  5KCD A;  2YLO A;  4RUO X;  3P88 A;  3CS4 A;  5KCU A;  2Q59 B;  3WMH A;  2J7X A;  3K22 A;  1UPV A;  4J5X A;  3VHV A;  4G1D A;  2J7Y A;  4S15 A;  4R2U A;  2P1U A;  4JYH A;  3CQV A;  5DZH A;  4RAK A;  3M7R A;  1YJE A;  4EMA A;  3OS8 A;  1KNU A;  2QR9 A;  3ADW A;  4PPP A;  5APJ A;  3F5C B;  3W0Y A;  1T74 A;  1NQ7 A;  3D90 A;  4Y29 A;  5HYK A;  2NPA A;  5DVV A;  4POJ A;  3ADV A;  3B1M A;  3X1H A;  4NQA B;  4F9M A;  1DKF B;  1QKM A;  2VV0 A;  4OAR A;  4OED A;  3W5R A;  3SP6 A;  3ADU A;  2YLP A;  4S0T A;  2QGW A;  1XQC A;  4FHI A;  3E00 A;  2ZK5 A;  1ZUC A;  3A40 X;  1RJK A;  2PIU A;  4OZR E;  3WGP A;  2REW A;  5EI1 A;  5AAU A;  2NV7 A;  1S19 A;  4XI3 A;  1ZDT A;  1E3K A;  4OLM A;  5AAV B;  5ETH A;  5DXG A;  4OFU A;  2ZK3 A;  2H77 A;  5DXR A;  5DWG A;  2VV4 A;  3IPQ A;  5KR9 A;  1FM6 A;  5DZI A;  1ZKY A;  4MG9 B;  2AYR A;  5ACC A;  1U9E A;  3HO0 A;  3VT9 A;  2YAT A;  3IA6 A;  3CDP A;  3D57 A;  3HM1 A;  3RLJ A;  1XP6 A;  5DL4 A;  4MGA B;  1KKQ A;  5IZ0 A;  1OT7 A;  2QPY A;  3B67 A;  1T7T A;  4QL8 A;  1OVL B;  3WJ5 A;  4RE8 A;  2FAI A;  3W0J A;  2P1V A;  3KWY A;  3W0A A;  1FD0 A;  1QKT A;  2Q7L A;  2QE4 A;  2XYJ A;  3W0C A;  4IVY A;  4ZNT A;  4DQM A;  1M2Z A;  5DZ1 A;  4MG8 A;  2ZK4 A;  3FEI A;  3OSA A;  4POH A;  3DCT A;  5DZ0 A;  5KRO A;  2I4Z A;  2R40 D;  3S9S A;  5DK9 A;  5DXB A;  3VT4 A;  5DX3 B;  3VTD A;  3WT6 A;  1QKN A;  1XDK A;  1G5Y A;  2R40 A;  1I7G A;  5E15 A;  5EC9 A;  5AK2 A;  1TFC A;  3ADX A;  2AA6 A;  3T03 A;  4DMA A;  4QJR A;  5DUE A;  5AWJ A;  3FLI A;  1X7R A;  2YLQ A;  2AA2 A;  1G2N A;  4K6I A;  1QKU A;  4X1G A;  4A4V A;  2GTK A;  2VSR A;  3VJS A;  2NXX E;  4WQP A;  4DK8 A;  1GWX A;  5DIE A;  1UHL A;  3UUA B;  5KRF A;  5DYB A;  5DP0 A;  3EYB A;  3PRG A;  2QZO B;  5AWK A;  5KRJ A;  2Q5G A;  4PXM A;  3UU7 B;  3KDT A;  1H9U A;  4KZM A;  4UDC A;  1XNN A;  2Q1V A;  3V9T A;  3AZ1 A;  5FQV A;  1GS4 A;  2I0G A;  2P7A A;  2Q8S A;  4WPF A;  5KRM A;  4ZOM A;  5GID A;  2Q59 A;  5L7G A;  3P89 A;  2JJ3 A;  3V49 A;  4P6X A;  1SKX A;  2AX6 A;  2HAR A;  2P4Y A;  2Z4J A;  5APH A;  5KRH A;  4IU7 A;  2IHQ A;  1WM0 X;  2O4J A;  1YYE A;  1EXX A;  4MG8 B;  3PEQ A;  5DUG A;  3B3K A;  4XLD A;  2P1T A;  3A2I A;  1DKF A;  2HC4 A;  4NUF A;  1K74 D;  4RMD A;  3UVV B;  1RDT D;  3VT8 A;  4ZNS A;  2ZMH A;  2Z4B A;  4REF A;  5K13 A;  1FCX A;  3OMK A;  3OS8 C;  4MG7 B;  1MVC A;  4ZNH A;  1UPW A;  1SQN A;  3PCU A;  1T7M A;  1G1U A;  5KCE A;  5AAV A;  4RZG A;  2ZNP A;  4PWL A;  5F9B A;  2FVJ A;  4LNX A;  4LSJ A;  1PQC A;  4G21 A;  4YNK A;  5EJV A;  4MG9 A;  4FNE A;  4E2J A;  1ZAF A;  5L7E A;  1BSX A;  3IPS A;  5HJP B;  4KZI A;  3BEJ A;  3OZ0 A;  3VSO A;  3GYU A;  5DV8 A;  3W0G A;  5DXQ A;  2QMV A;  2HFP A;  1N83 A;  3L0L A;  1HJ1 A;  3IXP D;  4IWF A;  4PLE A;  1OVL A;  5G3J A;  2I0J A;  2V0V A;  2ZVT A;  3ERT A;  3OLL A;  2Q70 A;  5LWP A;  3IXP A;  5G44 A;  3OMQ A;  5DID A;  1Z95 A;  5DVS A;  3P8X A;  1S9P A;  2NXX A;  2PIW A;  3AZ3 A;  2Q60 A;  4K7A A;  3W5P A;  4BCR A;  3P0U A;  2YFE A;  2O9I A;  3A9E B;  2VV1 B;  5DVC A;  4WHG A;  2IOG A;  2QA8 B;  3ZR7 A;  3D5F A;  4JAZ A;  3B5R A;  3R8A A;  3CLD A;  3GN8 A;  3KYT A;  1R6G A;  5DI7 A;  3KFC A;  3R8D A;  2PJL A;  3A2H A;  4N73 A;  2YJD A;  4XAO A;  5DV6 A;  3E00 D;  4G20 A;  2E2R A;  3OMO A;  5DX3 A;  1E3G A;  1T79 A;  2OM9 A;  4HEE X;  1ILG A;  2AX9 A;  2HB8 A;  1XOW A;  5FQT A;  2AX7 A;  3AFR A;  3FC6 A;  5L11 A;  3OS9 A;  3ZRA A;  5JY3 A;  2QA6 A;  3CJW A;  3UUD B;  2Q1H A;  3ERD A;  3K6P A;  1NDE A;  4XUH A;  1FM6 D;  3A3Z X;  1X7J A;  3OZJ A;  4RME A;  3VSP A;  3TY0 A;  3UUA A;  4XTA A;  5G42 A;  3V4A A;  3V3Q A;  3TKM A;  2V7C A;  2W8Y A;  4OHA A;  2YHD A;  2QZO A;  1NUO A;  4DOS A;  3UU7 A;  5E0W A;  3MNP A;  3DZU A;  1PK5 A;  4LTW A;  2QNV A;  4OC7 A;  5KRK A;  2P7Z A;  1K7L A;  5I4V A;  4MGC A;  1ERE A;  2NW4 A;  2OUZ A;  2Q5P A;  4IUI A;  5B41 A;  1RK3 A;  3FUR A;  4OK1 A;  2ZMI A;  3R5M A;  3X31 A;  3FEJ A;  4MG5 A;  2HCD A;  2ZMJ A;  2LBD A;  5DYD A;  4RWV A;  3PO9 A;  5HYR A;  3OKH A;  1T5Z A;  4N8R A;  3KDU A;  5AVL A;  2PIT A;  2OVH A;  2IOK A;  3MNE A;  2QGT A;  4M8H A;  5DZ3 A;  2AB2 A;  1FCZ A;  2ZFX A;  3AN4 A;  3LMP A;  3OMM A;  1NHZ A;  4P6W A;  3Q95 B;  5A86 A;  2ZLA A;  4J5W C;  1U3S A;  5DKB A;  4WLB A;  2PKL A;  5C4O A;  3R2A A;  2ZXZ A;  2ZAS A;  3H0A A;  3WT5 A;  2VV2 A;  1X76 A;  2QTU A;  1I37 A;  2PIO A;  1S9Q A;  3G0W A;  4IW6 A;  4NB6 A;  5DXK A;  1R5K A;  3UVV A;  1NAV A;  2Q5S A;  4PP6 A;  5DTV A;  5E7V A;  3ADS A;  3JZB A;  1XAP A;  4MG7 A;  4CSJ A;  1ZH7 A;  2GPO A;  3FC6 B;  2QSE A;  2Q7I A;  4Q0A C;  4OJ4 A;  5EGV A;  1SR7 A;  2PIN A;  4ZJR A;  1T7F A;  2ZBS A;  3DCU A;  3O1E A;  4OKX A;  2ATH A;  5E19 A;  5G5W A;  1GWQ A;  1IE8 A;  1P93 A;  3GZ9 A;  1VJB A;  2P15 A;  3CS8 A;  3FS1 A;  2GP7 A;  2ABI A;  4XUM A;  5KCC A;  4X1F A;  3F7D A;  4IS8 A;  3KPZ A;  4UDD A;  3GD2 A;  3B0R A;  1NQ0 A;  4QE6 A;  1FBY A;  2POG A;  5HJP A;  5KRI A;  1XP1 A;  3DR1 A;  2Q61 A;  2AMB A;  3L1B A;  1LV2 A;  4JYI A;  1R1K D;  3G8O A;  3AUR A;  2ZKC A;  5DY8 A;  4R6S A;  4OKT A;  4OEA A;  5LGA A;  4OEZ A;  4G1Z A;  4ZNV A;  5DMC A;  4MGD B;  2ZNN A;  4ZO1 B;  4YPQ A;  1NQ2 A;  1R1K A;  3AUN A;  4L96 A;  2XHS A;  4ZJW A;  3FUG A;  4ZN7 A;  1ERR A;  3HVL A;  4MGB B;  1XVP B;  2F4B A;  1PDU A;  3A9E A;  2VV1 A;  4REE A;  1Y0X X;  2QA8 A;  2XKW A;  5DLR A;  1XIU A;  1T65 A;  5KRC A;  3AUQ A;  4LNW A;  5ICK A;  3KBA A;  1Z5X U;  1ZDU A;  3G9E A;  1RKG A;  4WHF A;  2ZK0 A;  2Q7J A;  4PLD A;  1T7R A;  2AA7 A;  5AYG A;  5AZT A;  3W0I A;  3OSI A;  2ZK2 A;  5JI0 D;  2XYW A;  3W5T A;  2Q6J A;  4J5X C;  3WFF A;  2ACL B;  3BQD A;  3CDS A;  1I38 A;  3ET2 A;  5IAW A;  2VST A;  3V9V A;  4RFW A;  5G45 A;  3U9Q A;  2PRG A;  4OIV A;  4OGH A;  5KCW A;  4MG6 A;  3UUD A;  4FGY A;  1TXI A;  4A4W A;  2O4R A;  2PIV A;  1DB1 A;  4UDB A;  5KYA A;  4E4Q A;  1FM9 A;  4UDA A;  4OH5 A;  3KMG A;  1XLS E;  4NIE A;  3N00 A;  4ZNW A;  5DXE A;  2EWP A;  1P8D A;  1YOW A;  2QAB A;  5DUH A;  4EM9 A;  1L2J A;  3ET0 A;  4Q50 A;  4RUJ A;  5GIE A;  3DZY D;  1YUC A;  3D6D A;  2OCF A;  3NSP A;  4TUZ B;  1N46 A;  4IV4 A;  5KCT A;  2VV3 A;  3KMZ A;  4IV2 A;  3DZY A;  4XHD A;  2GPU A;  1X78 A;  2AA5 A;  4S0S A;  5GIC A;  1NRL A;  5KRA A;  2HVC A;  2HAS A;  1X7B A;  1XJ7 A;  1SJ0 A;  1HG4 A;  4HLW A;  4K4J A;  4DM6 A;  1YOK A;  3FAL B;  4TV1 B;  1OSH A;  1S0Z A;  3UP3 A;  2AO6 A;  3VJI A;  5JJM B;  2GPP A;  3Q95 A;  2QW4 A;  3OAP A;  1XV9 B;  3VRV A;  3DY6 A;  1YA3 A;  3H52 A;  2J4A A;  2HBH A;  2JFA B;  2YJA B;  3GWS X;  3L0E A;  4ITF A;  5E14 A;  3X1I A;  1PQ9 A;  3B68 A;  1MV9 A;  1OSV A;  4DOR A;  4N5G A;  4L98 A;  1PRG A;  4OFR A;  3UUC A;  5G43 A;  4J26 A;  4B7W A;  3WWR A;  3UP0 A;  1M7W A;  3B0W A;  3VHW A;  3OSW A;  4E4K A;  4KZJ A;  4PRG A;  4FHH A;  4N1Y A;  2G44 A;  3CS6 A;  3L3Z A;  2ZNO A;  2J14 A;  3W0H A;  2G5O A;  4M8E A;  4G2H A;  3ZQT A;  1L2I A;  1Y9R A;  3TKC A;  1RKH A;  3DZU D;  4IQR A;  3L0J A;  4JL4 A;  5DXM A;  3W5Q A;  3VJT A;  4PF3 A;  3VTB A;  3ADT A;  5DWL A;  4G2I A;  1YIM A;  1YMT A;  4IVW A;  4DK7 A;  3R5N A;  4YMQ A;  5KYJ A;  2AX8 A;  2Q7K A;  5M96 A;  4YT1 A;  4QM0 A;  3DT3 A;  3NOA A;  4XT9 A;  3ZRB A;  1KV6 A;  4IWC A;  3ILZ A;  3R29 A;  1Z5X E;  4MGD A;  4OKW A;  3OLF A;  4PPS A;  5FQP A;  4QK4 A;  1NQ1 A;  5DRM A;  5C4T A;  2I4P A;  3VI8 A;  1LBD A;  1U3R A;  3V9Y A;  4FN9 A;  4MGB A;  2AM9 A;  4ZI1 A;  1XVP A;  1I7I A;  5C4U A;  1XZX X;  3RY9 A;  1IE9 A;  1K4W A;  3K8S A;  3B0Q A;  2ZXN A;  4CI5 A;  5AVI A;  1XLS A;  4DM8 A;  3VTC A;  2A3I A;  3H0A D;  4ONI A;  3AZ2 A;  3HQ5 A;  1FCY A;  4G1Y A;  3OMP A;  3B66 A;  2HWQ A;  3NSQ A;  3JZC A;  3R8I A;  5AZV A;  4OJ9 A;  1XP9 A;  2ZK1 A;  2QXS A;  5FQS A;  3OOK A;  4R06 A;  1N4H A;  2ACL A;  4O8F A;  4OH6 A;  3VN2 A;  2G0G A;  2PIP L;  5KD9 A;  4OIL A;  1PZL A;  3RUT A;  2XYX A;  5HCV A;  3B0T A;  2Q3Y A;  3D24 A;  3WTQ A;  5DWE A;  2B23 A;  3GYT A;  5E1C A;  3SZ1 A;  2P7G A;  1NYX A;  4OZT U;  1R20 D;  2HWR A;  3SP9 A;  4MDD A;  1PQ6 A;  1Y0S A;  2AXA A;  3HLV A;  2BJ4 A;  3OKI A;  5DWI A;  4JYG A;  5DU5 A;  5EIT A;  2B1Z A;  1T76 A;  4NY9 A;  1R20 A;  4OKB A;  2OZ7 A;  2PIQ A;  3IPU A;  1UOM A;  3GBK A;  4TUZ A;  4APU A;  4RUP A;  1MZN A;  3MNO A;  2G0H A;  2YLY A;  4J24 A;  3KMR A;  3OLS A;  3PBA A;  3VHU A;  5E0X A;  2OVM A;  2OAX A;  2BAW A;  3O1D A;  2B1V A;  4IA1 A;  4RZE A;  4CI4 A;  1X7E A;  5G46 A;  3OOF A;  3VJH A;  4IA7 A;  2GWX A;  3RUU A;  3L03 A;  5DWJ A;  2P54 A;  2Q6S A;  3FAL A;  4TV1 A;  2AMA A;  2AAX A;  5JJM A;  3VT7 A;  3VRT A;  3ET1 A;  3VRW A;  2JF9 A;  1XV9 A;  3WJ4 A;  2GL8 A;  1XPC A;  1EXA A;  2VV4 B;  3TX7 B;  2JFA A;  4ZNU A;  5DSH A;  4ZN9 A;  1S0X A;  2PIR A;  3LBD A;  2GPV A;  4OZR U;  1ZEO A;  1Q4X A;  5HZC A;  3B65 A;  1G50 A;  1XQ3 A;  4IA2 A;  5KCF A;  1ILH A;  2ZLC A;  3A2J A;  3IMY A;  4J5W A;  5FQR A;  4JGV A;  4IA3 A;  5DIG A;  2B50 A;  3FXV A;  2ZXM A;  5DXP A;  5KRL A;  1FM9 D;  1T73 A;  4OEY A;  3HZF A;  1ZGY A;  3QT0 A;  2HB7 A;  1T63 A;  4ZO1 X;  2I4J A;  4OIU A;  4PP5 A;  1YY4 A;  5APK A;  2H79 A;  2Q6R A;  2QH6 A;  4A2J A;  1NAX A;  3RLL A;  2ZY0 A; 
#chains in the Genus database with same CATH homology
 3F5C A;  2HAM A;  4PVU A;  2BJ4 B;  5H1E A;  4PP3 A;  2GIU A;  4OJB A;  4WVD A;  2POB A;  2PIX A;  3GWX A;  3X36 A;  1U3Q A;  2QXM A;  3HC6 A;  5DKE A;  3VRU A;  3BC5 A;  3V3E A;  2AWH A;  3A78 A;  3CWD A;  4QE8 A;  4RMC A;  5DXB B;  3CTB A;  1K74 A;  1XDK B;  3G8I A;  3VT6 A;  3HOD A;  2ZL9 A;  1YIN A;  5GT4 A;  1RDT A;  3VT3 A;  3WT7 A;  3E94 A;  4IW8 A;  5HJS A;  2ZNQ A;  1A52 A;  4RZF A;  1YP0 A;  5DMF A;  5EHJ A;  3OGT A;  5SYZ A;  4LBD A;  5DRJ A;  2R6W A;  5CJ6 A;  3AX8 A;  3WFG A;  5C4S A;  1UHL B;  4ITE A;  3VT5 A;  4Q13 A;  3ET3 A;  3AN3 A;  4OZT E;  1XB7 A;  5DKG A;  1A28 A;  5DV3 A;  2FSZ A;  3PLZ A;  2PNU A;  1XNX A;  4MGA A;  5IXK A;  1M13 A;  3K23 A;  2ZK6 A;  3E7C A;  3HC5 A;  4S14 A;  5L7H A;  5B5B A;  2R6Y A;  3RVF A;  1GWR A;  1PCG A;  3L3X A;  5DKS A;  5KCD A;  2YLO A;  4RUO X;  3P88 A;  3CS4 A;  5KCU A;  2Q59 B;  3WMH A;  2J7X A;  3K22 A;  1UPV A;  4J5X A;  3VHV A;  4G1D A;  2J7Y A;  4S15 A;  4R2U A;  2P1U A;  4JYH A;  3CQV A;  5DZH A;  4RAK A;  3M7R A;  1YJE A;  4EMA A;  3OS8 A;  1KNU A;  2QR9 A;  3ADW A;  4PPP A;  5APJ A;  3F5C B;  3W0Y A;  1T74 A;  1NQ7 A;  3D90 A;  4Y29 A;  5HYK A;  2NPA A;  5DVV A;  4POJ A;  3ADV A;  3B1M A;  3X1H A;  4NQA B;  4F9M A;  1DKF B;  1QKM A;  2VV0 A;  4OAR A;  4OED A;  3W5R A;  3SP6 A;  3ADU A;  2YLP A;  4S0T A;  2QGW A;  1XQC A;  4FHI A;  3E00 A;  2ZK5 A;  1ZUC A;  3A40 X;  1RJK A;  2PIU A;  4OZR E;  3WGP A;  2REW A;  5EI1 A;  5AAU A;  2NV7 A;  1S19 A;  4XI3 A;  1ZDT A;  1E3K A;  4OLM A;  5AAV B;  5ETH A;  5DXG A;  4OFU A;  2ZK3 A;  2H77 A;  5DXR A;  5DWG A;  2VV4 A;  3IPQ A;  5KR9 A;  1FM6 A;  5DZI A;  1ZKY A;  4MG9 B;  2AYR A;  5ACC A;  1U9E A;  3HO0 A;  3VT9 A;  2YAT A;  3IA6 A;  3CDP A;  3D57 A;  3HM1 A;  3RLJ A;  1XP6 A;  5DL4 A;  4MGA B;  1KKQ A;  5IZ0 A;  1OT7 A;  2QPY A;  3B67 A;  1T7T A;  4QL8 A;  1OVL B;  3WJ5 A;  4RE8 A;  2FAI A;  3W0J A;  2P1V A;  3KWY A;  3W0A A;  1FD0 A;  1QKT A;  2Q7L A;  2QE4 A;  2XYJ A;  3W0C A;  4IVY A;  4ZNT A;  4DQM A;  1M2Z A;  5DZ1 A;  4MG8 A;  2ZK4 A;  3FEI A;  3OSA A;  4POH A;  3DCT A;  5DZ0 A;  5KRO A;  2I4Z A;  2R40 D;  3S9S A;  5DK9 A;  5DXB A;  3VT4 A;  5DX3 B;  3VTD A;  3WT6 A;  1QKN A;  1XDK A;  1G5Y A;  2R40 A;  1I7G A;  5E15 A;  5EC9 A;  5AK2 A;  1TFC A;  3ADX A;  2AA6 A;  3T03 A;  4DMA A;  4QJR A;  5DUE A;  5AWJ A;  3FLI A;  1X7R A;  2YLQ A;  2AA2 A;  1G2N A;  4K6I A;  1QKU A;  4X1G A;  4A4V A;  2GTK A;  2VSR A;  3VJS A;  2NXX E;  4WQP A;  4DK8 A;  1GWX A;  5DIE A;  1UHL A;  3UUA B;  5KRF A;  5DYB A;  5DP0 A;  3EYB A;  3PRG A;  2QZO B;  5AWK A;  5KRJ A;  2Q5G A;  4PXM A;  3UU7 B;  3KDT A;  1H9U A;  4KZM A;  4UDC A;  1XNN A;  2Q1V A;  3V9T A;  3AZ1 A;  5FQV A;  1GS4 A;  2I0G A;  2P7A A;  2Q8S A;  4WPF A;  5KRM A;  4ZOM A;  5GID A;  2Q59 A;  5L7G A;  3P89 A;  2JJ3 A;  3V49 A;  4P6X A;  1SKX A;  2AX6 A;  2HAR A;  2P4Y A;  2Z4J A;  5APH A;  5KRH A;  4IU7 A;  2IHQ A;  1WM0 X;  2O4J A;  1YYE A;  1EXX A;  4MG8 B;  3PEQ A;  5DUG A;  3B3K A;  4XLD A;  2P1T A;  3A2I A;  1DKF A;  2HC4 A;  4NUF A;  1K74 D;  4RMD A;  3UVV B;  1RDT D;  3VT8 A;  4ZNS A;  2ZMH A;  2Z4B A;  4REF A;  5K13 A;  1FCX A;  3OMK A;  3OS8 C;  4MG7 B;  1MVC A;  4ZNH A;  1UPW A;  1SQN A;  3PCU A;  1T7M A;  1G1U A;  5KCE A;  5AAV A;  4RZG A;  2ZNP A;  4PWL A;  5F9B A;  2FVJ A;  4LNX A;  4LSJ A;  1PQC A;  4G21 A;  4YNK A;  5EJV A;  4MG9 A;  4FNE A;  4E2J A;  1ZAF A;  5L7E A;  1BSX A;  3IPS A;  5HJP B;  4KZI A;  3BEJ A;  3OZ0 A;  3VSO A;  3GYU A;  5DV8 A;  3W0G A;  5DXQ A;  2QMV A;  2HFP A;  1N83 A;  3L0L A;  1HJ1 A;  3IXP D;  4IWF A;  4PLE A;  1OVL A;  5G3J A;  2I0J A;  2V0V A;  2ZVT A;  3ERT A;  3OLL A;  2Q70 A;  5LWP A;  3IXP A;  5G44 A;  3OMQ A;  5DID A;  1Z95 A;  5DVS A;  3P8X A;  1S9P A;  2NXX A;  2PIW A;  3AZ3 A;  2Q60 A;  4K7A A;  3W5P A;  4BCR A;  3P0U A;  2YFE A;  2O9I A;  3A9E B;  2VV1 B;  5DVC A;  4WHG A;  2IOG A;  2QA8 B;  3ZR7 A;  3D5F A;  4JAZ A;  3B5R A;  3R8A A;  3CLD A;  3GN8 A;  3KYT A;  1R6G A;  5DI7 A;  3KFC A;  3R8D A;  2PJL A;  3A2H A;  4N73 A;  2YJD A;  4XAO A;  5DV6 A;  3E00 D;  4G20 A;  2E2R A;  3OMO A;  5DX3 A;  1E3G A;  1T79 A;  2OM9 A;  4HEE X;  1ILG A;  2AX9 A;  2HB8 A;  1XOW A;  5FQT A;  2AX7 A;  3AFR A;  3FC6 A;  5L11 A;  3OS9 A;  3ZRA A;  5JY3 A;  2QA6 A;  3CJW A;  3UUD B;  2Q1H A;  3ERD A;  3K6P A;  1NDE A;  4XUH A;  1FM6 D;  3A3Z X;  1X7J A;  3OZJ A;  4RME A;  3VSP A;  3TY0 A;  3UUA A;  4XTA A;  5G42 A;  3V4A A;  3V3Q A;  3TKM A;  2V7C A;  2W8Y A;  4OHA A;  2YHD A;  2QZO A;  1NUO A;  4DOS A;  3UU7 A;  5E0W A;  3MNP A;  3DZU A;  1PK5 A;  4LTW A;  2QNV A;  4OC7 A;  5KRK A;  2P7Z A;  1K7L A;  5I4V A;  4MGC A;  1ERE A;  2NW4 A;  2OUZ A;  2Q5P A;  4IUI A;  5B41 A;  1RK3 A;  3FUR A;  4OK1 A;  2ZMI A;  3R5M A;  3X31 A;  3FEJ A;  4MG5 A;  2HCD A;  2ZMJ A;  2LBD A;  5DYD A;  4RWV A;  3PO9 A;  5HYR A;  3OKH A;  1T5Z A;  4N8R A;  3KDU A;  5AVL A;  2PIT A;  2OVH A;  2IOK A;  3MNE A;  2QGT A;  4M8H A;  5DZ3 A;  2AB2 A;  1FCZ A;  2ZFX A;  3AN4 A;  3LMP A;  3OMM A;  1NHZ A;  4P6W A;  3Q95 B;  5A86 A;  2ZLA A;  4J5W C;  1U3S A;  5DKB A;  4WLB A;  2PKL A;  5C4O A;  3R2A A;  2ZXZ A;  2ZAS A;  3H0A A;  3WT5 A;  2VV2 A;  1X76 A;  2QTU A;  1I37 A;  2PIO A;  1S9Q A;  3G0W A;  4IW6 A;  4NB6 A;  5DXK A;  1R5K A;  3UVV A;  1NAV A;  2Q5S A;  4PP6 A;  5DTV A;  5E7V A;  3ADS A;  3JZB A;  1XAP A;  4MG7 A;  4CSJ A;  1ZH7 A;  2GPO A;  3FC6 B;  2QSE A;  2Q7I A;  4Q0A C;  4OJ4 A;  5EGV A;  1SR7 A;  2PIN A;  4ZJR A;  1T7F A;  2ZBS A;  3DCU A;  3O1E A;  4OKX A;  2ATH A;  5E19 A;  5G5W A;  1GWQ A;  1IE8 A;  1P93 A;  3GZ9 A;  1VJB A;  2P15 A;  3CS8 A;  3FS1 A;  2GP7 A;  2ABI A;  4XUM A;  5KCC A;  4X1F A;  3F7D A;  4IS8 A;  3KPZ A;  4UDD A;  3GD2 A;  3B0R A;  1NQ0 A;  4QE6 A;  1FBY A;  2POG A;  5HJP A;  5KRI A;  1XP1 A;  3DR1 A;  2Q61 A;  2AMB A;  3L1B A;  1LV2 A;  4JYI A;  1R1K D;  3G8O A;  3AUR A;  2ZKC A;  5DY8 A;  4R6S A;  4OKT A;  4OEA A;  5LGA A;  4OEZ A;  4G1Z A;  4ZNV A;  5DMC A;  4MGD B;  2ZNN A;  4ZO1 B;  4YPQ A;  1NQ2 A;  1R1K A;  3AUN A;  4L96 A;  2XHS A;  4ZJW A;  3FUG A;  4ZN7 A;  1ERR A;  3HVL A;  4MGB B;  1XVP B;  2F4B A;  1PDU A;  3A9E A;  2VV1 A;  4REE A;  1Y0X X;  2QA8 A;  2XKW A;  5DLR A;  1XIU A;  1T65 A;  5KRC A;  3AUQ A;  4LNW A;  5ICK A;  3KBA A;  1Z5X U;  1ZDU A;  3G9E A;  1RKG A;  4WHF A;  2ZK0 A;  2Q7J A;  4PLD A;  1T7R A;  2AA7 A;  5AYG A;  5AZT A;  3W0I A;  3OSI A;  2ZK2 A;  5JI0 D;  2XYW A;  3W5T A;  2Q6J A;  4J5X C;  3WFF A;  2ACL B;  3BQD A;  3CDS A;  1I38 A;  3ET2 A;  5IAW A;  2VST A;  3V9V A;  4RFW A;  5G45 A;  3U9Q A;  2PRG A;  4OIV A;  4OGH A;  5KCW A;  4MG6 A;  3UUD A;  4FGY A;  1TXI A;  4A4W A;  2O4R A;  2PIV A;  1DB1 A;  4UDB A;  5KYA A;  4E4Q A;  1FM9 A;  4UDA A;  4OH5 A;  3KMG A;  1XLS E;  4NIE A;  3N00 A;  4ZNW A;  5DXE A;  2EWP A;  1P8D A;  1YOW A;  2QAB A;  5DUH A;  4EM9 A;  1L2J A;  3ET0 A;  4Q50 A;  4RUJ A;  5GIE A;  3DZY D;  1YUC A;  3D6D A;  2OCF A;  3NSP A;  4TUZ B;  1N46 A;  4IV4 A;  5KCT A;  2VV3 A;  3KMZ A;  4IV2 A;  3DZY A;  4XHD A;  2GPU A;  1X78 A;  2AA5 A;  4S0S A;  5GIC A;  1NRL A;  5KRA A;  2HVC A;  2HAS A;  1X7B A;  1XJ7 A;  1SJ0 A;  1HG4 A;  4HLW A;  4K4J A;  4DM6 A;  1YOK A;  3FAL B;  4TV1 B;  1OSH A;  1S0Z A;  3UP3 A;  2AO6 A;  3VJI A;  5JJM B;  2GPP A;  3Q95 A;  2QW4 A;  3OAP A;  1XV9 B;  3VRV A;  3DY6 A;  1YA3 A;  3H52 A;  2J4A A;  2HBH A;  2JFA B;  2YJA B;  3GWS X;  3L0E A;  4ITF A;  5E14 A;  3X1I A;  1PQ9 A;  3B68 A;  1MV9 A;  1OSV A;  4DOR A;  4N5G A;  4L98 A;  1PRG A;  4OFR A;  3UUC A;  5G43 A;  4J26 A;  4B7W A;  3WWR A;  3UP0 A;  1M7W A;  3B0W A;  3VHW A;  3OSW A;  4E4K A;  4KZJ A;  4PRG A;  4FHH A;  4N1Y A;  2G44 A;  3CS6 A;  3L3Z A;  2ZNO A;  2J14 A;  3W0H A;  2G5O A;  4M8E A;  4G2H A;  3ZQT A;  1L2I A;  1Y9R A;  3TKC A;  1RKH A;  3DZU D;  4IQR A;  3L0J A;  4JL4 A;  5DXM A;  3W5Q A;  3VJT A;  4PF3 A;  3VTB A;  3ADT A;  5DWL A;  4G2I A;  1YIM A;  1YMT A;  4IVW A;  4DK7 A;  3R5N A;  4YMQ A;  5KYJ A;  2AX8 A;  2Q7K A;  5M96 A;  4YT1 A;  4QM0 A;  3DT3 A;  3NOA A;  4XT9 A;  3ZRB A;  1KV6 A;  4IWC A;  3ILZ A;  3R29 A;  1Z5X E;  4MGD A;  4OKW A;  3OLF A;  4PPS A;  5FQP A;  4QK4 A;  1NQ1 A;  5DRM A;  5C4T A;  2I4P A;  3VI8 A;  1LBD A;  1U3R A;  3V9Y A;  4FN9 A;  4MGB A;  2AM9 A;  4ZI1 A;  1XVP A;  1I7I A;  5C4U A;  1XZX X;  3RY9 A;  1IE9 A;  1K4W A;  3K8S A;  3B0Q A;  2ZXN A;  4CI5 A;  5AVI A;  1XLS A;  4DM8 A;  3VTC A;  2A3I A;  3H0A D;  4ONI A;  3AZ2 A;  3HQ5 A;  1FCY A;  4G1Y A;  3OMP A;  3B66 A;  2HWQ A;  3NSQ A;  3JZC A;  3R8I A;  5AZV A;  4OJ9 A;  1XP9 A;  2ZK1 A;  2QXS A;  5FQS A;  3OOK A;  4R06 A;  1N4H A;  2ACL A;  4O8F A;  4OH6 A;  3VN2 A;  2G0G A;  2PIP L;  5KD9 A;  4OIL A;  1PZL A;  3RUT A;  2XYX A;  5HCV A;  3B0T A;  2Q3Y A;  3D24 A;  3WTQ A;  5DWE A;  2B23 A;  3GYT A;  5E1C A;  3SZ1 A;  2P7G A;  1NYX A;  4OZT U;  1R20 D;  2HWR A;  3SP9 A;  4MDD A;  1PQ6 A;  1Y0S A;  2AXA A;  3HLV A;  2BJ4 A;  3OKI A;  5DWI A;  4JYG A;  5DU5 A;  5EIT A;  2B1Z A;  1T76 A;  4NY9 A;  1R20 A;  4OKB A;  2OZ7 A;  2PIQ A;  3IPU A;  1UOM A;  3GBK A;  4TUZ A;  4APU A;  4RUP A;  1MZN A;  3MNO A;  2G0H A;  2YLY A;  4J24 A;  3KMR A;  3OLS A;  3PBA A;  3VHU A;  5E0X A;  2OVM A;  2OAX A;  2BAW A;  3O1D A;  2B1V A;  4IA1 A;  4RZE A;  4CI4 A;  1X7E A;  5G46 A;  3OOF A;  3VJH A;  4IA7 A;  2GWX A;  3RUU A;  3L03 A;  5DWJ A;  2P54 A;  2Q6S A;  3FAL A;  4TV1 A;  2AMA A;  2AAX A;  5JJM A;  3VT7 A;  3VRT A;  3ET1 A;  3VRW A;  2JF9 A;  1XV9 A;  3WJ4 A;  2GL8 A;  1XPC A;  1EXA A;  2VV4 B;  3TX7 B;  2JFA A;  4ZNU A;  5DSH A;  4ZN9 A;  1S0X A;  2PIR A;  3LBD A;  2GPV A;  4OZR U;  1ZEO A;  1Q4X A;  5HZC A;  3B65 A;  1G50 A;  1XQ3 A;  4IA2 A;  5KCF A;  1ILH A;  2ZLC A;  3A2J A;  3IMY A;  4J5W A;  5FQR A;  4JGV A;  4IA3 A;  5DIG A;  2B50 A;  3FXV A;  2ZXM A;  5DXP A;  5KRL A;  1FM9 D;  1T73 A;  4OEY A;  3HZF A;  1ZGY A;  3QT0 A;  2HB7 A;  1T63 A;  4ZO1 X;  2I4J A;  4OIU A;  4PP5 A;  1YY4 A;  5APK A;  2H79 A;  2Q6R A;  2QH6 A;  4A2J A;  1NAX A;  3RLL A;  2ZY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...