4OIVA

Structural basis for small molecule ndb as a selective antagonist of fxr
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
226
structure length
210
Chain Sequence
ELTPDQQTLLHFIMDSYNKSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFAELLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLEEIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Small Molecule NDB (N-Benzyl-N-(3-(tert-butyl)-4-hydroxyphenyl)-2,6-dichloro-4-(dimethylamino) Benzamide) as a Selective Antagonist of Farnesoid X Receptor alpha (FXR alpha ) in Stabilizing the Homodimerization of the Receptor.
pubmed doi rcsb
molecule keywords Bile acid receptor
molecule tags Nuclear protein receptor
source organism Homo sapiens
total genus 77
structure length 210
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4oivA00
4N1YA 3KMZA 1L2JA 5IXKA 2PITA 3ADWA 3NOAA 3KMRA 2AA2A 3OMKA 4O8FA 5EI1A 2OM9A 3B67A 5KCUA 2GPOA 4YT1A 5DWIA 3W0JA 3CQVA 5AVIA 2ZMIA 4JL4A 3V9VA 4NB6A 3W5RA 5C4UA 3GZ9A 1FM6D 5F9BA 5LGAA 4ZO1B 2AA6A 1T65A 2HWRA 2PNUA 2IHQA 4OKBA 3IMYA 2H79A 4RMEA 4Q0AC 1G2NA 3ADSA 3K6PA 3O1EA 4OH6A 4S14A 5DKEA 1ILGA 2ZK3A 1M13A 2QA6A 4EMAA 5G46A 2POGA 4OZRE 4QK4A 1XV9B 1UPVA 3A2HA 4K4JA 5KRMA 1NYXA 4RMDA 5DXGA 1QKTA 4OC7A 4PP6A 3ZRAA 4E4KA 4J26A 4OLMA 1ZKYA 2Q61A 5EHJA 5B5BA 5FQRA 2QXSA 5DXRA 1R6GA 1XDKA 2QA8A 4OKXA 5DRMA 4OFUA 1TXIA 2FSZA 2HASA 4OH5A 3WJ4A 1ZDUA 1YJEA 3Q95A 2Q5GA 3WT5A 3VJSA 4N73A 5EJVA 1QKUA 1FM9D 4ZNUA 2J7XA 4WHGA 3W5TA 3MNEA 5DZ0A 5DZHA 2VSRA 1XJ7A 3VSOA 2YJDA 4ITFA 4S0TA 4UDCA 1XLSE 4PLEA 1HJ1A 1UHLB 2AX9A 1XZXX 2VV4B 2Z4JA 2YFEA 3IPSA 3P88A 1PDUA 2AYRA 4FNEA 4IA1A 3G0WA 4FN9A 5DIGA 1SKXA 2XYWA 5AZVA 1XIUA 2GPUA 4IA2A 4ONIA 4ZO1X 3KWYA 4KZJA 3W0GA 3D5FA 3CWDA 3DZUA 2P4YA 5DX3B 1Z5XU 3RLJA 2ZK2A 1DB1A 3QT0A 3ZR7A 5DWJA 4OARA 2YLOA 4XUMA 2OZ7A 1YOKA 3OOFA 2JF9A 2ZNOA 5SYZA 5FQPA 4A4WA 5DRJA 3JZCA 1L2IA 3W5QA 3PO9A 5KCFA 4M8EA 2AX8A 1RK3A 3H0AD 1X7JA 4PXMA 5KYJA 2PIPL 3ZQTA 1UPWA 2OVMA 4XI3A 2GWXA 2PIRA 4G20A 5DVCA 2POBA 3D6DA 3R5MA 3T03A 4N5GA 5DV8A 1XAPA 2Q59B 3H0AA 1XP9A 1T76A 3G8IA 1OT7A 5AYGA 3UP3A 3UUDB 2PINA 3D24A 4DORA 4KZIA 3R29A 1Y9RA 2G0GA 5KCDA 3CDSA 4WPFA 5DKBA 4B7WA 4MGBA 2AX7A 1A52A 1I38A 4MGDA 5G45A 2YLQA 1GS4A 3VT8A 4WLBA 5DKGA 1YY4A 3DCUA 3DCTA 2YJAB 3OSAA 2Q7IA 3CS8A 3A9EA 3ET1A 3F5CA 5DI7A 1XNNA 2QA8B 2AAXA 4OFRA 5DXMA 2Q7JA 2HWQA 3OS8A 1T63A 1PQ9A 2QGTA 3CLDA 3L03A 3Q95B 4XHDA 1NDEA 1RDTD 2JFAB 1FD0A 4K6IA 1EXAA 5EGVA 3IPUA 4G2HA 5DUEA 4DM6A 1PQ6A 5A86A 4KZMA 3V49A 3R8DA 3U9QA 2P54A 4J5XA 4OGHA 3FEIA 2IOGA 2ZL9A 3OS8C 5DV3A 2ZXNA 1X7BA 2ABIA 3E94A 4PP5A 2NW4A 3G8OA 4IWCA 2ZNPA 4OKWA 1ZAFA 4TV1A 1E3KA 5DZ1A 2B23A 2QPYA 2Q6JA 2AMAA 2I0GA 2GTKA 4POJA 4UDDA 1MV9A 3X1IA 3CJWA 5DMFA 3O1DA 5ACCA 4OZTE 1ZEOA 2VV0A 4PPSA 1NQ7A 4LNXA 3UVVA 2GP7A 2QNVA 3OZJA 4PVUA 2QZOB 2VSTA 4QJRA 2BJ4A 3TKCA 3VJTA 4QE6A 5KR9A 5DXKA 4MGAA 3L0JA 1NHZA 5G5WA 3UU7B 1XVPA 3FC6A 2P7GA 1T74A 2Q8SA 3B0TA 1XOWA 3VI8A 2YLYA 3TY0A 4XTAA 2BAWA 4OJ4A 4RUPA 4XAOA 3VHVA 1NQ2A 2YHDA 5IZ0A 3WJ5A 1MVCA 1KKQA 1NQ0A 1DKFA 4R06A 5DMCA 1XQ3A 2ZK5A 2I4PA 5L7EA 2J7YA 1G5YA 5DV6A 3KDUA 5DTVA 1XNXA 1E3GA 2EWPA 4YNKA 5DWLA 5C4SA 4CI4A 4YPQA 5E7VA 5FQSA 5IAWA 5DYDA 3S9SA 1GWQA 1A28A 1G50A 5APJA 2GL8A 2P1UA 3B1MA 3JZBA 3AZ3A 5K13A 3IXPA 3VHUA 3ILZA 2VV3A 4OZRU 4MGBB 1NUOA 1H9UA 3FXVA 4MGDB 1I7GA 5AWJA 3HZFA 4DM8A 2ZNNA 3PRGA 4G21A 4PLDA 3A78A 1YA3A 2HAMA 3R5NA 4RUJA 4IQRA 3B66A 3A9EB 4UDBA 3F5CB 5G44A 4RZEA 4N8RA 3B5RA 4IA3A 3B0RA 3KPZA 5JY3A 1M7WA 5L7HA 3VRWA 3VRVA 2QMVA 2ZK1A 5DYBA 3A40X 2HBHA 3DY6A 4IVYA 2Q6RA 2QH6A 2QXMA 2JJ3A 2AWHA 3VT6A 2ZVTA 2ZLAA 3V4AA 3L0EA 2G5OA 2ATHA 3IA6A 1FBYA 5DUGA 3ERDA 3V9YA 3L0LA 3AZ2A 2GPPA 3HO0A 2XYXA 3LBDA 2R6YA 4QM0A 5HYRA 3UP0A 1T79A 3HQ5A 5DZIA 2R6WA 1VJBA 4TV1B 4DK7A 4OKTA 3DZUD 3VJHA 2ZFXA 2HFPA 1SR7A 3VJIA 4IV4A 2ZBSA 3OKHA 4MG7A 1U3RA 5GIEA 2Q5SA 3PBAA 2BJ4B 1X76A 3AX8A 1S0ZA 2XKWA 3K23A 5HJPB 3OMQA 4MGAB 1OSVA 3OKIA 2O4JA 3KMGA 1XVPB 4R2UA 3V3QA 2VV2A 3BC5A 3OAPA 3NSQA 2J4AA 2Q1VA 5DIEA 3AUNA 2PKLA 5DWGA 3WFGA 4J5WA 5JJMA 3OLSA 3HC6A 2PIWA 3RVFA 1K74D 4IW8A 4ZNWA 1DKFB 5E1CA 1YINA 3A2JA 3CDPA 2YLPA 3GWSX 4R6SA 1SQNA 2GPVA 5DWEA 1U3SA 1RKHA 4JYGA 4LNWA 2HARA 5DKSA 1GWRA 2ZXMA 3GWXA 2QW4A 3NSPA 2P1TA 1XP6A 5AAUA 3VT3A 1K74A 5M96A 4J5WC 4G1YA 4MDDA 2Q3YA 2OCFA 3X36A 4FGYA 4HEEX 1QKNA 4PF3A 2J14A 2ACLA 2Q7KA 3FEJA 4RWVA 3VT5A 4IW6A 3P0UA 3VRUA 5HZCA 4UDAA 2ZMJA 2PJLA 1IE9A 3DZYD 2XYJA 3K22A 5KRJA 1XPCA 3WFFA 4E2JA 3W0AA 3OOKA 1M2ZA 2NV7A 1PQCA 2AM9A 4ZNVA 2REWA 3SZ1A 2PIOA 2NXXA 1NAVA 4XT9A 5DK9A 3DZYA 3BQDA 3FLIA 3VT9A 2OVHA 1XDKB 5DXPA 5KCTA 3WTQA 4WHFA 4MG9A 3ADTA 4YMQA 4BCRA 4JYHA 5H1EA 2R40A 2PRGA 4PPPA 3RY9A 1XLSA 2HB8A 2QSEA 4PWLA 3VT4A 5ETHA 2B50A 4A2JA 2VV1A 3GD2A 4OIVA 4LBDA 4WQPA 1S9PA 5KCEA 5I4VA 4OZTU 3HODA 5DLRA 1NRLA 3OZ0A 4DK8A 4MG7B 3R8AA 3VTCA 1LBDA 5AAVA 1Q4XA 3GYTA 2ZK0A 3DT3A 1IE8A 4JYIA 5DP0A 1XV9A 1ZGYA 3WGPA 4PRGA 5AWKA 5AVLA 1ZH7A 5DZ3A 4POHA 5DXEA 2PIXA 1LV2A 1R20A 3PCUA 4S0SA 5ICKA 3OMMA 1Y0XX 1GWXA 1PCGA 5KRLA 4MG6A 2P1VA 3WT7A 1ZDTA 5EC9A 4RFWA 5DU5A 1XP1A 3G9EA 5G42A 4P6XA 2I4ZA 1YUCA 4RAKA 4ZI1A 1KV6A 3AUQA 3GYUA 1X7RA 1P8DA 2H77A 3IXPD 2ZASA 2ACLB 1S0XA 2I4JA 5C4OA 1N46A 3N00A 4TUZA 4MG8A 2AO6A 4G1DA 5HYKA 5DXQA 4J24A 1S9QA 3IPQA 2B1VA 4L96A 3FALA 2PIUA 3ET0A 3WWRA 1XB7A 4OK1A 2FVJA 3SP6A 3M7RA 3L3ZA 1Z95A 2OAXA 5DSHA 4OEYA 3VSPA 5KRCA 5KRAA 4QL8A 4IU7A 5AK2A 3A3ZX 5APKA 3VN2A 3E00D 3R2AA 2Q1HA 3L3XA 3ET2A 4MG9B 3WMHA 5KYAA 3TKMA 3K8SA 4RZFA 4JAZA 5CJ6A 2QR9A 3ADUA 1X78A 4REFA 4CI5A 3B3KA 5KRHA 3W0HA 1P93A 1T73A 3E00A 3FUGA 4OEZA 1WM0X 2YATA 2AA7A 2ZK4A 3R8IA 4ZJWA 2HB7A 1T7FA 3VHWA 3E7CA 3WT6A 2VV1B 1X7EA 4MG5A 2FAIA 3KFCA 4ITEA 3D90A 5L11A 2Q59A 4XLDA 4G1ZA 5E0WA 3UUDA 3CS4A 2P15A 2ZKCA 1FM6A 4K7AA 5GT4A 4RZGA 5AAVB 3D57A 4DOSA 1XQCA 2GIUA 3HC5A 3ADVA 3EYBA 3FURA 2OUZA 3AURA 1HG4A 2A3IA 3VT7A 2Q6SA 3PLZA 1PK5A 3OMOA 4ZN7A 3V3EA 1PRGA 5DXBA 3UVVB 1OVLA 2XHSA 3ET3A 3KDTA 1UOMA 2NXXE 3B68A 5GIDA 1U3QA 3KBAA 1T7TA 2JFAA 1FCYA 5E15A 3OLFA 2O9IA 3FC6B 1YOWA 3GBKA 1YMTA 2V7CA 3LMPA 4DMAA 5DL4A 3VRTA 2Q70A 2F4BA 2PIVA 4IUIA 4LTWA 3ZRBA 5B41A 5HJSA 5KRFA 3TX7B 1S19A 2P7ZA 2Z4BA 5LWPA 5E14A 1FM9A 4IA7A 3X31A 2B1ZA 3HVLA 1SJ0A 4OEAA 4WVDA 5E0XA 4RMCA 5KROA 4APUA 4DQMA 3OSIA 4TUZB 2P7AA 4IWFA 1Y0SA 4MG8B 3W0IA 4IS8A 4OJBA 2ZY0A 4ZNSA 1TFCA 3BEJA 4FHIA 2G44A 5C4TA 5DVVA 2QGWA 3FALB 2PIQA 3GN8A 3P89A 2QE4A 1MZNA 1EREA 1K7LA 4RE8A 1U9EA 1YIMA 3AFRA 1ILHA 2I0JA 4ZN9A 4JGVA 4OEDA 5HCVA 4ZJRA 1KNUA 2QZOA 4P6WA 4CSJA 3HM1A 3VTDA 5KCWA 3SP9A 1T5ZA 1Z5XE 3UU7A 3ERTA 3UUAA 3VTBA 4OHAA 3RLLA 1T7RA 3PEQA 2QTUA 2R40D 2IOKA 1NQ1A 2E2RA 3AN3A 3OMPA 4G2IA 4ZOMA 5KD9A 4A4VA 2AXAA 4E4QA 4Y29A 3UUCA 3X1HA 3B0WA 5KRKA 3MNOA 4EM9A 5FQVA 4PP3A 1YP0A 4NY9A 1NAXA 4NQAB 3OLLA 2LBDA 4M8HA 4F9MA 3KYTA 2HCDA 2AMBA 4Q50A 5FQTA 4LSJA 5APHA 3L1BA 1I37A 1YYEA 2AA5A 2G0HA 3B0QA 3AN4A 1PZLA 5DXBB 1OVLB 3OS9A 4IV2A 5G3JA 5JI0D 3ADXA 5GICA 5DUHA 1QKMA 1R20D 1N83A 4OILA 2NPAA 5KCCA 4S15A 1G1UA 5G43A 1ERRA 1EXXA 4REEA 3P8XA 4OIUA 3W0CA 1RKGA 4ZNTA 2HVCA 2ZK6A 3MNPA 5DVSA 2QABA 3RUUA 4IVWA 2AB2A 2W8YA 5JJMB 3W0YA 1R1KD 2HC4A 1RDTA 4X1FA 1FCXA 4QE8A 1RJKA 1I7IA 4MGCA 2V0VA 3CTBA 3RUTA 5L7GA 2ZMHA 3A2IA 1R1KA 1T7MA 4NIEA 4ZNHA 1ZUCA 2ZLCA 3FS1A 2AX6A 3DR1A 3OSWA 1UHLA 3B65A 4OJ9A 4RUOX 3W5PA 1N4HA 2VV4A 4J5XC 2Q7LA 3OGTA 5DY8A 4X1GA 4Q13A 3CS6A 5KRIA 5DIDA 1R5KA 4XUHA 4L98A 5E19A 2Q60A 2ZXZA 3F7DA 4FHHA 5HJPA 1BSXA 5AZTA 5DX3A 2O4RA 2Q5PA 3UUAB 3V9TA 4HLWA 1FCZA 2ZNQA 3AZ1A 3HLVA 3H52A 1OSHA 5EITA 1K4WA 4NUFA
chains in the Genus database with same CATH superfamily
4N1YA 3KMZA 1L2JA 5IXKA 2PITA 3ADWA 3NOAA 3KMRA 2AA2A 3OMKA 4O8FA 5EI1A 2OM9A 3B67A 5KCUA 2GPOA 4YT1A 5DWIA 3W0JA 3CQVA 5AVIA 2ZMIA 4JL4A 3V9VA 4NB6A 3W5RA 5C4UA 3GZ9A 1FM6D 5F9BA 5LGAA 4ZO1B 2AA6A 1T65A 2HWRA 2PNUA 2IHQA 4OKBA 3IMYA 2H79A 4RMEA 4Q0AC 1G2NA 3ADSA 3K6PA 3O1EA 4OH6A 4S14A 5DKEA 1ILGA 2ZK3A 1M13A 2QA6A 4EMAA 5G46A 2POGA 4OZRE 4QK4A 1XV9B 1UPVA 3A2HA 4K4JA 5KRMA 1NYXA 4RMDA 5DXGA 1QKTA 4OC7A 4PP6A 3ZRAA 4E4KA 4J26A 4OLMA 1ZKYA 2Q61A 5EHJA 5B5BA 5FQRA 2QXSA 5DXRA 1R6GA 1XDKA 2QA8A 4OKXA 5DRMA 4OFUA 1TXIA 2FSZA 2HASA 4OH5A 3WJ4A 1ZDUA 1YJEA 3Q95A 2Q5GA 3WT5A 3VJSA 4N73A 5EJVA 1QKUA 1FM9D 4ZNUA 2J7XA 4WHGA 3W5TA 3MNEA 5DZ0A 5DZHA 2VSRA 1XJ7A 3VSOA 2YJDA 4ITFA 4S0TA 4UDCA 1XLSE 4PLEA 1HJ1A 1UHLB 2AX9A 1XZXX 2VV4B 2Z4JA 2YFEA 3IPSA 3P88A 1PDUA 2AYRA 4FNEA 4IA1A 3G0WA 4FN9A 5DIGA 1SKXA 2XYWA 5AZVA 1XIUA 2GPUA 4IA2A 4ONIA 4ZO1X 3KWYA 4KZJA 3W0GA 3D5FA 3CWDA 3DZUA 2P4YA 5DX3B 1Z5XU 3RLJA 2ZK2A 1DB1A 3QT0A 3ZR7A 5DWJA 4OARA 2YLOA 4XUMA 2OZ7A 1YOKA 3OOFA 2JF9A 2ZNOA 5SYZA 5FQPA 4A4WA 5DRJA 3JZCA 1L2IA 3W5QA 3PO9A 5KCFA 4M8EA 2AX8A 1RK3A 3H0AD 1X7JA 4PXMA 5KYJA 2PIPL 3ZQTA 1UPWA 2OVMA 4XI3A 2GWXA 2PIRA 4G20A 5DVCA 2POBA 3D6DA 3R5MA 3T03A 4N5GA 5DV8A 1XAPA 2Q59B 3H0AA 1XP9A 1T76A 3G8IA 1OT7A 5AYGA 3UP3A 3UUDB 2PINA 3D24A 4DORA 4KZIA 3R29A 1Y9RA 2G0GA 5KCDA 3CDSA 4WPFA 5DKBA 4B7WA 4MGBA 2AX7A 1A52A 1I38A 4MGDA 5G45A 2YLQA 1GS4A 3VT8A 4WLBA 5DKGA 1YY4A 3DCUA 3DCTA 2YJAB 3OSAA 2Q7IA 3CS8A 3A9EA 3ET1A 3F5CA 5DI7A 1XNNA 2QA8B 2AAXA 4OFRA 5DXMA 2Q7JA 2HWQA 3OS8A 1T63A 1PQ9A 2QGTA 3CLDA 3L03A 3Q95B 4XHDA 1NDEA 1RDTD 2JFAB 1FD0A 4K6IA 1EXAA 5EGVA 3IPUA 4G2HA 5DUEA 4DM6A 1PQ6A 5A86A 4KZMA 3V49A 3R8DA 3U9QA 2P54A 4J5XA 4OGHA 3FEIA 2IOGA 2ZL9A 3OS8C 5DV3A 2ZXNA 1X7BA 2ABIA 3E94A 4PP5A 2NW4A 3G8OA 4IWCA 2ZNPA 4OKWA 1ZAFA 4TV1A 1E3KA 5DZ1A 2B23A 2QPYA 2Q6JA 2AMAA 2I0GA 2GTKA 4POJA 4UDDA 1MV9A 3X1IA 3CJWA 5DMFA 3O1DA 5ACCA 4OZTE 1ZEOA 2VV0A 4PPSA 1NQ7A 4LNXA 3UVVA 2GP7A 2QNVA 3OZJA 4PVUA 2QZOB 2VSTA 4QJRA 2BJ4A 3TKCA 3VJTA 4QE6A 5KR9A 5DXKA 4MGAA 3L0JA 1NHZA 5G5WA 3UU7B 1XVPA 3FC6A 2P7GA 1T74A 2Q8SA 3B0TA 1XOWA 3VI8A 2YLYA 3TY0A 4XTAA 2BAWA 4OJ4A 4RUPA 4XAOA 3VHVA 1NQ2A 2YHDA 5IZ0A 3WJ5A 1MVCA 1KKQA 1NQ0A 1DKFA 4R06A 5DMCA 1XQ3A 2ZK5A 2I4PA 5L7EA 2J7YA 1G5YA 5DV6A 3KDUA 5DTVA 1XNXA 1E3GA 2EWPA 4YNKA 5DWLA 5C4SA 4CI4A 4YPQA 5E7VA 5FQSA 5IAWA 5DYDA 3S9SA 1GWQA 1A28A 1G50A 5APJA 2GL8A 2P1UA 3B1MA 3JZBA 3AZ3A 5K13A 3IXPA 3VHUA 3ILZA 2VV3A 4OZRU 4MGBB 1NUOA 1H9UA 3FXVA 4MGDB 1I7GA 5AWJA 3HZFA 4DM8A 2ZNNA 3PRGA 4G21A 4PLDA 3A78A 1YA3A 2HAMA 3R5NA 4RUJA 4IQRA 3B66A 3A9EB 4UDBA 3F5CB 5G44A 4RZEA 4N8RA 3B5RA 4IA3A 3B0RA 3KPZA 5JY3A 1M7WA 5L7HA 3VRWA 3VRVA 2QMVA 2ZK1A 5DYBA 3A40X 2HBHA 3DY6A 4IVYA 2Q6RA 2QH6A 2QXMA 2JJ3A 2AWHA 3VT6A 2ZVTA 2ZLAA 3V4AA 3L0EA 2G5OA 2ATHA 3IA6A 1FBYA 5DUGA 3ERDA 3V9YA 3L0LA 3AZ2A 2GPPA 3HO0A 2XYXA 3LBDA 2R6YA 4QM0A 5HYRA 3UP0A 1T79A 3HQ5A 5DZIA 2R6WA 1VJBA 4TV1B 4DK7A 4OKTA 3DZUD 3VJHA 2ZFXA 2HFPA 1SR7A 3VJIA 4IV4A 2ZBSA 3OKHA 4MG7A 1U3RA 5GIEA 2Q5SA 3PBAA 2BJ4B 1X76A 3AX8A 1S0ZA 2XKWA 3K23A 5HJPB 3OMQA 4MGAB 1OSVA 3OKIA 2O4JA 3KMGA 1XVPB 4R2UA 3V3QA 2VV2A 3BC5A 3OAPA 3NSQA 2J4AA 2Q1VA 5DIEA 3AUNA 2PKLA 5DWGA 3WFGA 4J5WA 5JJMA 3OLSA 3HC6A 2PIWA 3RVFA 1K74D 4IW8A 4ZNWA 1DKFB 5E1CA 1YINA 3A2JA 3CDPA 2YLPA 3GWSX 4R6SA 1SQNA 2GPVA 5DWEA 1U3SA 1RKHA 4JYGA 4LNWA 2HARA 5DKSA 1GWRA 2ZXMA 3GWXA 2QW4A 3NSPA 2P1TA 1XP6A 5AAUA 3VT3A 1K74A 5M96A 4J5WC 4G1YA 4MDDA 2Q3YA 2OCFA 3X36A 4FGYA 4HEEX 1QKNA 4PF3A 2J14A 2ACLA 2Q7KA 3FEJA 4RWVA 3VT5A 4IW6A 3P0UA 3VRUA 5HZCA 4UDAA 2ZMJA 2PJLA 1IE9A 3DZYD 2XYJA 3K22A 5KRJA 1XPCA 3WFFA 4E2JA 3W0AA 3OOKA 1M2ZA 2NV7A 1PQCA 2AM9A 4ZNVA 2REWA 3SZ1A 2PIOA 2NXXA 1NAVA 4XT9A 5DK9A 3DZYA 3BQDA 3FLIA 3VT9A 2OVHA 1XDKB 5DXPA 5KCTA 3WTQA 4WHFA 4MG9A 3ADTA 4YMQA 4BCRA 4JYHA 5H1EA 2R40A 2PRGA 4PPPA 3RY9A 1XLSA 2HB8A 2QSEA 4PWLA 3VT4A 5ETHA 2B50A 4A2JA 2VV1A 3GD2A 4OIVA 4LBDA 4WQPA 1S9PA 5KCEA 5I4VA 4OZTU 3HODA 5DLRA 1NRLA 3OZ0A 4DK8A 4MG7B 3R8AA 3VTCA 1LBDA 5AAVA 1Q4XA 3GYTA 2ZK0A 3DT3A 1IE8A 4JYIA 5DP0A 1XV9A 1ZGYA 3WGPA 4PRGA 5AWKA 5AVLA 1ZH7A 5DZ3A 4POHA 5DXEA 2PIXA 1LV2A 1R20A 3PCUA 4S0SA 5ICKA 3OMMA 1Y0XX 1GWXA 1PCGA 5KRLA 4MG6A 2P1VA 3WT7A 1ZDTA 5EC9A 4RFWA 5DU5A 1XP1A 3G9EA 5G42A 4P6XA 2I4ZA 1YUCA 4RAKA 4ZI1A 1KV6A 3AUQA 3GYUA 1X7RA 1P8DA 2H77A 3IXPD 2ZASA 2ACLB 1S0XA 2I4JA 5C4OA 1N46A 3N00A 4TUZA 4MG8A 2AO6A 4G1DA 5HYKA 5DXQA 4J24A 1S9QA 3IPQA 2B1VA 4L96A 3FALA 2PIUA 3ET0A 3WWRA 1XB7A 4OK1A 2FVJA 3SP6A 3M7RA 3L3ZA 1Z95A 2OAXA 5DSHA 4OEYA 3VSPA 5KRCA 5KRAA 4QL8A 4IU7A 5AK2A 3A3ZX 5APKA 3VN2A 3E00D 3R2AA 2Q1HA 3L3XA 3ET2A 4MG9B 3WMHA 5KYAA 3TKMA 3K8SA 4RZFA 4JAZA 5CJ6A 2QR9A 3ADUA 1X78A 4REFA 4CI5A 3B3KA 5KRHA 3W0HA 1P93A 1T73A 3E00A 3FUGA 4OEZA 1WM0X 2YATA 2AA7A 2ZK4A 3R8IA 4ZJWA 2HB7A 1T7FA 3VHWA 3E7CA 3WT6A 2VV1B 1X7EA 4MG5A 2FAIA 3KFCA 4ITEA 3D90A 5L11A 2Q59A 4XLDA 4G1ZA 5E0WA 3UUDA 3CS4A 2P15A 2ZKCA 1FM6A 4K7AA 5GT4A 4RZGA 5AAVB 3D57A 4DOSA 1XQCA 2GIUA 3HC5A 3ADVA 3EYBA 3FURA 2OUZA 3AURA 1HG4A 2A3IA 3VT7A 2Q6SA 3PLZA 1PK5A 3OMOA 4ZN7A 3V3EA 1PRGA 5DXBA 3UVVB 1OVLA 2XHSA 3ET3A 3KDTA 1UOMA 2NXXE 3B68A 5GIDA 1U3QA 3KBAA 1T7TA 2JFAA 1FCYA 5E15A 3OLFA 2O9IA 3FC6B 1YOWA 3GBKA 1YMTA 2V7CA 3LMPA 4DMAA 5DL4A 3VRTA 2Q70A 2F4BA 2PIVA 4IUIA 4LTWA 3ZRBA 5B41A 5HJSA 5KRFA 3TX7B 1S19A 2P7ZA 2Z4BA 5LWPA 5E14A 1FM9A 4IA7A 3X31A 2B1ZA 3HVLA 1SJ0A 4OEAA 4WVDA 5E0XA 4RMCA 5KROA 4APUA 4DQMA 3OSIA 4TUZB 2P7AA 4IWFA 1Y0SA 4MG8B 3W0IA 4IS8A 4OJBA 2ZY0A 4ZNSA 1TFCA 3BEJA 4FHIA 2G44A 5C4TA 5DVVA 2QGWA 3FALB 2PIQA 3GN8A 3P89A 2QE4A 1MZNA 1EREA 1K7LA 4RE8A 1U9EA 1YIMA 3AFRA 1ILHA 2I0JA 4ZN9A 4JGVA 4OEDA 5HCVA 4ZJRA 1KNUA 2QZOA 4P6WA 4CSJA 3HM1A 3VTDA 5KCWA 3SP9A 1T5ZA 1Z5XE 3UU7A 3ERTA 3UUAA 3VTBA 4OHAA 3RLLA 1T7RA 3PEQA 2QTUA 2R40D 2IOKA 1NQ1A 2E2RA 3AN3A 3OMPA 4G2IA 4ZOMA 5KD9A 4A4VA 2AXAA 4E4QA 4Y29A 3UUCA 3X1HA 3B0WA 5KRKA 3MNOA 4EM9A 5FQVA 4PP3A 1YP0A 4NY9A 1NAXA 4NQAB 3OLLA 2LBDA 4M8HA 4F9MA 3KYTA 2HCDA 2AMBA 4Q50A 5FQTA 4LSJA 5APHA 3L1BA 1I37A 1YYEA 2AA5A 2G0HA 3B0QA 3AN4A 1PZLA 5DXBB 1OVLB 3OS9A 4IV2A 5G3JA 5JI0D 3ADXA 5GICA 5DUHA 1QKMA 1R20D 1N83A 4OILA 2NPAA 5KCCA 4S15A 1G1UA 5G43A 1ERRA 1EXXA 4REEA 3P8XA 4OIUA 3W0CA 1RKGA 4ZNTA 2HVCA 2ZK6A 3MNPA 5DVSA 2QABA 3RUUA 4IVWA 2AB2A 2W8YA 5JJMB 3W0YA 1R1KD 2HC4A 1RDTA 4X1FA 1FCXA 4QE8A 1RJKA 1I7IA 4MGCA 2V0VA 3CTBA 3RUTA 5L7GA 2ZMHA 3A2IA 1R1KA 1T7MA 4NIEA 4ZNHA 1ZUCA 2ZLCA 3FS1A 2AX6A 3DR1A 3OSWA 1UHLA 3B65A 4OJ9A 4RUOX 3W5PA 1N4HA 2VV4A 4J5XC 2Q7LA 3OGTA 5DY8A 4X1GA 4Q13A 3CS6A 5KRIA 5DIDA 1R5KA 4XUHA 4L98A 5E19A 2Q60A 2ZXZA 3F7DA 4FHHA 5HJPA 1BSXA 5AZTA 5DX3A 2O4RA 2Q5PA 3UUAB 3V9TA 4HLWA 1FCZA 2ZNQA 3AZ1A 3HLVA 3H52A 1OSHA 5EITA 1K4WA 4NUFA
chains in the Genus database with same CATH topology
4N1YA 3KMZA 1L2JA 5IXKA 2PITA 3ADWA 3NOAA 3KMRA 2AA2A 3OMKA 4O8FA 5EI1A 2OM9A 3B67A 5KCUA 2GPOA 4YT1A 5DWIA 3W0JA 3CQVA 5AVIA 2ZMIA 4JL4A 3V9VA 4NB6A 3W5RA 5C4UA 3GZ9A 1FM6D 5F9BA 5LGAA 4ZO1B 2AA6A 1T65A 2HWRA 2PNUA 2IHQA 4OKBA 3IMYA 2H79A 4RMEA 4Q0AC 1G2NA 3ADSA 3K6PA 3O1EA 4OH6A 4S14A 5DKEA 1ILGA 2ZK3A 1M13A 2QA6A 4EMAA 5G46A 2POGA 4OZRE 4QK4A 1XV9B 1UPVA 3A2HA 4K4JA 5KRMA 1NYXA 4RMDA 5DXGA 1QKTA 4OC7A 4PP6A 3ZRAA 4E4KA 4J26A 4OLMA 1ZKYA 2Q61A 5EHJA 5B5BA 5FQRA 2QXSA 5DXRA 1R6GA 1XDKA 2QA8A 4OKXA 5DRMA 4OFUA 1TXIA 2FSZA 2HASA 4OH5A 3WJ4A 1ZDUA 1YJEA 3Q95A 2Q5GA 3WT5A 3VJSA 4N73A 5EJVA 1QKUA 1FM9D 4ZNUA 2J7XA 4WHGA 3W5TA 3MNEA 5DZ0A 5DZHA 2VSRA 1XJ7A 3VSOA 2YJDA 4ITFA 4S0TA 4UDCA 1XLSE 4PLEA 1HJ1A 1UHLB 2AX9A 1XZXX 2VV4B 2Z4JA 2YFEA 3IPSA 3P88A 1PDUA 2AYRA 4FNEA 4IA1A 3G0WA 4FN9A 5DIGA 1SKXA 2XYWA 5AZVA 1XIUA 2GPUA 4IA2A 4ONIA 4ZO1X 3KWYA 4KZJA 3W0GA 3D5FA 3CWDA 3DZUA 2P4YA 5DX3B 1Z5XU 3RLJA 2ZK2A 1DB1A 3QT0A 3ZR7A 5DWJA 4OARA 2YLOA 4XUMA 2OZ7A 1YOKA 3OOFA 2JF9A 2ZNOA 5SYZA 5FQPA 4A4WA 5DRJA 3JZCA 1L2IA 3W5QA 3PO9A 5KCFA 4M8EA 2AX8A 1RK3A 3H0AD 1X7JA 4PXMA 5KYJA 2PIPL 3ZQTA 1UPWA 2OVMA 4XI3A 2GWXA 2PIRA 4G20A 5DVCA 2POBA 3D6DA 3R5MA 3T03A 4N5GA 5DV8A 1XAPA 2Q59B 3H0AA 1XP9A 1T76A 3G8IA 1OT7A 5AYGA 3UP3A 3UUDB 2PINA 3D24A 4DORA 4KZIA 3R29A 1Y9RA 2G0GA 5KCDA 3CDSA 4WPFA 5DKBA 4B7WA 4MGBA 2AX7A 1A52A 1I38A 4MGDA 5G45A 2YLQA 1GS4A 3VT8A 4WLBA 5DKGA 1YY4A 3DCUA 3DCTA 2YJAB 3OSAA 2Q7IA 3CS8A 3A9EA 3ET1A 3F5CA 5DI7A 1XNNA 2QA8B 2AAXA 4OFRA 5DXMA 2Q7JA 2HWQA 3OS8A 1T63A 1PQ9A 2QGTA 3CLDA 3L03A 3Q95B 4XHDA 1NDEA 1RDTD 2JFAB 1FD0A 4K6IA 1EXAA 5EGVA 3IPUA 4G2HA 5DUEA 4DM6A 1PQ6A 5A86A 4KZMA 3V49A 3R8DA 3U9QA 2P54A 4J5XA 4OGHA 3FEIA 2IOGA 2ZL9A 3OS8C 5DV3A 2ZXNA 1X7BA 2ABIA 3E94A 4PP5A 2NW4A 3G8OA 4IWCA 2ZNPA 4OKWA 1ZAFA 4TV1A 1E3KA 5DZ1A 2B23A 2QPYA 2Q6JA 2AMAA 2I0GA 2GTKA 4POJA 4UDDA 1MV9A 3X1IA 3CJWA 5DMFA 3O1DA 5ACCA 4OZTE 1ZEOA 2VV0A 4PPSA 1NQ7A 4LNXA 3UVVA 2GP7A 2QNVA 3OZJA 4PVUA 2QZOB 2VSTA 4QJRA 2BJ4A 3TKCA 3VJTA 4QE6A 5KR9A 5DXKA 4MGAA 3L0JA 1NHZA 5G5WA 3UU7B 1XVPA 3FC6A 2P7GA 1T74A 2Q8SA 3B0TA 1XOWA 3VI8A 2YLYA 3TY0A 4XTAA 2BAWA 4OJ4A 4RUPA 4XAOA 3VHVA 1NQ2A 2YHDA 5IZ0A 3WJ5A 1MVCA 1KKQA 1NQ0A 1DKFA 4R06A 5DMCA 1XQ3A 2ZK5A 2I4PA 5L7EA 2J7YA 1G5YA 5DV6A 3KDUA 5DTVA 1XNXA 1E3GA 2EWPA 4YNKA 5DWLA 5C4SA 4CI4A 4YPQA 5E7VA 5FQSA 5IAWA 5DYDA 3S9SA 1GWQA 1A28A 1G50A 5APJA 2GL8A 2P1UA 3B1MA 3JZBA 3AZ3A 5K13A 3IXPA 3VHUA 3ILZA 2VV3A 4OZRU 4MGBB 1NUOA 1H9UA 3FXVA 4MGDB 1I7GA 5AWJA 3HZFA 4DM8A 2ZNNA 3PRGA 4G21A 4PLDA 3A78A 1YA3A 2HAMA 3R5NA 4RUJA 4IQRA 3B66A 3A9EB 4UDBA 3F5CB 5G44A 4RZEA 4N8RA 3B5RA 4IA3A 3B0RA 3KPZA 5JY3A 1M7WA 5L7HA 3VRWA 3VRVA 2QMVA 2ZK1A 5DYBA 3A40X 2HBHA 3DY6A 4IVYA 2Q6RA 2QH6A 2QXMA 2JJ3A 2AWHA 3VT6A 2ZVTA 2ZLAA 3V4AA 3L0EA 2G5OA 2ATHA 3IA6A 1FBYA 5DUGA 3ERDA 3V9YA 3L0LA 3AZ2A 2GPPA 3HO0A 2XYXA 3LBDA 2R6YA 4QM0A 5HYRA 3UP0A 1T79A 3HQ5A 5DZIA 2R6WA 1VJBA 4TV1B 4DK7A 4OKTA 3DZUD 3VJHA 2ZFXA 2HFPA 1SR7A 3VJIA 4IV4A 2ZBSA 3OKHA 4MG7A 1U3RA 5GIEA 2Q5SA 3PBAA 2BJ4B 1X76A 3AX8A 1S0ZA 2XKWA 3K23A 5HJPB 3OMQA 4MGAB 1OSVA 3OKIA 2O4JA 3KMGA 1XVPB 4R2UA 3V3QA 2VV2A 3BC5A 3OAPA 3NSQA 2J4AA 2Q1VA 5DIEA 3AUNA 2PKLA 5DWGA 3WFGA 4J5WA 5JJMA 3OLSA 3HC6A 2PIWA 3RVFA 1K74D 4IW8A 4ZNWA 1DKFB 5E1CA 1YINA 3A2JA 3CDPA 2YLPA 3GWSX 4R6SA 1SQNA 2GPVA 5DWEA 1U3SA 1RKHA 4JYGA 4LNWA 2HARA 5DKSA 1GWRA 2ZXMA 3GWXA 2QW4A 3NSPA 2P1TA 1XP6A 5AAUA 3VT3A 1K74A 5M96A 4J5WC 4G1YA 4MDDA 2Q3YA 2OCFA 3X36A 4FGYA 4HEEX 1QKNA 4PF3A 2J14A 2ACLA 2Q7KA 3FEJA 4RWVA 3VT5A 4IW6A 3P0UA 3VRUA 5HZCA 4UDAA 2ZMJA 2PJLA 1IE9A 3DZYD 2XYJA 3K22A 5KRJA 1XPCA 3WFFA 4E2JA 3W0AA 3OOKA 1M2ZA 2NV7A 1PQCA 2AM9A 4ZNVA 2REWA 3SZ1A 2PIOA 2NXXA 1NAVA 4XT9A 5DK9A 3DZYA 3BQDA 3FLIA 3VT9A 2OVHA 1XDKB 5DXPA 5KCTA 3WTQA 4WHFA 4MG9A 3ADTA 4YMQA 4BCRA 4JYHA 5H1EA 2R40A 2PRGA 4PPPA 3RY9A 1XLSA 2HB8A 2QSEA 4PWLA 3VT4A 5ETHA 2B50A 4A2JA 2VV1A 3GD2A 4OIVA 4LBDA 4WQPA 1S9PA 5KCEA 5I4VA 4OZTU 3HODA 5DLRA 1NRLA 3OZ0A 4DK8A 4MG7B 3R8AA 3VTCA 1LBDA 5AAVA 1Q4XA 3GYTA 2ZK0A 3DT3A 1IE8A 4JYIA 5DP0A 1XV9A 1ZGYA 3WGPA 4PRGA 5AWKA 5AVLA 1ZH7A 5DZ3A 4POHA 5DXEA 2PIXA 1LV2A 1R20A 3PCUA 4S0SA 5ICKA 3OMMA 1Y0XX 1GWXA 1PCGA 5KRLA 4MG6A 2P1VA 3WT7A 1ZDTA 5EC9A 4RFWA 5DU5A 1XP1A 3G9EA 5G42A 4P6XA 2I4ZA 1YUCA 4RAKA 4ZI1A 1KV6A 3AUQA 3GYUA 1X7RA 1P8DA 2H77A 3IXPD 2ZASA 2ACLB 1S0XA 2I4JA 5C4OA 1N46A 3N00A 4TUZA 4MG8A 2AO6A 4G1DA 5HYKA 5DXQA 4J24A 1S9QA 3IPQA 2B1VA 4L96A 3FALA 2PIUA 3ET0A 3WWRA 1XB7A 4OK1A 2FVJA 3SP6A 3M7RA 3L3ZA 1Z95A 2OAXA 5DSHA 4OEYA 3VSPA 5KRCA 5KRAA 4QL8A 4IU7A 5AK2A 3A3ZX 5APKA 3VN2A 3E00D 3R2AA 2Q1HA 3L3XA 3ET2A 4MG9B 3WMHA 5KYAA 3TKMA 3K8SA 4RZFA 4JAZA 5CJ6A 2QR9A 3ADUA 1X78A 4REFA 4CI5A 3B3KA 5KRHA 3W0HA 1P93A 1T73A 3E00A 3FUGA 4OEZA 1WM0X 2YATA 2AA7A 2ZK4A 3R8IA 4ZJWA 2HB7A 1T7FA 3VHWA 3E7CA 3WT6A 2VV1B 1X7EA 4MG5A 2FAIA 3KFCA 4ITEA 3D90A 5L11A 2Q59A 4XLDA 4G1ZA 5E0WA 3UUDA 3CS4A 2P15A 2ZKCA 1FM6A 4K7AA 5GT4A 4RZGA 5AAVB 3D57A 4DOSA 1XQCA 2GIUA 3HC5A 3ADVA 3EYBA 3FURA 2OUZA 3AURA 1HG4A 2A3IA 3VT7A 2Q6SA 3PLZA 1PK5A 3OMOA 4ZN7A 3V3EA 1PRGA 5DXBA 3UVVB 1OVLA 2XHSA 3ET3A 3KDTA 1UOMA 2NXXE 3B68A 5GIDA 1U3QA 3KBAA 1T7TA 2JFAA 1FCYA 5E15A 3OLFA 2O9IA 3FC6B 1YOWA 3GBKA 1YMTA 2V7CA 3LMPA 4DMAA 5DL4A 3VRTA 2Q70A 2F4BA 2PIVA 4IUIA 4LTWA 3ZRBA 5B41A 5HJSA 5KRFA 3TX7B 1S19A 2P7ZA 2Z4BA 5LWPA 5E14A 1FM9A 4IA7A 3X31A 2B1ZA 3HVLA 1SJ0A 4OEAA 4WVDA 5E0XA 4RMCA 5KROA 4APUA 4DQMA 3OSIA 4TUZB 2P7AA 4IWFA 1Y0SA 4MG8B 3W0IA 4IS8A 4OJBA 2ZY0A 4ZNSA 1TFCA 3BEJA 4FHIA 2G44A 5C4TA 5DVVA 2QGWA 3FALB 2PIQA 3GN8A 3P89A 2QE4A 1MZNA 1EREA 1K7LA 4RE8A 1U9EA 1YIMA 3AFRA 1ILHA 2I0JA 4ZN9A 4JGVA 4OEDA 5HCVA 4ZJRA 1KNUA 2QZOA 4P6WA 4CSJA 3HM1A 3VTDA 5KCWA 3SP9A 1T5ZA 1Z5XE 3UU7A 3ERTA 3UUAA 3VTBA 4OHAA 3RLLA 1T7RA 3PEQA 2QTUA 2R40D 2IOKA 1NQ1A 2E2RA 3AN3A 3OMPA 4G2IA 4ZOMA 5KD9A 4A4VA 2AXAA 4E4QA 4Y29A 3UUCA 3X1HA 3B0WA 5KRKA 3MNOA 4EM9A 5FQVA 4PP3A 1YP0A 4NY9A 1NAXA 4NQAB 3OLLA 2LBDA 4M8HA 4F9MA 3KYTA 2HCDA 2AMBA 4Q50A 5FQTA 4LSJA 5APHA 3L1BA 1I37A 1YYEA 2AA5A 2G0HA 3B0QA 3AN4A 1PZLA 5DXBB 1OVLB 3OS9A 4IV2A 5G3JA 5JI0D 3ADXA 5GICA 5DUHA 1QKMA 1R20D 1N83A 4OILA 2NPAA 5KCCA 4S15A 1G1UA 5G43A 1ERRA 1EXXA 4REEA 3P8XA 4OIUA 3W0CA 1RKGA 4ZNTA 2HVCA 2ZK6A 3MNPA 5DVSA 2QABA 3RUUA 4IVWA 2AB2A 2W8YA 5JJMB 3W0YA 1R1KD 2HC4A 1RDTA 4X1FA 1FCXA 4QE8A 1RJKA 1I7IA 4MGCA 2V0VA 3CTBA 3RUTA 5L7GA 2ZMHA 3A2IA 1R1KA 1T7MA 4NIEA 4ZNHA 1ZUCA 2ZLCA 3FS1A 2AX6A 3DR1A 3OSWA 1UHLA 3B65A 4OJ9A 4RUOX 3W5PA 1N4HA 2VV4A 4J5XC 2Q7LA 3OGTA 5DY8A 4X1GA 4Q13A 3CS6A 5KRIA 5DIDA 1R5KA 4XUHA 4L98A 5E19A 2Q60A 2ZXZA 3F7DA 4FHHA 5HJPA 1BSXA 5AZTA 5DX3A 2O4RA 2Q5PA 3UUAB 3V9TA 4HLWA 1FCZA 2ZNQA 3AZ1A 3HLVA 3H52A 1OSHA 5EITA 1K4WA 4NUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N1Y A;  3KMZ A;  1L2J A;  5IXK A;  2PIT A;  3ADW A;  3NOA A;  3KMR A;  2AA2 A;  3OMK A;  4O8F A;  5EI1 A;  2OM9 A;  3B67 A;  5KCU A;  2GPO A;  4YT1 A;  5DWI A;  3W0J A;  3CQV A;  5AVI A;  2ZMI A;  4JL4 A;  3V9V A;  4NB6 A;  3W5R A;  5C4U A;  3GZ9 A;  1FM6 D;  5F9B A;  5LGA A;  4ZO1 B;  2AA6 A;  1T65 A;  2HWR A;  2PNU A;  2IHQ A;  4OKB A;  3IMY A;  2H79 A;  4RME A;  4Q0A C;  1G2N A;  3ADS A;  3K6P A;  3O1E A;  4OH6 A;  4S14 A;  5DKE A;  1ILG A;  2ZK3 A;  1M13 A;  2QA6 A;  4EMA A;  5G46 A;  2POG A;  4OZR E;  4QK4 A;  1XV9 B;  1UPV A;  3A2H A;  4K4J A;  5KRM A;  1NYX A;  4RMD A;  5DXG A;  1QKT A;  4OC7 A;  4PP6 A;  3ZRA A;  4E4K A;  4J26 A;  4OLM A;  1ZKY A;  2Q61 A;  5EHJ A;  5B5B A;  5FQR A;  2QXS A;  5DXR A;  1R6G A;  1XDK A;  2QA8 A;  4OKX A;  5DRM A;  4OFU A;  1TXI A;  2FSZ A;  2HAS A;  4OH5 A;  3WJ4 A;  1ZDU A;  1YJE A;  3Q95 A;  2Q5G A;  3WT5 A;  3VJS A;  4N73 A;  5EJV A;  1QKU A;  1FM9 D;  4ZNU A;  2J7X A;  4WHG A;  3W5T A;  3MNE A;  5DZ0 A;  5DZH A;  2VSR A;  1XJ7 A;  3VSO A;  2YJD A;  4ITF A;  4S0T A;  4UDC A;  1XLS E;  4PLE A;  1HJ1 A;  1UHL B;  2AX9 A;  1XZX X;  2VV4 B;  2Z4J A;  2YFE A;  3IPS A;  3P88 A;  1PDU A;  2AYR A;  4FNE A;  4IA1 A;  3G0W A;  4FN9 A;  5DIG A;  1SKX A;  2XYW A;  5AZV A;  1XIU A;  2GPU A;  4IA2 A;  4ONI A;  4ZO1 X;  3KWY A;  4KZJ A;  3W0G A;  3D5F A;  3CWD A;  3DZU A;  2P4Y A;  5DX3 B;  1Z5X U;  3RLJ A;  2ZK2 A;  1DB1 A;  3QT0 A;  3ZR7 A;  5DWJ A;  4OAR A;  2YLO A;  4XUM A;  2OZ7 A;  1YOK A;  3OOF A;  2JF9 A;  2ZNO A;  5SYZ A;  5FQP A;  4A4W A;  5DRJ A;  3JZC A;  1L2I A;  3W5Q A;  3PO9 A;  5KCF A;  4M8E A;  2AX8 A;  1RK3 A;  3H0A D;  1X7J A;  4PXM A;  5KYJ A;  2PIP L;  3ZQT A;  1UPW A;  2OVM A;  4XI3 A;  2GWX A;  2PIR A;  4G20 A;  5DVC A;  2POB A;  3D6D A;  3R5M A;  3T03 A;  4N5G A;  5DV8 A;  1XAP A;  2Q59 B;  3H0A A;  1XP9 A;  1T76 A;  3G8I A;  1OT7 A;  5AYG A;  3UP3 A;  3UUD B;  2PIN A;  3D24 A;  4DOR A;  4KZI A;  3R29 A;  1Y9R A;  2G0G A;  5KCD A;  3CDS A;  4WPF A;  5DKB A;  4B7W A;  4MGB A;  2AX7 A;  1A52 A;  1I38 A;  4MGD A;  5G45 A;  2YLQ A;  1GS4 A;  3VT8 A;  4WLB A;  5DKG A;  1YY4 A;  3DCU A;  3DCT A;  2YJA B;  3OSA A;  2Q7I A;  3CS8 A;  3A9E A;  3ET1 A;  3F5C A;  5DI7 A;  1XNN A;  2QA8 B;  2AAX A;  4OFR A;  5DXM A;  2Q7J A;  2HWQ A;  3OS8 A;  1T63 A;  1PQ9 A;  2QGT A;  3CLD A;  3L03 A;  3Q95 B;  4XHD A;  1NDE A;  1RDT D;  2JFA B;  1FD0 A;  4K6I A;  1EXA A;  5EGV A;  3IPU A;  4G2H A;  5DUE A;  4DM6 A;  1PQ6 A;  5A86 A;  4KZM A;  3V49 A;  3R8D A;  3U9Q A;  2P54 A;  4J5X A;  4OGH A;  3FEI A;  2IOG A;  2ZL9 A;  3OS8 C;  5DV3 A;  2ZXN A;  1X7B A;  2ABI A;  3E94 A;  4PP5 A;  2NW4 A;  3G8O A;  4IWC A;  2ZNP A;  4OKW A;  1ZAF A;  4TV1 A;  1E3K A;  5DZ1 A;  2B23 A;  2QPY A;  2Q6J A;  2AMA A;  2I0G A;  2GTK A;  4POJ A;  4UDD A;  1MV9 A;  3X1I A;  3CJW A;  5DMF A;  3O1D A;  5ACC A;  4OZT E;  1ZEO A;  2VV0 A;  4PPS A;  1NQ7 A;  4LNX A;  3UVV A;  2GP7 A;  2QNV A;  3OZJ A;  4PVU A;  2QZO B;  2VST A;  4QJR A;  2BJ4 A;  3TKC A;  3VJT A;  4QE6 A;  5KR9 A;  5DXK A;  4MGA A;  3L0J A;  1NHZ A;  5G5W A;  3UU7 B;  1XVP A;  3FC6 A;  2P7G A;  1T74 A;  2Q8S A;  3B0T A;  1XOW A;  3VI8 A;  2YLY A;  3TY0 A;  4XTA A;  2BAW A;  4OJ4 A;  4RUP A;  4XAO A;  3VHV A;  1NQ2 A;  2YHD A;  5IZ0 A;  3WJ5 A;  1MVC A;  1KKQ A;  1NQ0 A;  1DKF A;  4R06 A;  5DMC A;  1XQ3 A;  2ZK5 A;  2I4P A;  5L7E A;  2J7Y A;  1G5Y A;  5DV6 A;  3KDU A;  5DTV A;  1XNX A;  1E3G A;  2EWP A;  4YNK A;  5DWL A;  5C4S A;  4CI4 A;  4YPQ A;  5E7V A;  5FQS A;  5IAW A;  5DYD A;  3S9S A;  1GWQ A;  1A28 A;  1G50 A;  5APJ A;  2GL8 A;  2P1U A;  3B1M A;  3JZB A;  3AZ3 A;  5K13 A;  3IXP A;  3VHU A;  3ILZ A;  2VV3 A;  4OZR U;  4MGB B;  1NUO A;  1H9U A;  3FXV A;  4MGD B;  1I7G A;  5AWJ A;  3HZF A;  4DM8 A;  2ZNN A;  3PRG A;  4G21 A;  4PLD A;  3A78 A;  1YA3 A;  2HAM A;  3R5N A;  4RUJ A;  4IQR A;  3B66 A;  3A9E B;  4UDB A;  3F5C B;  5G44 A;  4RZE A;  4N8R A;  3B5R A;  4IA3 A;  3B0R A;  3KPZ A;  5JY3 A;  1M7W A;  5L7H A;  3VRW A;  3VRV A;  2QMV A;  2ZK1 A;  5DYB A;  3A40 X;  2HBH A;  3DY6 A;  4IVY A;  2Q6R A;  2QH6 A;  2QXM A;  2JJ3 A;  2AWH A;  3VT6 A;  2ZVT A;  2ZLA A;  3V4A A;  3L0E A;  2G5O A;  2ATH A;  3IA6 A;  1FBY A;  5DUG A;  3ERD A;  3V9Y A;  3L0L A;  3AZ2 A;  2GPP A;  3HO0 A;  2XYX A;  3LBD A;  2R6Y A;  4QM0 A;  5HYR A;  3UP0 A;  1T79 A;  3HQ5 A;  5DZI A;  2R6W A;  1VJB A;  4TV1 B;  4DK7 A;  4OKT A;  3DZU D;  3VJH A;  2ZFX A;  2HFP A;  1SR7 A;  3VJI A;  4IV4 A;  2ZBS A;  3OKH A;  4MG7 A;  1U3R A;  5GIE A;  2Q5S A;  3PBA A;  2BJ4 B;  1X76 A;  3AX8 A;  1S0Z A;  2XKW A;  3K23 A;  5HJP B;  3OMQ A;  4MGA B;  1OSV A;  3OKI A;  2O4J A;  3KMG A;  1XVP B;  4R2U A;  3V3Q A;  2VV2 A;  3BC5 A;  3OAP A;  3NSQ A;  2J4A A;  2Q1V A;  5DIE A;  3AUN A;  2PKL A;  5DWG A;  3WFG A;  4J5W A;  5JJM A;  3OLS A;  3HC6 A;  2PIW A;  3RVF A;  1K74 D;  4IW8 A;  4ZNW A;  1DKF B;  5E1C A;  1YIN A;  3A2J A;  3CDP A;  2YLP A;  3GWS X;  4R6S A;  1SQN A;  2GPV A;  5DWE A;  1U3S A;  1RKH A;  4JYG A;  4LNW A;  2HAR A;  5DKS A;  1GWR A;  2ZXM A;  3GWX A;  2QW4 A;  3NSP A;  2P1T A;  1XP6 A;  5AAU A;  3VT3 A;  1K74 A;  5M96 A;  4J5W C;  4G1Y A;  4MDD A;  2Q3Y A;  2OCF A;  3X36 A;  4FGY A;  4HEE X;  1QKN A;  4PF3 A;  2J14 A;  2ACL A;  2Q7K A;  3FEJ A;  4RWV A;  3VT5 A;  4IW6 A;  3P0U A;  3VRU A;  5HZC A;  4UDA A;  2ZMJ A;  2PJL A;  1IE9 A;  3DZY D;  2XYJ A;  3K22 A;  5KRJ A;  1XPC A;  3WFF A;  4E2J A;  3W0A A;  3OOK A;  1M2Z A;  2NV7 A;  1PQC A;  2AM9 A;  4ZNV A;  2REW A;  3SZ1 A;  2PIO A;  2NXX A;  1NAV A;  4XT9 A;  5DK9 A;  3DZY A;  3BQD A;  3FLI A;  3VT9 A;  2OVH A;  1XDK B;  5DXP A;  5KCT A;  3WTQ A;  4WHF A;  4MG9 A;  3ADT A;  4YMQ A;  4BCR A;  4JYH A;  5H1E A;  2R40 A;  2PRG A;  4PPP A;  3RY9 A;  1XLS A;  2HB8 A;  2QSE A;  4PWL A;  3VT4 A;  5ETH A;  2B50 A;  4A2J A;  2VV1 A;  3GD2 A;  4OIV A;  4LBD A;  4WQP A;  1S9P A;  5KCE A;  5I4V A;  4OZT U;  3HOD A;  5DLR A;  1NRL A;  3OZ0 A;  4DK8 A;  4MG7 B;  3R8A A;  3VTC A;  1LBD A;  5AAV A;  1Q4X A;  3GYT A;  2ZK0 A;  3DT3 A;  1IE8 A;  4JYI A;  5DP0 A;  1XV9 A;  1ZGY A;  3WGP A;  4PRG A;  5AWK A;  5AVL A;  1ZH7 A;  5DZ3 A;  4POH A;  5DXE A;  2PIX A;  1LV2 A;  1R20 A;  3PCU A;  4S0S A;  5ICK A;  3OMM A;  1Y0X X;  1GWX A;  1PCG A;  5KRL A;  4MG6 A;  2P1V A;  3WT7 A;  1ZDT A;  5EC9 A;  4RFW A;  5DU5 A;  1XP1 A;  3G9E A;  5G42 A;  4P6X A;  2I4Z A;  1YUC A;  4RAK A;  4ZI1 A;  1KV6 A;  3AUQ A;  3GYU A;  1X7R A;  1P8D A;  2H77 A;  3IXP D;  2ZAS A;  2ACL B;  1S0X A;  2I4J A;  5C4O A;  1N46 A;  3N00 A;  4TUZ A;  4MG8 A;  2AO6 A;  4G1D A;  5HYK A;  5DXQ A;  4J24 A;  1S9Q A;  3IPQ A;  2B1V A;  4L96 A;  3FAL A;  2PIU A;  3ET0 A;  3WWR A;  1XB7 A;  4OK1 A;  2FVJ A;  3SP6 A;  3M7R A;  3L3Z A;  1Z95 A;  2OAX A;  5DSH A;  4OEY A;  3VSP A;  5KRC A;  5KRA A;  4QL8 A;  4IU7 A;  5AK2 A;  3A3Z X;  5APK A;  3VN2 A;  3E00 D;  3R2A A;  2Q1H A;  3L3X A;  3ET2 A;  4MG9 B;  3WMH A;  5KYA A;  3TKM A;  3K8S A;  4RZF A;  4JAZ A;  5CJ6 A;  2QR9 A;  3ADU A;  1X78 A;  4REF A;  4CI5 A;  3B3K A;  5KRH A;  3W0H A;  1P93 A;  1T73 A;  3E00 A;  3FUG A;  4OEZ A;  1WM0 X;  2YAT A;  2AA7 A;  2ZK4 A;  3R8I A;  4ZJW A;  2HB7 A;  1T7F A;  3VHW A;  3E7C A;  3WT6 A;  2VV1 B;  1X7E A;  4MG5 A;  2FAI A;  3KFC A;  4ITE A;  3D90 A;  5L11 A;  2Q59 A;  4XLD A;  4G1Z A;  5E0W A;  3UUD A;  3CS4 A;  2P15 A;  2ZKC A;  1FM6 A;  4K7A A;  5GT4 A;  4RZG A;  5AAV B;  3D57 A;  4DOS A;  1XQC A;  2GIU A;  3HC5 A;  3ADV A;  3EYB A;  3FUR A;  2OUZ A;  3AUR A;  1HG4 A;  2A3I A;  3VT7 A;  2Q6S A;  3PLZ A;  1PK5 A;  3OMO A;  4ZN7 A;  3V3E A;  1PRG A;  5DXB A;  3UVV B;  1OVL A;  2XHS A;  3ET3 A;  3KDT A;  1UOM A;  2NXX E;  3B68 A;  5GID A;  1U3Q A;  3KBA A;  1T7T A;  2JFA A;  1FCY A;  5E15 A;  3OLF A;  2O9I A;  3FC6 B;  1YOW A;  3GBK A;  1YMT A;  2V7C A;  3LMP A;  4DMA A;  5DL4 A;  3VRT A;  2Q70 A;  2F4B A;  2PIV A;  4IUI A;  4LTW A;  3ZRB A;  5B41 A;  5HJS A;  5KRF A;  3TX7 B;  1S19 A;  2P7Z A;  2Z4B A;  5LWP A;  5E14 A;  1FM9 A;  4IA7 A;  3X31 A;  2B1Z A;  3HVL A;  1SJ0 A;  4OEA A;  4WVD A;  5E0X A;  4RMC A;  5KRO A;  4APU A;  4DQM A;  3OSI A;  4TUZ B;  2P7A A;  4IWF A;  1Y0S A;  4MG8 B;  3W0I A;  4IS8 A;  4OJB A;  2ZY0 A;  4ZNS A;  1TFC A;  3BEJ A;  4FHI A;  2G44 A;  5C4T A;  5DVV A;  2QGW A;  3FAL B;  2PIQ A;  3GN8 A;  3P89 A;  2QE4 A;  1MZN A;  1ERE A;  1K7L A;  4RE8 A;  1U9E A;  1YIM A;  3AFR A;  1ILH A;  2I0J A;  4ZN9 A;  4JGV A;  4OED A;  5HCV A;  4ZJR A;  1KNU A;  2QZO A;  4P6W A;  4CSJ A;  3HM1 A;  3VTD A;  5KCW A;  3SP9 A;  1T5Z A;  1Z5X E;  3UU7 A;  3ERT A;  3UUA A;  3VTB A;  4OHA A;  3RLL A;  1T7R A;  3PEQ A;  2QTU A;  2R40 D;  2IOK A;  1NQ1 A;  2E2R A;  3AN3 A;  3OMP A;  4G2I A;  4ZOM A;  5KD9 A;  4A4V A;  2AXA A;  4E4Q A;  4Y29 A;  3UUC A;  3X1H A;  3B0W A;  5KRK A;  3MNO A;  4EM9 A;  5FQV A;  4PP3 A;  1YP0 A;  4NY9 A;  1NAX A;  4NQA B;  3OLL A;  2LBD A;  4M8H A;  4F9M A;  3KYT A;  2HCD A;  2AMB A;  4Q50 A;  5FQT A;  4LSJ A;  5APH A;  3L1B A;  1I37 A;  1YYE A;  2AA5 A;  2G0H A;  3B0Q A;  3AN4 A;  1PZL A;  5DXB B;  1OVL B;  3OS9 A;  4IV2 A;  5G3J A;  5JI0 D;  3ADX A;  5GIC A;  5DUH A;  1QKM A;  1R20 D;  1N83 A;  4OIL A;  2NPA A;  5KCC A;  4S15 A;  1G1U A;  5G43 A;  1ERR A;  1EXX A;  4REE A;  3P8X A;  4OIU A;  3W0C A;  1RKG A;  4ZNT A;  2HVC A;  2ZK6 A;  3MNP A;  5DVS A;  2QAB A;  3RUU A;  4IVW A;  2AB2 A;  2W8Y A;  5JJM B;  3W0Y A;  1R1K D;  2HC4 A;  1RDT A;  4X1F A;  1FCX A;  4QE8 A;  1RJK A;  1I7I A;  4MGC A;  2V0V A;  3CTB A;  3RUT A;  5L7G A;  2ZMH A;  3A2I A;  1R1K A;  1T7M A;  4NIE A;  4ZNH A;  1ZUC A;  2ZLC A;  3FS1 A;  2AX6 A;  3DR1 A;  3OSW A;  1UHL A;  3B65 A;  4OJ9 A;  4RUO X;  3W5P A;  1N4H A;  2VV4 A;  4J5X C;  2Q7L A;  3OGT A;  5DY8 A;  4X1G A;  4Q13 A;  3CS6 A;  5KRI A;  5DID A;  1R5K A;  4XUH A;  4L98 A;  5E19 A;  2Q60 A;  2ZXZ A;  3F7D A;  4FHH A;  5HJP A;  1BSX A;  5AZT A;  5DX3 A;  2O4R A;  2Q5P A;  3UUA B;  3V9T A;  4HLW A;  1FCZ A;  2ZNQ A;  3AZ1 A;  3HLV A;  3H52 A;  1OSH A;  5EIT A;  1K4W A;  4NUF A; 
#chains in the Genus database with same CATH topology
 4N1Y A;  3KMZ A;  1L2J A;  5IXK A;  2PIT A;  3ADW A;  3NOA A;  3KMR A;  2AA2 A;  3OMK A;  4O8F A;  5EI1 A;  2OM9 A;  3B67 A;  5KCU A;  2GPO A;  4YT1 A;  5DWI A;  3W0J A;  3CQV A;  5AVI A;  2ZMI A;  4JL4 A;  3V9V A;  4NB6 A;  3W5R A;  5C4U A;  3GZ9 A;  1FM6 D;  5F9B A;  5LGA A;  4ZO1 B;  2AA6 A;  1T65 A;  2HWR A;  2PNU A;  2IHQ A;  4OKB A;  3IMY A;  2H79 A;  4RME A;  4Q0A C;  1G2N A;  3ADS A;  3K6P A;  3O1E A;  4OH6 A;  4S14 A;  5DKE A;  1ILG A;  2ZK3 A;  1M13 A;  2QA6 A;  4EMA A;  5G46 A;  2POG A;  4OZR E;  4QK4 A;  1XV9 B;  1UPV A;  3A2H A;  4K4J A;  5KRM A;  1NYX A;  4RMD A;  5DXG A;  1QKT A;  4OC7 A;  4PP6 A;  3ZRA A;  4E4K A;  4J26 A;  4OLM A;  1ZKY A;  2Q61 A;  5EHJ A;  5B5B A;  5FQR A;  2QXS A;  5DXR A;  1R6G A;  1XDK A;  2QA8 A;  4OKX A;  5DRM A;  4OFU A;  1TXI A;  2FSZ A;  2HAS A;  4OH5 A;  3WJ4 A;  1ZDU A;  1YJE A;  3Q95 A;  2Q5G A;  3WT5 A;  3VJS A;  4N73 A;  5EJV A;  1QKU A;  1FM9 D;  4ZNU A;  2J7X A;  4WHG A;  3W5T A;  3MNE A;  5DZ0 A;  5DZH A;  2VSR A;  1XJ7 A;  3VSO A;  2YJD A;  4ITF A;  4S0T A;  4UDC A;  1XLS E;  4PLE A;  1HJ1 A;  1UHL B;  2AX9 A;  1XZX X;  2VV4 B;  2Z4J A;  2YFE A;  3IPS A;  3P88 A;  1PDU A;  2AYR A;  4FNE A;  4IA1 A;  3G0W A;  4FN9 A;  5DIG A;  1SKX A;  2XYW A;  5AZV A;  1XIU A;  2GPU A;  4IA2 A;  4ONI A;  4ZO1 X;  3KWY A;  4KZJ A;  3W0G A;  3D5F A;  3CWD A;  3DZU A;  2P4Y A;  5DX3 B;  1Z5X U;  3RLJ A;  2ZK2 A;  1DB1 A;  3QT0 A;  3ZR7 A;  5DWJ A;  4OAR A;  2YLO A;  4XUM A;  2OZ7 A;  1YOK A;  3OOF A;  2JF9 A;  2ZNO A;  5SYZ A;  5FQP A;  4A4W A;  5DRJ A;  3JZC A;  1L2I A;  3W5Q A;  3PO9 A;  5KCF A;  4M8E A;  2AX8 A;  1RK3 A;  3H0A D;  1X7J A;  4PXM A;  5KYJ A;  2PIP L;  3ZQT A;  1UPW A;  2OVM A;  4XI3 A;  2GWX A;  2PIR A;  4G20 A;  5DVC A;  2POB A;  3D6D A;  3R5M A;  3T03 A;  4N5G A;  5DV8 A;  1XAP A;  2Q59 B;  3H0A A;  1XP9 A;  1T76 A;  3G8I A;  1OT7 A;  5AYG A;  3UP3 A;  3UUD B;  2PIN A;  3D24 A;  4DOR A;  4KZI A;  3R29 A;  1Y9R A;  2G0G A;  5KCD A;  3CDS A;  4WPF A;  5DKB A;  4B7W A;  4MGB A;  2AX7 A;  1A52 A;  1I38 A;  4MGD A;  5G45 A;  2YLQ A;  1GS4 A;  3VT8 A;  4WLB A;  5DKG A;  1YY4 A;  3DCU A;  3DCT A;  2YJA B;  3OSA A;  2Q7I A;  3CS8 A;  3A9E A;  3ET1 A;  3F5C A;  5DI7 A;  1XNN A;  2QA8 B;  2AAX A;  4OFR A;  5DXM A;  2Q7J A;  2HWQ A;  3OS8 A;  1T63 A;  1PQ9 A;  2QGT A;  3CLD A;  3L03 A;  3Q95 B;  4XHD A;  1NDE A;  1RDT D;  2JFA B;  1FD0 A;  4K6I A;  1EXA A;  5EGV A;  3IPU A;  4G2H A;  5DUE A;  4DM6 A;  1PQ6 A;  5A86 A;  4KZM A;  3V49 A;  3R8D A;  3U9Q A;  2P54 A;  4J5X A;  4OGH A;  3FEI A;  2IOG A;  2ZL9 A;  3OS8 C;  5DV3 A;  2ZXN A;  1X7B A;  2ABI A;  3E94 A;  4PP5 A;  2NW4 A;  3G8O A;  4IWC A;  2ZNP A;  4OKW A;  1ZAF A;  4TV1 A;  1E3K A;  5DZ1 A;  2B23 A;  2QPY A;  2Q6J A;  2AMA A;  2I0G A;  2GTK A;  4POJ A;  4UDD A;  1MV9 A;  3X1I A;  3CJW A;  5DMF A;  3O1D A;  5ACC A;  4OZT E;  1ZEO A;  2VV0 A;  4PPS A;  1NQ7 A;  4LNX A;  3UVV A;  2GP7 A;  2QNV A;  3OZJ A;  4PVU A;  2QZO B;  2VST A;  4QJR A;  2BJ4 A;  3TKC A;  3VJT A;  4QE6 A;  5KR9 A;  5DXK A;  4MGA A;  3L0J A;  1NHZ A;  5G5W A;  3UU7 B;  1XVP A;  3FC6 A;  2P7G A;  1T74 A;  2Q8S A;  3B0T A;  1XOW A;  3VI8 A;  2YLY A;  3TY0 A;  4XTA A;  2BAW A;  4OJ4 A;  4RUP A;  4XAO A;  3VHV A;  1NQ2 A;  2YHD A;  5IZ0 A;  3WJ5 A;  1MVC A;  1KKQ A;  1NQ0 A;  1DKF A;  4R06 A;  5DMC A;  1XQ3 A;  2ZK5 A;  2I4P A;  5L7E A;  2J7Y A;  1G5Y A;  5DV6 A;  3KDU A;  5DTV A;  1XNX A;  1E3G A;  2EWP A;  4YNK A;  5DWL A;  5C4S A;  4CI4 A;  4YPQ A;  5E7V A;  5FQS A;  5IAW A;  5DYD A;  3S9S A;  1GWQ A;  1A28 A;  1G50 A;  5APJ A;  2GL8 A;  2P1U A;  3B1M A;  3JZB A;  3AZ3 A;  5K13 A;  3IXP A;  3VHU A;  3ILZ A;  2VV3 A;  4OZR U;  4MGB B;  1NUO A;  1H9U A;  3FXV A;  4MGD B;  1I7G A;  5AWJ A;  3HZF A;  4DM8 A;  2ZNN A;  3PRG A;  4G21 A;  4PLD A;  3A78 A;  1YA3 A;  2HAM A;  3R5N A;  4RUJ A;  4IQR A;  3B66 A;  3A9E B;  4UDB A;  3F5C B;  5G44 A;  4RZE A;  4N8R A;  3B5R A;  4IA3 A;  3B0R A;  3KPZ A;  5JY3 A;  1M7W A;  5L7H A;  3VRW A;  3VRV A;  2QMV A;  2ZK1 A;  5DYB A;  3A40 X;  2HBH A;  3DY6 A;  4IVY A;  2Q6R A;  2QH6 A;  2QXM A;  2JJ3 A;  2AWH A;  3VT6 A;  2ZVT A;  2ZLA A;  3V4A A;  3L0E A;  2G5O A;  2ATH A;  3IA6 A;  1FBY A;  5DUG A;  3ERD A;  3V9Y A;  3L0L A;  3AZ2 A;  2GPP A;  3HO0 A;  2XYX A;  3LBD A;  2R6Y A;  4QM0 A;  5HYR A;  3UP0 A;  1T79 A;  3HQ5 A;  5DZI A;  2R6W A;  1VJB A;  4TV1 B;  4DK7 A;  4OKT A;  3DZU D;  3VJH A;  2ZFX A;  2HFP A;  1SR7 A;  3VJI A;  4IV4 A;  2ZBS A;  3OKH A;  4MG7 A;  1U3R A;  5GIE A;  2Q5S A;  3PBA A;  2BJ4 B;  1X76 A;  3AX8 A;  1S0Z A;  2XKW A;  3K23 A;  5HJP B;  3OMQ A;  4MGA B;  1OSV A;  3OKI A;  2O4J A;  3KMG A;  1XVP B;  4R2U A;  3V3Q A;  2VV2 A;  3BC5 A;  3OAP A;  3NSQ A;  2J4A A;  2Q1V A;  5DIE A;  3AUN A;  2PKL A;  5DWG A;  3WFG A;  4J5W A;  5JJM A;  3OLS A;  3HC6 A;  2PIW A;  3RVF A;  1K74 D;  4IW8 A;  4ZNW A;  1DKF B;  5E1C A;  1YIN A;  3A2J A;  3CDP A;  2YLP A;  3GWS X;  4R6S A;  1SQN A;  2GPV A;  5DWE A;  1U3S A;  1RKH A;  4JYG A;  4LNW A;  2HAR A;  5DKS A;  1GWR A;  2ZXM A;  3GWX A;  2QW4 A;  3NSP A;  2P1T A;  1XP6 A;  5AAU A;  3VT3 A;  1K74 A;  5M96 A;  4J5W C;  4G1Y A;  4MDD A;  2Q3Y A;  2OCF A;  3X36 A;  4FGY A;  4HEE X;  1QKN A;  4PF3 A;  2J14 A;  2ACL A;  2Q7K A;  3FEJ A;  4RWV A;  3VT5 A;  4IW6 A;  3P0U A;  3VRU A;  5HZC A;  4UDA A;  2ZMJ A;  2PJL A;  1IE9 A;  3DZY D;  2XYJ A;  3K22 A;  5KRJ A;  1XPC A;  3WFF A;  4E2J A;  3W0A A;  3OOK A;  1M2Z A;  2NV7 A;  1PQC A;  2AM9 A;  4ZNV A;  2REW A;  3SZ1 A;  2PIO A;  2NXX A;  1NAV A;  4XT9 A;  5DK9 A;  3DZY A;  3BQD A;  3FLI A;  3VT9 A;  2OVH A;  1XDK B;  5DXP A;  5KCT A;  3WTQ A;  4WHF A;  4MG9 A;  3ADT A;  4YMQ A;  4BCR A;  4JYH A;  5H1E A;  2R40 A;  2PRG A;  4PPP A;  3RY9 A;  1XLS A;  2HB8 A;  2QSE A;  4PWL A;  3VT4 A;  5ETH A;  2B50 A;  4A2J A;  2VV1 A;  3GD2 A;  4OIV A;  4LBD A;  4WQP A;  1S9P A;  5KCE A;  5I4V A;  4OZT U;  3HOD A;  5DLR A;  1NRL A;  3OZ0 A;  4DK8 A;  4MG7 B;  3R8A A;  3VTC A;  1LBD A;  5AAV A;  1Q4X A;  3GYT A;  2ZK0 A;  3DT3 A;  1IE8 A;  4JYI A;  5DP0 A;  1XV9 A;  1ZGY A;  3WGP A;  4PRG A;  5AWK A;  5AVL A;  1ZH7 A;  5DZ3 A;  4POH A;  5DXE A;  2PIX A;  1LV2 A;  1R20 A;  3PCU A;  4S0S A;  5ICK A;  3OMM A;  1Y0X X;  1GWX A;  1PCG A;  5KRL A;  4MG6 A;  2P1V A;  3WT7 A;  1ZDT A;  5EC9 A;  4RFW A;  5DU5 A;  1XP1 A;  3G9E A;  5G42 A;  4P6X A;  2I4Z A;  1YUC A;  4RAK A;  4ZI1 A;  1KV6 A;  3AUQ A;  3GYU A;  1X7R A;  1P8D A;  2H77 A;  3IXP D;  2ZAS A;  2ACL B;  1S0X A;  2I4J A;  5C4O A;  1N46 A;  3N00 A;  4TUZ A;  4MG8 A;  2AO6 A;  4G1D A;  5HYK A;  5DXQ A;  4J24 A;  1S9Q A;  3IPQ A;  2B1V A;  4L96 A;  3FAL A;  2PIU A;  3ET0 A;  3WWR A;  1XB7 A;  4OK1 A;  2FVJ A;  3SP6 A;  3M7R A;  3L3Z A;  1Z95 A;  2OAX A;  5DSH A;  4OEY A;  3VSP A;  5KRC A;  5KRA A;  4QL8 A;  4IU7 A;  5AK2 A;  3A3Z X;  5APK A;  3VN2 A;  3E00 D;  3R2A A;  2Q1H A;  3L3X A;  3ET2 A;  4MG9 B;  3WMH A;  5KYA A;  3TKM A;  3K8S A;  4RZF A;  4JAZ A;  5CJ6 A;  2QR9 A;  3ADU A;  1X78 A;  4REF A;  4CI5 A;  3B3K A;  5KRH A;  3W0H A;  1P93 A;  1T73 A;  3E00 A;  3FUG A;  4OEZ A;  1WM0 X;  2YAT A;  2AA7 A;  2ZK4 A;  3R8I A;  4ZJW A;  2HB7 A;  1T7F A;  3VHW A;  3E7C A;  3WT6 A;  2VV1 B;  1X7E A;  4MG5 A;  2FAI A;  3KFC A;  4ITE A;  3D90 A;  5L11 A;  2Q59 A;  4XLD A;  4G1Z A;  5E0W A;  3UUD A;  3CS4 A;  2P15 A;  2ZKC A;  1FM6 A;  4K7A A;  5GT4 A;  4RZG A;  5AAV B;  3D57 A;  4DOS A;  1XQC A;  2GIU A;  3HC5 A;  3ADV A;  3EYB A;  3FUR A;  2OUZ A;  3AUR A;  1HG4 A;  2A3I A;  3VT7 A;  2Q6S A;  3PLZ A;  1PK5 A;  3OMO A;  4ZN7 A;  3V3E A;  1PRG A;  5DXB A;  3UVV B;  1OVL A;  2XHS A;  3ET3 A;  3KDT A;  1UOM A;  2NXX E;  3B68 A;  5GID A;  1U3Q A;  3KBA A;  1T7T A;  2JFA A;  1FCY A;  5E15 A;  3OLF A;  2O9I A;  3FC6 B;  1YOW A;  3GBK A;  1YMT A;  2V7C A;  3LMP A;  4DMA A;  5DL4 A;  3VRT A;  2Q70 A;  2F4B A;  2PIV A;  4IUI A;  4LTW A;  3ZRB A;  5B41 A;  5HJS A;  5KRF A;  3TX7 B;  1S19 A;  2P7Z A;  2Z4B A;  5LWP A;  5E14 A;  1FM9 A;  4IA7 A;  3X31 A;  2B1Z A;  3HVL A;  1SJ0 A;  4OEA A;  4WVD A;  5E0X A;  4RMC A;  5KRO A;  4APU A;  4DQM A;  3OSI A;  4TUZ B;  2P7A A;  4IWF A;  1Y0S A;  4MG8 B;  3W0I A;  4IS8 A;  4OJB A;  2ZY0 A;  4ZNS A;  1TFC A;  3BEJ A;  4FHI A;  2G44 A;  5C4T A;  5DVV A;  2QGW A;  3FAL B;  2PIQ A;  3GN8 A;  3P89 A;  2QE4 A;  1MZN A;  1ERE A;  1K7L A;  4RE8 A;  1U9E A;  1YIM A;  3AFR A;  1ILH A;  2I0J A;  4ZN9 A;  4JGV A;  4OED A;  5HCV A;  4ZJR A;  1KNU A;  2QZO A;  4P6W A;  4CSJ A;  3HM1 A;  3VTD A;  5KCW A;  3SP9 A;  1T5Z A;  1Z5X E;  3UU7 A;  3ERT A;  3UUA A;  3VTB A;  4OHA A;  3RLL A;  1T7R A;  3PEQ A;  2QTU A;  2R40 D;  2IOK A;  1NQ1 A;  2E2R A;  3AN3 A;  3OMP A;  4G2I A;  4ZOM A;  5KD9 A;  4A4V A;  2AXA A;  4E4Q A;  4Y29 A;  3UUC A;  3X1H A;  3B0W A;  5KRK A;  3MNO A;  4EM9 A;  5FQV A;  4PP3 A;  1YP0 A;  4NY9 A;  1NAX A;  4NQA B;  3OLL A;  2LBD A;  4M8H A;  4F9M A;  3KYT A;  2HCD A;  2AMB A;  4Q50 A;  5FQT A;  4LSJ A;  5APH A;  3L1B A;  1I37 A;  1YYE A;  2AA5 A;  2G0H A;  3B0Q A;  3AN4 A;  1PZL A;  5DXB B;  1OVL B;  3OS9 A;  4IV2 A;  5G3J A;  5JI0 D;  3ADX A;  5GIC A;  5DUH A;  1QKM A;  1R20 D;  1N83 A;  4OIL A;  2NPA A;  5KCC A;  4S15 A;  1G1U A;  5G43 A;  1ERR A;  1EXX A;  4REE A;  3P8X A;  4OIU A;  3W0C A;  1RKG A;  4ZNT A;  2HVC A;  2ZK6 A;  3MNP A;  5DVS A;  2QAB A;  3RUU A;  4IVW A;  2AB2 A;  2W8Y A;  5JJM B;  3W0Y A;  1R1K D;  2HC4 A;  1RDT A;  4X1F A;  1FCX A;  4QE8 A;  1RJK A;  1I7I A;  4MGC A;  2V0V A;  3CTB A;  3RUT A;  5L7G A;  2ZMH A;  3A2I A;  1R1K A;  1T7M A;  4NIE A;  4ZNH A;  1ZUC A;  2ZLC A;  3FS1 A;  2AX6 A;  3DR1 A;  3OSW A;  1UHL A;  3B65 A;  4OJ9 A;  4RUO X;  3W5P A;  1N4H A;  2VV4 A;  4J5X C;  2Q7L A;  3OGT A;  5DY8 A;  4X1G A;  4Q13 A;  3CS6 A;  5KRI A;  5DID A;  1R5K A;  4XUH A;  4L98 A;  5E19 A;  2Q60 A;  2ZXZ A;  3F7D A;  4FHH A;  5HJP A;  1BSX A;  5AZT A;  5DX3 A;  2O4R A;  2Q5P A;  3UUA B;  3V9T A;  4HLW A;  1FCZ A;  2ZNQ A;  3AZ1 A;  3HLV A;  3H52 A;  1OSH A;  5EIT A;  1K4W A;  4NUF A; 
#chains in the Genus database with same CATH homology
 4N1Y A;  3KMZ A;  1L2J A;  5IXK A;  2PIT A;  3ADW A;  3NOA A;  3KMR A;  2AA2 A;  3OMK A;  4O8F A;  5EI1 A;  2OM9 A;  3B67 A;  5KCU A;  2GPO A;  4YT1 A;  5DWI A;  3W0J A;  3CQV A;  5AVI A;  2ZMI A;  4JL4 A;  3V9V A;  4NB6 A;  3W5R A;  5C4U A;  3GZ9 A;  1FM6 D;  5F9B A;  5LGA A;  4ZO1 B;  2AA6 A;  1T65 A;  2HWR A;  2PNU A;  2IHQ A;  4OKB A;  3IMY A;  2H79 A;  4RME A;  4Q0A C;  1G2N A;  3ADS A;  3K6P A;  3O1E A;  4OH6 A;  4S14 A;  5DKE A;  1ILG A;  2ZK3 A;  1M13 A;  2QA6 A;  4EMA A;  5G46 A;  2POG A;  4OZR E;  4QK4 A;  1XV9 B;  1UPV A;  3A2H A;  4K4J A;  5KRM A;  1NYX A;  4RMD A;  5DXG A;  1QKT A;  4OC7 A;  4PP6 A;  3ZRA A;  4E4K A;  4J26 A;  4OLM A;  1ZKY A;  2Q61 A;  5EHJ A;  5B5B A;  5FQR A;  2QXS A;  5DXR A;  1R6G A;  1XDK A;  2QA8 A;  4OKX A;  5DRM A;  4OFU A;  1TXI A;  2FSZ A;  2HAS A;  4OH5 A;  3WJ4 A;  1ZDU A;  1YJE A;  3Q95 A;  2Q5G A;  3WT5 A;  3VJS A;  4N73 A;  5EJV A;  1QKU A;  1FM9 D;  4ZNU A;  2J7X A;  4WHG A;  3W5T A;  3MNE A;  5DZ0 A;  5DZH A;  2VSR A;  1XJ7 A;  3VSO A;  2YJD A;  4ITF A;  4S0T A;  4UDC A;  1XLS E;  4PLE A;  1HJ1 A;  1UHL B;  2AX9 A;  1XZX X;  2VV4 B;  2Z4J A;  2YFE A;  3IPS A;  3P88 A;  1PDU A;  2AYR A;  4FNE A;  4IA1 A;  3G0W A;  4FN9 A;  5DIG A;  1SKX A;  2XYW A;  5AZV A;  1XIU A;  2GPU A;  4IA2 A;  4ONI A;  4ZO1 X;  3KWY A;  4KZJ A;  3W0G A;  3D5F A;  3CWD A;  3DZU A;  2P4Y A;  5DX3 B;  1Z5X U;  3RLJ A;  2ZK2 A;  1DB1 A;  3QT0 A;  3ZR7 A;  5DWJ A;  4OAR A;  2YLO A;  4XUM A;  2OZ7 A;  1YOK A;  3OOF A;  2JF9 A;  2ZNO A;  5SYZ A;  5FQP A;  4A4W A;  5DRJ A;  3JZC A;  1L2I A;  3W5Q A;  3PO9 A;  5KCF A;  4M8E A;  2AX8 A;  1RK3 A;  3H0A D;  1X7J A;  4PXM A;  5KYJ A;  2PIP L;  3ZQT A;  1UPW A;  2OVM A;  4XI3 A;  2GWX A;  2PIR A;  4G20 A;  5DVC A;  2POB A;  3D6D A;  3R5M A;  3T03 A;  4N5G A;  5DV8 A;  1XAP A;  2Q59 B;  3H0A A;  1XP9 A;  1T76 A;  3G8I A;  1OT7 A;  5AYG A;  3UP3 A;  3UUD B;  2PIN A;  3D24 A;  4DOR A;  4KZI A;  3R29 A;  1Y9R A;  2G0G A;  5KCD A;  3CDS A;  4WPF A;  5DKB A;  4B7W A;  4MGB A;  2AX7 A;  1A52 A;  1I38 A;  4MGD A;  5G45 A;  2YLQ A;  1GS4 A;  3VT8 A;  4WLB A;  5DKG A;  1YY4 A;  3DCU A;  3DCT A;  2YJA B;  3OSA A;  2Q7I A;  3CS8 A;  3A9E A;  3ET1 A;  3F5C A;  5DI7 A;  1XNN A;  2QA8 B;  2AAX A;  4OFR A;  5DXM A;  2Q7J A;  2HWQ A;  3OS8 A;  1T63 A;  1PQ9 A;  2QGT A;  3CLD A;  3L03 A;  3Q95 B;  4XHD A;  1NDE A;  1RDT D;  2JFA B;  1FD0 A;  4K6I A;  1EXA A;  5EGV A;  3IPU A;  4G2H A;  5DUE A;  4DM6 A;  1PQ6 A;  5A86 A;  4KZM A;  3V49 A;  3R8D A;  3U9Q A;  2P54 A;  4J5X A;  4OGH A;  3FEI A;  2IOG A;  2ZL9 A;  3OS8 C;  5DV3 A;  2ZXN A;  1X7B A;  2ABI A;  3E94 A;  4PP5 A;  2NW4 A;  3G8O A;  4IWC A;  2ZNP A;  4OKW A;  1ZAF A;  4TV1 A;  1E3K A;  5DZ1 A;  2B23 A;  2QPY A;  2Q6J A;  2AMA A;  2I0G A;  2GTK A;  4POJ A;  4UDD A;  1MV9 A;  3X1I A;  3CJW A;  5DMF A;  3O1D A;  5ACC A;  4OZT E;  1ZEO A;  2VV0 A;  4PPS A;  1NQ7 A;  4LNX A;  3UVV A;  2GP7 A;  2QNV A;  3OZJ A;  4PVU A;  2QZO B;  2VST A;  4QJR A;  2BJ4 A;  3TKC A;  3VJT A;  4QE6 A;  5KR9 A;  5DXK A;  4MGA A;  3L0J A;  1NHZ A;  5G5W A;  3UU7 B;  1XVP A;  3FC6 A;  2P7G A;  1T74 A;  2Q8S A;  3B0T A;  1XOW A;  3VI8 A;  2YLY A;  3TY0 A;  4XTA A;  2BAW A;  4OJ4 A;  4RUP A;  4XAO A;  3VHV A;  1NQ2 A;  2YHD A;  5IZ0 A;  3WJ5 A;  1MVC A;  1KKQ A;  1NQ0 A;  1DKF A;  4R06 A;  5DMC A;  1XQ3 A;  2ZK5 A;  2I4P A;  5L7E A;  2J7Y A;  1G5Y A;  5DV6 A;  3KDU A;  5DTV A;  1XNX A;  1E3G A;  2EWP A;  4YNK A;  5DWL A;  5C4S A;  4CI4 A;  4YPQ A;  5E7V A;  5FQS A;  5IAW A;  5DYD A;  3S9S A;  1GWQ A;  1A28 A;  1G50 A;  5APJ A;  2GL8 A;  2P1U A;  3B1M A;  3JZB A;  3AZ3 A;  5K13 A;  3IXP A;  3VHU A;  3ILZ A;  2VV3 A;  4OZR U;  4MGB B;  1NUO A;  1H9U A;  3FXV A;  4MGD B;  1I7G A;  5AWJ A;  3HZF A;  4DM8 A;  2ZNN A;  3PRG A;  4G21 A;  4PLD A;  3A78 A;  1YA3 A;  2HAM A;  3R5N A;  4RUJ A;  4IQR A;  3B66 A;  3A9E B;  4UDB A;  3F5C B;  5G44 A;  4RZE A;  4N8R A;  3B5R A;  4IA3 A;  3B0R A;  3KPZ A;  5JY3 A;  1M7W A;  5L7H A;  3VRW A;  3VRV A;  2QMV A;  2ZK1 A;  5DYB A;  3A40 X;  2HBH A;  3DY6 A;  4IVY A;  2Q6R A;  2QH6 A;  2QXM A;  2JJ3 A;  2AWH A;  3VT6 A;  2ZVT A;  2ZLA A;  3V4A A;  3L0E A;  2G5O A;  2ATH A;  3IA6 A;  1FBY A;  5DUG A;  3ERD A;  3V9Y A;  3L0L A;  3AZ2 A;  2GPP A;  3HO0 A;  2XYX A;  3LBD A;  2R6Y A;  4QM0 A;  5HYR A;  3UP0 A;  1T79 A;  3HQ5 A;  5DZI A;  2R6W A;  1VJB A;  4TV1 B;  4DK7 A;  4OKT A;  3DZU D;  3VJH A;  2ZFX A;  2HFP A;  1SR7 A;  3VJI A;  4IV4 A;  2ZBS A;  3OKH A;  4MG7 A;  1U3R A;  5GIE A;  2Q5S A;  3PBA A;  2BJ4 B;  1X76 A;  3AX8 A;  1S0Z A;  2XKW A;  3K23 A;  5HJP B;  3OMQ A;  4MGA B;  1OSV A;  3OKI A;  2O4J A;  3KMG A;  1XVP B;  4R2U A;  3V3Q A;  2VV2 A;  3BC5 A;  3OAP A;  3NSQ A;  2J4A A;  2Q1V A;  5DIE A;  3AUN A;  2PKL A;  5DWG A;  3WFG A;  4J5W A;  5JJM A;  3OLS A;  3HC6 A;  2PIW A;  3RVF A;  1K74 D;  4IW8 A;  4ZNW A;  1DKF B;  5E1C A;  1YIN A;  3A2J A;  3CDP A;  2YLP A;  3GWS X;  4R6S A;  1SQN A;  2GPV A;  5DWE A;  1U3S A;  1RKH A;  4JYG A;  4LNW A;  2HAR A;  5DKS A;  1GWR A;  2ZXM A;  3GWX A;  2QW4 A;  3NSP A;  2P1T A;  1XP6 A;  5AAU A;  3VT3 A;  1K74 A;  5M96 A;  4J5W C;  4G1Y A;  4MDD A;  2Q3Y A;  2OCF A;  3X36 A;  4FGY A;  4HEE X;  1QKN A;  4PF3 A;  2J14 A;  2ACL A;  2Q7K A;  3FEJ A;  4RWV A;  3VT5 A;  4IW6 A;  3P0U A;  3VRU A;  5HZC A;  4UDA A;  2ZMJ A;  2PJL A;  1IE9 A;  3DZY D;  2XYJ A;  3K22 A;  5KRJ A;  1XPC A;  3WFF A;  4E2J A;  3W0A A;  3OOK A;  1M2Z A;  2NV7 A;  1PQC A;  2AM9 A;  4ZNV A;  2REW A;  3SZ1 A;  2PIO A;  2NXX A;  1NAV A;  4XT9 A;  5DK9 A;  3DZY A;  3BQD A;  3FLI A;  3VT9 A;  2OVH A;  1XDK B;  5DXP A;  5KCT A;  3WTQ A;  4WHF A;  4MG9 A;  3ADT A;  4YMQ A;  4BCR A;  4JYH A;  5H1E A;  2R40 A;  2PRG A;  4PPP A;  3RY9 A;  1XLS A;  2HB8 A;  2QSE A;  4PWL A;  3VT4 A;  5ETH A;  2B50 A;  4A2J A;  2VV1 A;  3GD2 A;  4OIV A;  4LBD A;  4WQP A;  1S9P A;  5KCE A;  5I4V A;  4OZT U;  3HOD A;  5DLR A;  1NRL A;  3OZ0 A;  4DK8 A;  4MG7 B;  3R8A A;  3VTC A;  1LBD A;  5AAV A;  1Q4X A;  3GYT A;  2ZK0 A;  3DT3 A;  1IE8 A;  4JYI A;  5DP0 A;  1XV9 A;  1ZGY A;  3WGP A;  4PRG A;  5AWK A;  5AVL A;  1ZH7 A;  5DZ3 A;  4POH A;  5DXE A;  2PIX A;  1LV2 A;  1R20 A;  3PCU A;  4S0S A;  5ICK A;  3OMM A;  1Y0X X;  1GWX A;  1PCG A;  5KRL A;  4MG6 A;  2P1V A;  3WT7 A;  1ZDT A;  5EC9 A;  4RFW A;  5DU5 A;  1XP1 A;  3G9E A;  5G42 A;  4P6X A;  2I4Z A;  1YUC A;  4RAK A;  4ZI1 A;  1KV6 A;  3AUQ A;  3GYU A;  1X7R A;  1P8D A;  2H77 A;  3IXP D;  2ZAS A;  2ACL B;  1S0X A;  2I4J A;  5C4O A;  1N46 A;  3N00 A;  4TUZ A;  4MG8 A;  2AO6 A;  4G1D A;  5HYK A;  5DXQ A;  4J24 A;  1S9Q A;  3IPQ A;  2B1V A;  4L96 A;  3FAL A;  2PIU A;  3ET0 A;  3WWR A;  1XB7 A;  4OK1 A;  2FVJ A;  3SP6 A;  3M7R A;  3L3Z A;  1Z95 A;  2OAX A;  5DSH A;  4OEY A;  3VSP A;  5KRC A;  5KRA A;  4QL8 A;  4IU7 A;  5AK2 A;  3A3Z X;  5APK A;  3VN2 A;  3E00 D;  3R2A A;  2Q1H A;  3L3X A;  3ET2 A;  4MG9 B;  3WMH A;  5KYA A;  3TKM A;  3K8S A;  4RZF A;  4JAZ A;  5CJ6 A;  2QR9 A;  3ADU A;  1X78 A;  4REF A;  4CI5 A;  3B3K A;  5KRH A;  3W0H A;  1P93 A;  1T73 A;  3E00 A;  3FUG A;  4OEZ A;  1WM0 X;  2YAT A;  2AA7 A;  2ZK4 A;  3R8I A;  4ZJW A;  2HB7 A;  1T7F A;  3VHW A;  3E7C A;  3WT6 A;  2VV1 B;  1X7E A;  4MG5 A;  2FAI A;  3KFC A;  4ITE A;  3D90 A;  5L11 A;  2Q59 A;  4XLD A;  4G1Z A;  5E0W A;  3UUD A;  3CS4 A;  2P15 A;  2ZKC A;  1FM6 A;  4K7A A;  5GT4 A;  4RZG A;  5AAV B;  3D57 A;  4DOS A;  1XQC A;  2GIU A;  3HC5 A;  3ADV A;  3EYB A;  3FUR A;  2OUZ A;  3AUR A;  1HG4 A;  2A3I A;  3VT7 A;  2Q6S A;  3PLZ A;  1PK5 A;  3OMO A;  4ZN7 A;  3V3E A;  1PRG A;  5DXB A;  3UVV B;  1OVL A;  2XHS A;  3ET3 A;  3KDT A;  1UOM A;  2NXX E;  3B68 A;  5GID A;  1U3Q A;  3KBA A;  1T7T A;  2JFA A;  1FCY A;  5E15 A;  3OLF A;  2O9I A;  3FC6 B;  1YOW A;  3GBK A;  1YMT A;  2V7C A;  3LMP A;  4DMA A;  5DL4 A;  3VRT A;  2Q70 A;  2F4B A;  2PIV A;  4IUI A;  4LTW A;  3ZRB A;  5B41 A;  5HJS A;  5KRF A;  3TX7 B;  1S19 A;  2P7Z A;  2Z4B A;  5LWP A;  5E14 A;  1FM9 A;  4IA7 A;  3X31 A;  2B1Z A;  3HVL A;  1SJ0 A;  4OEA A;  4WVD A;  5E0X A;  4RMC A;  5KRO A;  4APU A;  4DQM A;  3OSI A;  4TUZ B;  2P7A A;  4IWF A;  1Y0S A;  4MG8 B;  3W0I A;  4IS8 A;  4OJB A;  2ZY0 A;  4ZNS A;  1TFC A;  3BEJ A;  4FHI A;  2G44 A;  5C4T A;  5DVV A;  2QGW A;  3FAL B;  2PIQ A;  3GN8 A;  3P89 A;  2QE4 A;  1MZN A;  1ERE A;  1K7L A;  4RE8 A;  1U9E A;  1YIM A;  3AFR A;  1ILH A;  2I0J A;  4ZN9 A;  4JGV A;  4OED A;  5HCV A;  4ZJR A;  1KNU A;  2QZO A;  4P6W A;  4CSJ A;  3HM1 A;  3VTD A;  5KCW A;  3SP9 A;  1T5Z A;  1Z5X E;  3UU7 A;  3ERT A;  3UUA A;  3VTB A;  4OHA A;  3RLL A;  1T7R A;  3PEQ A;  2QTU A;  2R40 D;  2IOK A;  1NQ1 A;  2E2R A;  3AN3 A;  3OMP A;  4G2I A;  4ZOM A;  5KD9 A;  4A4V A;  2AXA A;  4E4Q A;  4Y29 A;  3UUC A;  3X1H A;  3B0W A;  5KRK A;  3MNO A;  4EM9 A;  5FQV A;  4PP3 A;  1YP0 A;  4NY9 A;  1NAX A;  4NQA B;  3OLL A;  2LBD A;  4M8H A;  4F9M A;  3KYT A;  2HCD A;  2AMB A;  4Q50 A;  5FQT A;  4LSJ A;  5APH A;  3L1B A;  1I37 A;  1YYE A;  2AA5 A;  2G0H A;  3B0Q A;  3AN4 A;  1PZL A;  5DXB B;  1OVL B;  3OS9 A;  4IV2 A;  5G3J A;  5JI0 D;  3ADX A;  5GIC A;  5DUH A;  1QKM A;  1R20 D;  1N83 A;  4OIL A;  2NPA A;  5KCC A;  4S15 A;  1G1U A;  5G43 A;  1ERR A;  1EXX A;  4REE A;  3P8X A;  4OIU A;  3W0C A;  1RKG A;  4ZNT A;  2HVC A;  2ZK6 A;  3MNP A;  5DVS A;  2QAB A;  3RUU A;  4IVW A;  2AB2 A;  2W8Y A;  5JJM B;  3W0Y A;  1R1K D;  2HC4 A;  1RDT A;  4X1F A;  1FCX A;  4QE8 A;  1RJK A;  1I7I A;  4MGC A;  2V0V A;  3CTB A;  3RUT A;  5L7G A;  2ZMH A;  3A2I A;  1R1K A;  1T7M A;  4NIE A;  4ZNH A;  1ZUC A;  2ZLC A;  3FS1 A;  2AX6 A;  3DR1 A;  3OSW A;  1UHL A;  3B65 A;  4OJ9 A;  4RUO X;  3W5P A;  1N4H A;  2VV4 A;  4J5X C;  2Q7L A;  3OGT A;  5DY8 A;  4X1G A;  4Q13 A;  3CS6 A;  5KRI A;  5DID A;  1R5K A;  4XUH A;  4L98 A;  5E19 A;  2Q60 A;  2ZXZ A;  3F7D A;  4FHH A;  5HJP A;  1BSX A;  5AZT A;  5DX3 A;  2O4R A;  2Q5P A;  3UUA B;  3V9T A;  4HLW A;  1FCZ A;  2ZNQ A;  3AZ1 A;  3HLV A;  3H52 A;  1OSH A;  5EIT A;  1K4W A;  4NUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...