5HYRA

Estrogen receptor alpha ligand binding domain y537s mutant in complex with stapled peptide src2-sp2 and estradiol
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
231
Chain Sequence
ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stapled Peptides with gamma-Methylated Hydrocarbon Chains for the Estrogen Receptor/Coactivator Interaction.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Gene regulation
source organism Homo sapiens
total genus 85
structure length 231
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5hyrA00
4IA1A 5C4OA 4F9MA 2LBDA 4P6XA 1X78A 2AYRA 4DK8A 1XP9A 3PCUA 4OC7A 4QM0A 5G5WA 2AXAA 4IWFA 2J4AA 5KCFA 2VV2A 3UP0A 2ZK2A 2AX9A 4MGBB 3WT6A 3K8SA 4IW6A 5CJ6A 1MV9A 1X7RA 4MG6A 3E00A 3Q95A 4PPSA 5DK9A 5DVVA 4PVUA 3W0HA 2ACLA 3AZ1A 3FUGA 3AZ3A 1XVPB 3VJSA 1IE9A 5L7EA 3OMMA 3H0AA 3F5CA 2Q7LA 5DTVA 3OOFA 2ZBSA 4MGCA 4MGDB 4PP6A 2ZK0A 3A2IA 1T73A 4N73A 4OILA 4OEAA 3W5PA 4RFWA 1YOKA 2AX8A 1DKFB 3N00A 3P0UA 1XPCA 3W5QA 3BQDA 3CWDA 3H52A 2Q7IA 4ZNUA 5DMFA 4RMEA 3ERDA 3IXPA 2Q6JA 4MG7A 5DWEA 3S9SA 2POBA 3MNPA 4MG8B 2HARA 1OT7A 1ILHA 2AA7A 5DKEA 2HB7A 1NQ1A 2J7XA 3FEJA 2VSRA 3OS9A 2I4ZA 1U3RA 5DXBB 5DZ1A 3PO9A 1G1UA 2XYJA 3VHUA 1R1KA 3VJHA 2ZNNA 3U9QA 2YLPA 4ZO1X 5DIDA 3VHWA 3W5TA 3WFGA 3VT9A 3KMGA 1Z95A 3DR1A 1U3SA 1S9QA 4IUIA 1ILGA 3HM1A 1XLSA 4OJ9A 5GICA 1P8DA 1A28A 4CSJA 2HCDA 1I7GA 5KYJA 1FD0A 4RZGA 5JY3A 3VSOA 3DY6A 3W5RA 2ZMJA 2JFAB 5EITA 4RWVA 2I4JA 3FALA 2R40D 2AO6A 3HO0A 4MGAA 1X76A 1PCGA 3VT4A 2VV1B 1UPVA 2HC4A 3O1DA 1XZXX 3OGTA 2G0GA 1FM9D 5DKSA 4IQRA 3IPQA 4L98A 1YP0A 3B67A 1T7FA 4ZN7A 1PQCA 1Z5XU 2PITA 3OSWA 3UUDB 2GPVA 3V3QA 3V9VA 4FHIA 3R8IA 4KZMA 3OKHA 5DSHA 1T7TA 2AA6A 5I4VA 4IVWA 1FCYA 4OHAA 1LV2A 1YJEA 2YLOA 4A4VA 5SYZA 5DZ0A 3A9EB 3RVFA 4G1YA 4ZNSA 4N5GA 4NQAB 1T65A 2QZOB 3R5MA 2AA2A 2Q59B 4LNXA 1PQ6A 1OSVA 4P6WA 4Q0AC 2AX6A 3CS4A 1Z5XE 5KRKA 2PIOA 3R5NA 2PIWA 3ERTA 1XOWA 2OVHA 5DXQA 4OIVA 3M7RA 4IVYA 4HEEX 2PIXA 1HJ1A 3AFRA 5DXKA 1OVLB 2QA8A 5EI1A 3B65A 5ICKA 2ZK3A 3MNEA 1ERRA 4JL4A 3R8AA 5FQVA 3R8DA 3CJWA 4PWLA 1R20D 1RDTD 4RUPA 4APUA 3K23A 5KRIA 3FEIA 5E15A 3ET0A 5DXPA 3A2HA 1S9PA 2NPAA 4ZNWA 3W0IA 2QXSA 4J5WC 4J26A 4KZJA 4XI3A 1ZGYA 3UVVB 3L3ZA 3DZUD 5AVLA 2OZ7A 2G5OA 1MZNA 5DL4A 3OOKA 2GPOA 2Q6SA 3OAPA 2QE4A 3VJIA 4K6IA 4POJA 1XP1A 1XAPA 3D24A 1YYEA 5E1CA 2IOKA 1SR7A 1XNNA 4XUHA 4ZI1A 1NUOA 2QNVA 2QXMA 1ZH7A 3ADSA 2YATA 2B50A 3KYTA 4TV1A 3WJ4A 5DRJA 1XIUA 4M8EA 4PXMA 4QE8A 5DIGA 5HYKA 2Q8SA 3FXVA 5DUHA 5APKA 4DQMA 5H1EA 3A78A 2R6YA 3VI8A 2JF9A 1FM6D 3PBAA 4G21A 5KRCA 3L0LA 5DX3A 2GWXA 2P54A 4OEDA 5AYGA 1FCZA 3D5FA 3SP6A 3VT5A 3MNOA 3TKCA 4KZIA 4OKBA 3VT3A 3VRUA 3KMZA 3FS1A 5DKBA 5GIEA 3CDPA 1S0ZA 1IE8A 1NRLA 1TFCA 2VV0A 3OZJA 4G2IA 5DWGA 3NSQA 4UDDA 1I38A 2PINA 1QKUA 3B0QA 4UDCA 4MG9B 3ADTA 1PRGA 3UP3A 3WTQA 4N8RA 1MVCA 1P93A 2FSZA 3ADVA 2ZK6A 5E7VA 5AVIA 5AZTA 2BJ4A 3DCTA 5DKGA 3CS8A 4K7AA 3NOAA 5L11A 5DYDA 3GZ9A 4ZO1B 3RLJA 4MG5A 4TUZB 2ZKCA 4POHA 4RE8A 4PPPA 1XDKB 1Y0SA 1M13A 1ZUCA 2G0HA 4PRGA 5G45A 2QGTA 3X36A 3VRVA 1T7RA 2PKLA 3L3XA 4S0TA 2HAMA 3RLLA 3HC5A 1XV9B 3CQVA 1T7MA 1I7IA 1OSHA 4JAZA 5DX3B 1YIMA 2QTUA 1YY4A 4G1ZA 2YHDA 2Z4JA 3TY0A 3HLVA 3B3KA 4LSJA 1UHLB 2PNUA 2GPPA 4CI4A 4YT1A 3VN2A 2Q5SA 5KD9A 4ITEA 5KR9A 4OJBA 2Q6RA 2F4BA 2Z4BA 4OZRE 3WT5A 4JYHA 5G3JA 2B1ZA 3WWRA 1RKGA 3DZYD 3UUAA 1X7EA 1QKMA 2Q1VA 2YFEA 2YLYA 3OMOA 5DWLA 2ZK5A 2PIVA 4DORA 5KYAA 4JYGA 5IZ0A 4DM8A 1R6GA 3R2AA 3Q95B 5KCDA 2Q7KA 2B23A 5F9BA 4IV2A 5FQPA 3ZR7A 2PRGA 2ACLB 2QA6A 3OMPA 2GIUA 3RY9A 4YMQA 3W0GA 2HVCA 3VSPA 5DVSA 5DP0A 2O4RA 2ZXNA 3F5CB 3VRTA 2HWRA 5LGAA 3AX8A 2ZFXA 2P1VA 4OJ4A 4OK1A 5DY8A 2FVJA 1N83A 2R6WA 4J5WA 1BSXA 5ETHA 3GD2A 4LTWA 4IA7A 2Q61A 1Y0XX 4DMAA 3IPSA 4FGYA 3B1MA 4OZTU 2V7CA 4ONIA 5JJMA 3V9YA 4X1GA 3A2JA 4R6SA 5KRJA 1KV6A 4MG7B 3WT7A 3ZQTA 2R40A 2V0VA 4IS8A 1FCXA 5DXGA 5DV3A 2P1TA 1NYXA 3SP9A 5AZVA 3OZ0A 5DZHA 3G0WA 4E4KA 3GWSX 4B7WA 1M7WA 4JYIA 1FM9A 3D57A 2YJDA 4FN9A 2AWHA 3CDSA 4N1YA 4OFRA 4ZJRA 3B0TA 2I4PA 5KCTA 2YJAB 1T74A 5AAVA 5B5BA 1K7LA 5DLRA 2XYXA 3V4AA 3VT6A 5KCWA 4OZTE 4O8FA 1GWQA 4RMDA 3FALB 3G8IA 1EREA 4MGAB 3LBDA 1ZDUA 2G44A 2ATHA 1VJBA 1GS4A 3ET3A 4OARA 4QJRA 4R06A 1NDEA 3WMHA 2VV4A 4DK7A 1XQCA 3FLIA 3AURA 5AWKA 3OLSA 2J7YA 4OKXA 2OCFA 5DV8A 2ZY0A 5G44A 4OFUA 2ZLCA 4Q13A 1NAVA 2ZASA 4J24A 1S19A 4FNEA 2QPYA 3VJTA 2PIUA 2NXXE 3GN8A 5DWJA 1K4WA 4M8HA 5DYBA 5KRHA 2YLQA 5L7HA 1SKXA 5DVCA 3V3EA 2ZMIA 3AUNA 1XJ7A 5HCVA 2H79A 4IW8A 3T03A 1UPWA 4FHHA 4YNKA 5KRMA 2A3IA 4MDDA 3KBAA 5APJA 3K22A 2J14A 3UUCA 4WHGA 3G8OA 5AK2A 2P7GA 2REWA 1R20A 1RDTA 3W0YA 3OS8C 3OSIA 1K74D 1RK3A 4PLEA 3V9TA 2H77A 1YINA 1NQ0A 4XT9A 3DCUA 3UU7A 3FC6A 3DZUA 2AMAA 4DM6A 3ADWA 2VV4B 1G5YA 3FURA 5DZIA 2ZVTA 3KDUA 5KCUA 4ZOMA 2QA8B 5DWIA 5G42A 3RUTA 5E0WA 3B0WA 5C4SA 3GBKA 1K74A 2B1VA 2P7ZA 3KMRA 3OMQA 3TKMA 2O4JA 4MGBA 1ZDTA 2PJLA 5HZCA 5DXRA 1N46A 1FM6A 3P88A 5C4UA 5L7GA 3P8XA 5ACCA 1XVPA 1E3KA 2BAWA 2O9IA 2IOGA 1RJKA 3OMKA 4QK4A 4X1FA 5KCCA 5DUGA 4OZRU 5HYRA 3D90A 1KKQA 4REEA 4MGDA 2AA5A 1XB7A 2P7AA 2ZL9A 3D6DA 4G1DA 3VHVA 4IA3A 4TV1B 4PP3A 2QSEA 1DKFA 5DXEA 3L0JA 2P1UA 3PEQA 4L96A 4LNWA 3E00D 3NSPA 3GWXA 2ZNQA 5KRFA 5M96A 1SJ0A 4S14A 2AM9A 2GL8A 5G46A 4OH5A 1E3GA 2QMVA 1NHZA 2OUZA 3O1EA 5GIDA 5DU5A 4MG8A 1PQ9A 3H0AD 1TXIA 4K4JA 4Y29A 1U9EA 1YA3A 3E94A 3QT0A 3TX7B 2QH6A 3AZ2A 1NQ2A 5DXBA 2HASA 3W0AA 2AAXA 2Q5GA 1UOMA 1RKHA 4R2UA 3ZRAA 1YOWA 5KCEA 4G20A 3VT7A 3HVLA 3X31A 3HODA 1G50A 3ADXA 2IHQA 5HJSA 1SQNA 3IPUA 5LWPA 4PF3A 5A86A 3IXPD 2JFAA 1LBDA 2BJ4B 5K13A 5FQSA 2Q70A 1XP6A 1HG4A 1T5ZA 3A3ZX 3WJ5A 1ZKYA 3JZBA 4NY9A 5EJVA 2Q60A 4EM9A 2VV1A 5DRMA 3ET2A 3DZYA 3K6PA 2AX7A 4RUJA 4OH6A 2XHSA 5EHJA 1R1KD 4XLDA 5FQRA 3F7DA 4OGHA 2GPUA 4A4WA 2ZXMA 4J5XC 5DIEA 4E2JA 3DT3A 5G43A 2EWPA 2JJ3A 3IMYA 4LBDA 5B41A 3G9EA 4OEZA 1KNUA 3VTCA 2ZMHA 2FAIA 3OSAA 4NB6A 3UUDA 1T63A 2ZXZA 3LMPA 2ABIA 3HQ5A 4XAOA 3L1BA 3W0JA 2XKWA 5KROA 2POGA 3OS8A 5EC9A 5DV6A 1XLSE 3B0RA 4IU7A 4WPFA 4WHFA 1DB1A 1GWXA 1X7BA 2HB8A 4XHDA 3HZFA 5E14A 3UUAB 3W0CA 5DZ3A 2E2RA 4EMAA 3CS6A 1X7JA 3BC5A 2NW4A 1ZEOA 3A9EA 4S15A 4IA2A 3B5RA 3X1IA 2QZOA 2QW4A 3X1HA 2Q59A 3AN3A 3KWYA 2P15A 4OLMA 1XQ3A 2PIPL 3R29A 4YPQA 2ZNOA 4UDBA 5HJPA 4ZNTA 4QL8A 2HBHA 3GYUA 3CLDA 3OLLA 4IWCA 4PP5A 4ZJWA 3EYBA 1OVLA 2ZLAA 3P89A 4OKTA 1S0XA 1L2IA 3OKIA 2PIRA 2GP7A 4RZEA 2W8YA 4WQPA 4BCRA 5AAUA 2GTKA 5JJMB 4PLDA 1XNXA 1I37A 3GYTA 3A40X 3ET1A 5DI7A 3UVVA 4S0SA 1Y9RA 1YMTA 3E7CA 3BEJA 3VTBA 5DUEA 3PRGA 2NXXA 2Q1HA 1EXXA 3ILZA 5APHA 4ZN9A 4XTAA 2ZK4A 4QE6A 4OKWA 2Q3YA 3V49A 1EXAA 4RAKA 4WLBA 4NIEA 4CI5A 5AAVB 5HJPB 3KDTA 4ZNVA 4RUOX 4OEYA 3B66A 1G2NA 1GWRA 4HLWA 3RUUA 4NUFA 3PLZA 5EGVA 3KFCA 3L0EA 5E0XA 4DOSA 4WVDA 2NV7A 1A52A 1WM0X 3WGPA 2HFPA 3JZCA 4G2HA 1M2ZA 4UDAA 2OVMA 2QABA 3SZ1A 4IV4A 5IXKA 2ZK1A 4ITFA 1QKNA 1FBYA 2I0JA 2ZNPA 5E19A 2Q7JA 3WFFA 4A2JA 4E4QA 2AMBA 2OAXA 5KRLA 1YUCA 5C4TA 3IA6A 4Q50A 5JI0D 1U3QA 4MG9A 5GT4A 2VSTA 3VT8A 1R5KA 3B68A 4J5XA 4RMCA 1N4HA 3AN4A 1PK5A 2VV3A 4ZNHA 5KRAA 2Q5PA 1QKTA 3OLFA 4TUZA 2AB2A 1T79A 5AWJA 1XDKA 5DXMA 2PIQA 3KPZA 5IAWA 5FQTA 1NQ7A 1XV9A 2P4YA 3L03A 3AUQA 1PDUA 2I0GA 4XUMA 3ZRBA 2OM9A 3ADUA 1L2JA 5DMCA 4REFA 3HC6A 3UU7B 1ZAFA 1PZLA 3FC6B 1NAXA 4OIUA 2XYWA 3VTDA 3VRWA 4JGVA 3CTBA 1UHLA 2HWQA 1H9UA 4RZFA 1T76A 1Q4XA 2QGWA 2QR9A
chains in the Genus database with same CATH superfamily
4IA1A 5C4OA 4F9MA 2LBDA 4P6XA 1X78A 2AYRA 4DK8A 1XP9A 3PCUA 4OC7A 4QM0A 5G5WA 2AXAA 4IWFA 2J4AA 5KCFA 2VV2A 3UP0A 2ZK2A 2AX9A 4MGBB 3WT6A 3K8SA 4IW6A 5CJ6A 1MV9A 1X7RA 4MG6A 3E00A 3Q95A 4PPSA 5DK9A 5DVVA 4PVUA 3W0HA 2ACLA 3AZ1A 3FUGA 3AZ3A 1XVPB 3VJSA 1IE9A 5L7EA 3OMMA 3H0AA 3F5CA 2Q7LA 5DTVA 3OOFA 2ZBSA 4MGCA 4MGDB 4PP6A 2ZK0A 3A2IA 1T73A 4N73A 4OILA 4OEAA 3W5PA 4RFWA 1YOKA 2AX8A 1DKFB 3N00A 3P0UA 1XPCA 3W5QA 3BQDA 3CWDA 3H52A 2Q7IA 4ZNUA 5DMFA 4RMEA 3ERDA 3IXPA 2Q6JA 4MG7A 5DWEA 3S9SA 2POBA 3MNPA 4MG8B 2HARA 1OT7A 1ILHA 2AA7A 5DKEA 2HB7A 1NQ1A 2J7XA 3FEJA 2VSRA 3OS9A 2I4ZA 1U3RA 5DXBB 5DZ1A 3PO9A 1G1UA 2XYJA 3VHUA 1R1KA 3VJHA 2ZNNA 3U9QA 2YLPA 4ZO1X 5DIDA 3VHWA 3W5TA 3WFGA 3VT9A 3KMGA 1Z95A 3DR1A 1U3SA 1S9QA 4IUIA 1ILGA 3HM1A 1XLSA 4OJ9A 5GICA 1P8DA 1A28A 4CSJA 2HCDA 1I7GA 5KYJA 1FD0A 4RZGA 5JY3A 3VSOA 3DY6A 3W5RA 2ZMJA 2JFAB 5EITA 4RWVA 2I4JA 3FALA 2R40D 2AO6A 3HO0A 4MGAA 1X76A 1PCGA 3VT4A 2VV1B 1UPVA 2HC4A 3O1DA 1XZXX 3OGTA 2G0GA 1FM9D 5DKSA 4IQRA 3IPQA 4L98A 1YP0A 3B67A 1T7FA 4ZN7A 1PQCA 1Z5XU 2PITA 3OSWA 3UUDB 2GPVA 3V3QA 3V9VA 4FHIA 3R8IA 4KZMA 3OKHA 5DSHA 1T7TA 2AA6A 5I4VA 4IVWA 1FCYA 4OHAA 1LV2A 1YJEA 2YLOA 4A4VA 5SYZA 5DZ0A 3A9EB 3RVFA 4G1YA 4ZNSA 4N5GA 4NQAB 1T65A 2QZOB 3R5MA 2AA2A 2Q59B 4LNXA 1PQ6A 1OSVA 4P6WA 4Q0AC 2AX6A 3CS4A 1Z5XE 5KRKA 2PIOA 3R5NA 2PIWA 3ERTA 1XOWA 2OVHA 5DXQA 4OIVA 3M7RA 4IVYA 4HEEX 2PIXA 1HJ1A 3AFRA 5DXKA 1OVLB 2QA8A 5EI1A 3B65A 5ICKA 2ZK3A 3MNEA 1ERRA 4JL4A 3R8AA 5FQVA 3R8DA 3CJWA 4PWLA 1R20D 1RDTD 4RUPA 4APUA 3K23A 5KRIA 3FEIA 5E15A 3ET0A 5DXPA 3A2HA 1S9PA 2NPAA 4ZNWA 3W0IA 2QXSA 4J5WC 4J26A 4KZJA 4XI3A 1ZGYA 3UVVB 3L3ZA 3DZUD 5AVLA 2OZ7A 2G5OA 1MZNA 5DL4A 3OOKA 2GPOA 2Q6SA 3OAPA 2QE4A 3VJIA 4K6IA 4POJA 1XP1A 1XAPA 3D24A 1YYEA 5E1CA 2IOKA 1SR7A 1XNNA 4XUHA 4ZI1A 1NUOA 2QNVA 2QXMA 1ZH7A 3ADSA 2YATA 2B50A 3KYTA 4TV1A 3WJ4A 5DRJA 1XIUA 4M8EA 4PXMA 4QE8A 5DIGA 5HYKA 2Q8SA 3FXVA 5DUHA 5APKA 4DQMA 5H1EA 3A78A 2R6YA 3VI8A 2JF9A 1FM6D 3PBAA 4G21A 5KRCA 3L0LA 5DX3A 2GWXA 2P54A 4OEDA 5AYGA 1FCZA 3D5FA 3SP6A 3VT5A 3MNOA 3TKCA 4KZIA 4OKBA 3VT3A 3VRUA 3KMZA 3FS1A 5DKBA 5GIEA 3CDPA 1S0ZA 1IE8A 1NRLA 1TFCA 2VV0A 3OZJA 4G2IA 5DWGA 3NSQA 4UDDA 1I38A 2PINA 1QKUA 3B0QA 4UDCA 4MG9B 3ADTA 1PRGA 3UP3A 3WTQA 4N8RA 1MVCA 1P93A 2FSZA 3ADVA 2ZK6A 5E7VA 5AVIA 5AZTA 2BJ4A 3DCTA 5DKGA 3CS8A 4K7AA 3NOAA 5L11A 5DYDA 3GZ9A 4ZO1B 3RLJA 4MG5A 4TUZB 2ZKCA 4POHA 4RE8A 4PPPA 1XDKB 1Y0SA 1M13A 1ZUCA 2G0HA 4PRGA 5G45A 2QGTA 3X36A 3VRVA 1T7RA 2PKLA 3L3XA 4S0TA 2HAMA 3RLLA 3HC5A 1XV9B 3CQVA 1T7MA 1I7IA 1OSHA 4JAZA 5DX3B 1YIMA 2QTUA 1YY4A 4G1ZA 2YHDA 2Z4JA 3TY0A 3HLVA 3B3KA 4LSJA 1UHLB 2PNUA 2GPPA 4CI4A 4YT1A 3VN2A 2Q5SA 5KD9A 4ITEA 5KR9A 4OJBA 2Q6RA 2F4BA 2Z4BA 4OZRE 3WT5A 4JYHA 5G3JA 2B1ZA 3WWRA 1RKGA 3DZYD 3UUAA 1X7EA 1QKMA 2Q1VA 2YFEA 2YLYA 3OMOA 5DWLA 2ZK5A 2PIVA 4DORA 5KYAA 4JYGA 5IZ0A 4DM8A 1R6GA 3R2AA 3Q95B 5KCDA 2Q7KA 2B23A 5F9BA 4IV2A 5FQPA 3ZR7A 2PRGA 2ACLB 2QA6A 3OMPA 2GIUA 3RY9A 4YMQA 3W0GA 2HVCA 3VSPA 5DVSA 5DP0A 2O4RA 2ZXNA 3F5CB 3VRTA 2HWRA 5LGAA 3AX8A 2ZFXA 2P1VA 4OJ4A 4OK1A 5DY8A 2FVJA 1N83A 2R6WA 4J5WA 1BSXA 5ETHA 3GD2A 4LTWA 4IA7A 2Q61A 1Y0XX 4DMAA 3IPSA 4FGYA 3B1MA 4OZTU 2V7CA 4ONIA 5JJMA 3V9YA 4X1GA 3A2JA 4R6SA 5KRJA 1KV6A 4MG7B 3WT7A 3ZQTA 2R40A 2V0VA 4IS8A 1FCXA 5DXGA 5DV3A 2P1TA 1NYXA 3SP9A 5AZVA 3OZ0A 5DZHA 3G0WA 4E4KA 3GWSX 4B7WA 1M7WA 4JYIA 1FM9A 3D57A 2YJDA 4FN9A 2AWHA 3CDSA 4N1YA 4OFRA 4ZJRA 3B0TA 2I4PA 5KCTA 2YJAB 1T74A 5AAVA 5B5BA 1K7LA 5DLRA 2XYXA 3V4AA 3VT6A 5KCWA 4OZTE 4O8FA 1GWQA 4RMDA 3FALB 3G8IA 1EREA 4MGAB 3LBDA 1ZDUA 2G44A 2ATHA 1VJBA 1GS4A 3ET3A 4OARA 4QJRA 4R06A 1NDEA 3WMHA 2VV4A 4DK7A 1XQCA 3FLIA 3AURA 5AWKA 3OLSA 2J7YA 4OKXA 2OCFA 5DV8A 2ZY0A 5G44A 4OFUA 2ZLCA 4Q13A 1NAVA 2ZASA 4J24A 1S19A 4FNEA 2QPYA 3VJTA 2PIUA 2NXXE 3GN8A 5DWJA 1K4WA 4M8HA 5DYBA 5KRHA 2YLQA 5L7HA 1SKXA 5DVCA 3V3EA 2ZMIA 3AUNA 1XJ7A 5HCVA 2H79A 4IW8A 3T03A 1UPWA 4FHHA 4YNKA 5KRMA 2A3IA 4MDDA 3KBAA 5APJA 3K22A 2J14A 3UUCA 4WHGA 3G8OA 5AK2A 2P7GA 2REWA 1R20A 1RDTA 3W0YA 3OS8C 3OSIA 1K74D 1RK3A 4PLEA 3V9TA 2H77A 1YINA 1NQ0A 4XT9A 3DCUA 3UU7A 3FC6A 3DZUA 2AMAA 4DM6A 3ADWA 2VV4B 1G5YA 3FURA 5DZIA 2ZVTA 3KDUA 5KCUA 4ZOMA 2QA8B 5DWIA 5G42A 3RUTA 5E0WA 3B0WA 5C4SA 3GBKA 1K74A 2B1VA 2P7ZA 3KMRA 3OMQA 3TKMA 2O4JA 4MGBA 1ZDTA 2PJLA 5HZCA 5DXRA 1N46A 1FM6A 3P88A 5C4UA 5L7GA 3P8XA 5ACCA 1XVPA 1E3KA 2BAWA 2O9IA 2IOGA 1RJKA 3OMKA 4QK4A 4X1FA 5KCCA 5DUGA 4OZRU 5HYRA 3D90A 1KKQA 4REEA 4MGDA 2AA5A 1XB7A 2P7AA 2ZL9A 3D6DA 4G1DA 3VHVA 4IA3A 4TV1B 4PP3A 2QSEA 1DKFA 5DXEA 3L0JA 2P1UA 3PEQA 4L96A 4LNWA 3E00D 3NSPA 3GWXA 2ZNQA 5KRFA 5M96A 1SJ0A 4S14A 2AM9A 2GL8A 5G46A 4OH5A 1E3GA 2QMVA 1NHZA 2OUZA 3O1EA 5GIDA 5DU5A 4MG8A 1PQ9A 3H0AD 1TXIA 4K4JA 4Y29A 1U9EA 1YA3A 3E94A 3QT0A 3TX7B 2QH6A 3AZ2A 1NQ2A 5DXBA 2HASA 3W0AA 2AAXA 2Q5GA 1UOMA 1RKHA 4R2UA 3ZRAA 1YOWA 5KCEA 4G20A 3VT7A 3HVLA 3X31A 3HODA 1G50A 3ADXA 2IHQA 5HJSA 1SQNA 3IPUA 5LWPA 4PF3A 5A86A 3IXPD 2JFAA 1LBDA 2BJ4B 5K13A 5FQSA 2Q70A 1XP6A 1HG4A 1T5ZA 3A3ZX 3WJ5A 1ZKYA 3JZBA 4NY9A 5EJVA 2Q60A 4EM9A 2VV1A 5DRMA 3ET2A 3DZYA 3K6PA 2AX7A 4RUJA 4OH6A 2XHSA 5EHJA 1R1KD 4XLDA 5FQRA 3F7DA 4OGHA 2GPUA 4A4WA 2ZXMA 4J5XC 5DIEA 4E2JA 3DT3A 5G43A 2EWPA 2JJ3A 3IMYA 4LBDA 5B41A 3G9EA 4OEZA 1KNUA 3VTCA 2ZMHA 2FAIA 3OSAA 4NB6A 3UUDA 1T63A 2ZXZA 3LMPA 2ABIA 3HQ5A 4XAOA 3L1BA 3W0JA 2XKWA 5KROA 2POGA 3OS8A 5EC9A 5DV6A 1XLSE 3B0RA 4IU7A 4WPFA 4WHFA 1DB1A 1GWXA 1X7BA 2HB8A 4XHDA 3HZFA 5E14A 3UUAB 3W0CA 5DZ3A 2E2RA 4EMAA 3CS6A 1X7JA 3BC5A 2NW4A 1ZEOA 3A9EA 4S15A 4IA2A 3B5RA 3X1IA 2QZOA 2QW4A 3X1HA 2Q59A 3AN3A 3KWYA 2P15A 4OLMA 1XQ3A 2PIPL 3R29A 4YPQA 2ZNOA 4UDBA 5HJPA 4ZNTA 4QL8A 2HBHA 3GYUA 3CLDA 3OLLA 4IWCA 4PP5A 4ZJWA 3EYBA 1OVLA 2ZLAA 3P89A 4OKTA 1S0XA 1L2IA 3OKIA 2PIRA 2GP7A 4RZEA 2W8YA 4WQPA 4BCRA 5AAUA 2GTKA 5JJMB 4PLDA 1XNXA 1I37A 3GYTA 3A40X 3ET1A 5DI7A 3UVVA 4S0SA 1Y9RA 1YMTA 3E7CA 3BEJA 3VTBA 5DUEA 3PRGA 2NXXA 2Q1HA 1EXXA 3ILZA 5APHA 4ZN9A 4XTAA 2ZK4A 4QE6A 4OKWA 2Q3YA 3V49A 1EXAA 4RAKA 4WLBA 4NIEA 4CI5A 5AAVB 5HJPB 3KDTA 4ZNVA 4RUOX 4OEYA 3B66A 1G2NA 1GWRA 4HLWA 3RUUA 4NUFA 3PLZA 5EGVA 3KFCA 3L0EA 5E0XA 4DOSA 4WVDA 2NV7A 1A52A 1WM0X 3WGPA 2HFPA 3JZCA 4G2HA 1M2ZA 4UDAA 2OVMA 2QABA 3SZ1A 4IV4A 5IXKA 2ZK1A 4ITFA 1QKNA 1FBYA 2I0JA 2ZNPA 5E19A 2Q7JA 3WFFA 4A2JA 4E4QA 2AMBA 2OAXA 5KRLA 1YUCA 5C4TA 3IA6A 4Q50A 5JI0D 1U3QA 4MG9A 5GT4A 2VSTA 3VT8A 1R5KA 3B68A 4J5XA 4RMCA 1N4HA 3AN4A 1PK5A 2VV3A 4ZNHA 5KRAA 2Q5PA 1QKTA 3OLFA 4TUZA 2AB2A 1T79A 5AWJA 1XDKA 5DXMA 2PIQA 3KPZA 5IAWA 5FQTA 1NQ7A 1XV9A 2P4YA 3L03A 3AUQA 1PDUA 2I0GA 4XUMA 3ZRBA 2OM9A 3ADUA 1L2JA 5DMCA 4REFA 3HC6A 3UU7B 1ZAFA 1PZLA 3FC6B 1NAXA 4OIUA 2XYWA 3VTDA 3VRWA 4JGVA 3CTBA 1UHLA 2HWQA 1H9UA 4RZFA 1T76A 1Q4XA 2QGWA 2QR9A
chains in the Genus database with same CATH topology
4IA1A 5C4OA 4F9MA 2LBDA 4P6XA 1X78A 2AYRA 4DK8A 1XP9A 3PCUA 4OC7A 4QM0A 5G5WA 2AXAA 4IWFA 2J4AA 5KCFA 2VV2A 3UP0A 2ZK2A 2AX9A 4MGBB 3WT6A 3K8SA 4IW6A 5CJ6A 1MV9A 1X7RA 4MG6A 3E00A 3Q95A 4PPSA 5DK9A 5DVVA 4PVUA 3W0HA 2ACLA 3AZ1A 3FUGA 3AZ3A 1XVPB 3VJSA 1IE9A 5L7EA 3OMMA 3H0AA 3F5CA 2Q7LA 5DTVA 3OOFA 2ZBSA 4MGCA 4MGDB 4PP6A 2ZK0A 3A2IA 1T73A 4N73A 4OILA 4OEAA 3W5PA 4RFWA 1YOKA 2AX8A 1DKFB 3N00A 3P0UA 1XPCA 3W5QA 3BQDA 3CWDA 3H52A 2Q7IA 4ZNUA 5DMFA 4RMEA 3ERDA 3IXPA 2Q6JA 4MG7A 5DWEA 3S9SA 2POBA 3MNPA 4MG8B 2HARA 1OT7A 1ILHA 2AA7A 5DKEA 2HB7A 1NQ1A 2J7XA 3FEJA 2VSRA 3OS9A 2I4ZA 1U3RA 5DXBB 5DZ1A 3PO9A 1G1UA 2XYJA 3VHUA 1R1KA 3VJHA 2ZNNA 3U9QA 2YLPA 4ZO1X 5DIDA 3VHWA 3W5TA 3WFGA 3VT9A 3KMGA 1Z95A 3DR1A 1U3SA 1S9QA 4IUIA 1ILGA 3HM1A 1XLSA 4OJ9A 5GICA 1P8DA 1A28A 4CSJA 2HCDA 1I7GA 5KYJA 1FD0A 4RZGA 5JY3A 3VSOA 3DY6A 3W5RA 2ZMJA 2JFAB 5EITA 4RWVA 2I4JA 3FALA 2R40D 2AO6A 3HO0A 4MGAA 1X76A 1PCGA 3VT4A 2VV1B 1UPVA 2HC4A 3O1DA 1XZXX 3OGTA 2G0GA 1FM9D 5DKSA 4IQRA 3IPQA 4L98A 1YP0A 3B67A 1T7FA 4ZN7A 1PQCA 1Z5XU 2PITA 3OSWA 3UUDB 2GPVA 3V3QA 3V9VA 4FHIA 3R8IA 4KZMA 3OKHA 5DSHA 1T7TA 2AA6A 5I4VA 4IVWA 1FCYA 4OHAA 1LV2A 1YJEA 2YLOA 4A4VA 5SYZA 5DZ0A 3A9EB 3RVFA 4G1YA 4ZNSA 4N5GA 4NQAB 1T65A 2QZOB 3R5MA 2AA2A 2Q59B 4LNXA 1PQ6A 1OSVA 4P6WA 4Q0AC 2AX6A 3CS4A 1Z5XE 5KRKA 2PIOA 3R5NA 2PIWA 3ERTA 1XOWA 2OVHA 5DXQA 4OIVA 3M7RA 4IVYA 4HEEX 2PIXA 1HJ1A 3AFRA 5DXKA 1OVLB 2QA8A 5EI1A 3B65A 5ICKA 2ZK3A 3MNEA 1ERRA 4JL4A 3R8AA 5FQVA 3R8DA 3CJWA 4PWLA 1R20D 1RDTD 4RUPA 4APUA 3K23A 5KRIA 3FEIA 5E15A 3ET0A 5DXPA 3A2HA 1S9PA 2NPAA 4ZNWA 3W0IA 2QXSA 4J5WC 4J26A 4KZJA 4XI3A 1ZGYA 3UVVB 3L3ZA 3DZUD 5AVLA 2OZ7A 2G5OA 1MZNA 5DL4A 3OOKA 2GPOA 2Q6SA 3OAPA 2QE4A 3VJIA 4K6IA 4POJA 1XP1A 1XAPA 3D24A 1YYEA 5E1CA 2IOKA 1SR7A 1XNNA 4XUHA 4ZI1A 1NUOA 2QNVA 2QXMA 1ZH7A 3ADSA 2YATA 2B50A 3KYTA 4TV1A 3WJ4A 5DRJA 1XIUA 4M8EA 4PXMA 4QE8A 5DIGA 5HYKA 2Q8SA 3FXVA 5DUHA 5APKA 4DQMA 5H1EA 3A78A 2R6YA 3VI8A 2JF9A 1FM6D 3PBAA 4G21A 5KRCA 3L0LA 5DX3A 2GWXA 2P54A 4OEDA 5AYGA 1FCZA 3D5FA 3SP6A 3VT5A 3MNOA 3TKCA 4KZIA 4OKBA 3VT3A 3VRUA 3KMZA 3FS1A 5DKBA 5GIEA 3CDPA 1S0ZA 1IE8A 1NRLA 1TFCA 2VV0A 3OZJA 4G2IA 5DWGA 3NSQA 4UDDA 1I38A 2PINA 1QKUA 3B0QA 4UDCA 4MG9B 3ADTA 1PRGA 3UP3A 3WTQA 4N8RA 1MVCA 1P93A 2FSZA 3ADVA 2ZK6A 5E7VA 5AVIA 5AZTA 2BJ4A 3DCTA 5DKGA 3CS8A 4K7AA 3NOAA 5L11A 5DYDA 3GZ9A 4ZO1B 3RLJA 4MG5A 4TUZB 2ZKCA 4POHA 4RE8A 4PPPA 1XDKB 1Y0SA 1M13A 1ZUCA 2G0HA 4PRGA 5G45A 2QGTA 3X36A 3VRVA 1T7RA 2PKLA 3L3XA 4S0TA 2HAMA 3RLLA 3HC5A 1XV9B 3CQVA 1T7MA 1I7IA 1OSHA 4JAZA 5DX3B 1YIMA 2QTUA 1YY4A 4G1ZA 2YHDA 2Z4JA 3TY0A 3HLVA 3B3KA 4LSJA 1UHLB 2PNUA 2GPPA 4CI4A 4YT1A 3VN2A 2Q5SA 5KD9A 4ITEA 5KR9A 4OJBA 2Q6RA 2F4BA 2Z4BA 4OZRE 3WT5A 4JYHA 5G3JA 2B1ZA 3WWRA 1RKGA 3DZYD 3UUAA 1X7EA 1QKMA 2Q1VA 2YFEA 2YLYA 3OMOA 5DWLA 2ZK5A 2PIVA 4DORA 5KYAA 4JYGA 5IZ0A 4DM8A 1R6GA 3R2AA 3Q95B 5KCDA 2Q7KA 2B23A 5F9BA 4IV2A 5FQPA 3ZR7A 2PRGA 2ACLB 2QA6A 3OMPA 2GIUA 3RY9A 4YMQA 3W0GA 2HVCA 3VSPA 5DVSA 5DP0A 2O4RA 2ZXNA 3F5CB 3VRTA 2HWRA 5LGAA 3AX8A 2ZFXA 2P1VA 4OJ4A 4OK1A 5DY8A 2FVJA 1N83A 2R6WA 4J5WA 1BSXA 5ETHA 3GD2A 4LTWA 4IA7A 2Q61A 1Y0XX 4DMAA 3IPSA 4FGYA 3B1MA 4OZTU 2V7CA 4ONIA 5JJMA 3V9YA 4X1GA 3A2JA 4R6SA 5KRJA 1KV6A 4MG7B 3WT7A 3ZQTA 2R40A 2V0VA 4IS8A 1FCXA 5DXGA 5DV3A 2P1TA 1NYXA 3SP9A 5AZVA 3OZ0A 5DZHA 3G0WA 4E4KA 3GWSX 4B7WA 1M7WA 4JYIA 1FM9A 3D57A 2YJDA 4FN9A 2AWHA 3CDSA 4N1YA 4OFRA 4ZJRA 3B0TA 2I4PA 5KCTA 2YJAB 1T74A 5AAVA 5B5BA 1K7LA 5DLRA 2XYXA 3V4AA 3VT6A 5KCWA 4OZTE 4O8FA 1GWQA 4RMDA 3FALB 3G8IA 1EREA 4MGAB 3LBDA 1ZDUA 2G44A 2ATHA 1VJBA 1GS4A 3ET3A 4OARA 4QJRA 4R06A 1NDEA 3WMHA 2VV4A 4DK7A 1XQCA 3FLIA 3AURA 5AWKA 3OLSA 2J7YA 4OKXA 2OCFA 5DV8A 2ZY0A 5G44A 4OFUA 2ZLCA 4Q13A 1NAVA 2ZASA 4J24A 1S19A 4FNEA 2QPYA 3VJTA 2PIUA 2NXXE 3GN8A 5DWJA 1K4WA 4M8HA 5DYBA 5KRHA 2YLQA 5L7HA 1SKXA 5DVCA 3V3EA 2ZMIA 3AUNA 1XJ7A 5HCVA 2H79A 4IW8A 3T03A 1UPWA 4FHHA 4YNKA 5KRMA 2A3IA 4MDDA 3KBAA 5APJA 3K22A 2J14A 3UUCA 4WHGA 3G8OA 5AK2A 2P7GA 2REWA 1R20A 1RDTA 3W0YA 3OS8C 3OSIA 1K74D 1RK3A 4PLEA 3V9TA 2H77A 1YINA 1NQ0A 4XT9A 3DCUA 3UU7A 3FC6A 3DZUA 2AMAA 4DM6A 3ADWA 2VV4B 1G5YA 3FURA 5DZIA 2ZVTA 3KDUA 5KCUA 4ZOMA 2QA8B 5DWIA 5G42A 3RUTA 5E0WA 3B0WA 5C4SA 3GBKA 1K74A 2B1VA 2P7ZA 3KMRA 3OMQA 3TKMA 2O4JA 4MGBA 1ZDTA 2PJLA 5HZCA 5DXRA 1N46A 1FM6A 3P88A 5C4UA 5L7GA 3P8XA 5ACCA 1XVPA 1E3KA 2BAWA 2O9IA 2IOGA 1RJKA 3OMKA 4QK4A 4X1FA 5KCCA 5DUGA 4OZRU 5HYRA 3D90A 1KKQA 4REEA 4MGDA 2AA5A 1XB7A 2P7AA 2ZL9A 3D6DA 4G1DA 3VHVA 4IA3A 4TV1B 4PP3A 2QSEA 1DKFA 5DXEA 3L0JA 2P1UA 3PEQA 4L96A 4LNWA 3E00D 3NSPA 3GWXA 2ZNQA 5KRFA 5M96A 1SJ0A 4S14A 2AM9A 2GL8A 5G46A 4OH5A 1E3GA 2QMVA 1NHZA 2OUZA 3O1EA 5GIDA 5DU5A 4MG8A 1PQ9A 3H0AD 1TXIA 4K4JA 4Y29A 1U9EA 1YA3A 3E94A 3QT0A 3TX7B 2QH6A 3AZ2A 1NQ2A 5DXBA 2HASA 3W0AA 2AAXA 2Q5GA 1UOMA 1RKHA 4R2UA 3ZRAA 1YOWA 5KCEA 4G20A 3VT7A 3HVLA 3X31A 3HODA 1G50A 3ADXA 2IHQA 5HJSA 1SQNA 3IPUA 5LWPA 4PF3A 5A86A 3IXPD 2JFAA 1LBDA 2BJ4B 5K13A 5FQSA 2Q70A 1XP6A 1HG4A 1T5ZA 3A3ZX 3WJ5A 1ZKYA 3JZBA 4NY9A 5EJVA 2Q60A 4EM9A 2VV1A 5DRMA 3ET2A 3DZYA 3K6PA 2AX7A 4RUJA 4OH6A 2XHSA 5EHJA 1R1KD 4XLDA 5FQRA 3F7DA 4OGHA 2GPUA 4A4WA 2ZXMA 4J5XC 5DIEA 4E2JA 3DT3A 5G43A 2EWPA 2JJ3A 3IMYA 4LBDA 5B41A 3G9EA 4OEZA 1KNUA 3VTCA 2ZMHA 2FAIA 3OSAA 4NB6A 3UUDA 1T63A 2ZXZA 3LMPA 2ABIA 3HQ5A 4XAOA 3L1BA 3W0JA 2XKWA 5KROA 2POGA 3OS8A 5EC9A 5DV6A 1XLSE 3B0RA 4IU7A 4WPFA 4WHFA 1DB1A 1GWXA 1X7BA 2HB8A 4XHDA 3HZFA 5E14A 3UUAB 3W0CA 5DZ3A 2E2RA 4EMAA 3CS6A 1X7JA 3BC5A 2NW4A 1ZEOA 3A9EA 4S15A 4IA2A 3B5RA 3X1IA 2QZOA 2QW4A 3X1HA 2Q59A 3AN3A 3KWYA 2P15A 4OLMA 1XQ3A 2PIPL 3R29A 4YPQA 2ZNOA 4UDBA 5HJPA 4ZNTA 4QL8A 2HBHA 3GYUA 3CLDA 3OLLA 4IWCA 4PP5A 4ZJWA 3EYBA 1OVLA 2ZLAA 3P89A 4OKTA 1S0XA 1L2IA 3OKIA 2PIRA 2GP7A 4RZEA 2W8YA 4WQPA 4BCRA 5AAUA 2GTKA 5JJMB 4PLDA 1XNXA 1I37A 3GYTA 3A40X 3ET1A 5DI7A 3UVVA 4S0SA 1Y9RA 1YMTA 3E7CA 3BEJA 3VTBA 5DUEA 3PRGA 2NXXA 2Q1HA 1EXXA 3ILZA 5APHA 4ZN9A 4XTAA 2ZK4A 4QE6A 4OKWA 2Q3YA 3V49A 1EXAA 4RAKA 4WLBA 4NIEA 4CI5A 5AAVB 5HJPB 3KDTA 4ZNVA 4RUOX 4OEYA 3B66A 1G2NA 1GWRA 4HLWA 3RUUA 4NUFA 3PLZA 5EGVA 3KFCA 3L0EA 5E0XA 4DOSA 4WVDA 2NV7A 1A52A 1WM0X 3WGPA 2HFPA 3JZCA 4G2HA 1M2ZA 4UDAA 2OVMA 2QABA 3SZ1A 4IV4A 5IXKA 2ZK1A 4ITFA 1QKNA 1FBYA 2I0JA 2ZNPA 5E19A 2Q7JA 3WFFA 4A2JA 4E4QA 2AMBA 2OAXA 5KRLA 1YUCA 5C4TA 3IA6A 4Q50A 5JI0D 1U3QA 4MG9A 5GT4A 2VSTA 3VT8A 1R5KA 3B68A 4J5XA 4RMCA 1N4HA 3AN4A 1PK5A 2VV3A 4ZNHA 5KRAA 2Q5PA 1QKTA 3OLFA 4TUZA 2AB2A 1T79A 5AWJA 1XDKA 5DXMA 2PIQA 3KPZA 5IAWA 5FQTA 1NQ7A 1XV9A 2P4YA 3L03A 3AUQA 1PDUA 2I0GA 4XUMA 3ZRBA 2OM9A 3ADUA 1L2JA 5DMCA 4REFA 3HC6A 3UU7B 1ZAFA 1PZLA 3FC6B 1NAXA 4OIUA 2XYWA 3VTDA 3VRWA 4JGVA 3CTBA 1UHLA 2HWQA 1H9UA 4RZFA 1T76A 1Q4XA 2QGWA 2QR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IA1 A;  5C4O A;  4F9M A;  2LBD A;  4P6X A;  1X78 A;  2AYR A;  4DK8 A;  1XP9 A;  3PCU A;  4OC7 A;  4QM0 A;  5G5W A;  2AXA A;  4IWF A;  2J4A A;  5KCF A;  2VV2 A;  3UP0 A;  2ZK2 A;  2AX9 A;  4MGB B;  3WT6 A;  3K8S A;  4IW6 A;  5CJ6 A;  1MV9 A;  1X7R A;  4MG6 A;  3E00 A;  3Q95 A;  4PPS A;  5DK9 A;  5DVV A;  4PVU A;  3W0H A;  2ACL A;  3AZ1 A;  3FUG A;  3AZ3 A;  1XVP B;  3VJS A;  1IE9 A;  5L7E A;  3OMM A;  3H0A A;  3F5C A;  2Q7L A;  5DTV A;  3OOF A;  2ZBS A;  4MGC A;  4MGD B;  4PP6 A;  2ZK0 A;  3A2I A;  1T73 A;  4N73 A;  4OIL A;  4OEA A;  3W5P A;  4RFW A;  1YOK A;  2AX8 A;  1DKF B;  3N00 A;  3P0U A;  1XPC A;  3W5Q A;  3BQD A;  3CWD A;  3H52 A;  2Q7I A;  4ZNU A;  5DMF A;  4RME A;  3ERD A;  3IXP A;  2Q6J A;  4MG7 A;  5DWE A;  3S9S A;  2POB A;  3MNP A;  4MG8 B;  2HAR A;  1OT7 A;  1ILH A;  2AA7 A;  5DKE A;  2HB7 A;  1NQ1 A;  2J7X A;  3FEJ A;  2VSR A;  3OS9 A;  2I4Z A;  1U3R A;  5DXB B;  5DZ1 A;  3PO9 A;  1G1U A;  2XYJ A;  3VHU A;  1R1K A;  3VJH A;  2ZNN A;  3U9Q A;  2YLP A;  4ZO1 X;  5DID A;  3VHW A;  3W5T A;  3WFG A;  3VT9 A;  3KMG A;  1Z95 A;  3DR1 A;  1U3S A;  1S9Q A;  4IUI A;  1ILG A;  3HM1 A;  1XLS A;  4OJ9 A;  5GIC A;  1P8D A;  1A28 A;  4CSJ A;  2HCD A;  1I7G A;  5KYJ A;  1FD0 A;  4RZG A;  5JY3 A;  3VSO A;  3DY6 A;  3W5R A;  2ZMJ A;  2JFA B;  5EIT A;  4RWV A;  2I4J A;  3FAL A;  2R40 D;  2AO6 A;  3HO0 A;  4MGA A;  1X76 A;  1PCG A;  3VT4 A;  2VV1 B;  1UPV A;  2HC4 A;  3O1D A;  1XZX X;  3OGT A;  2G0G A;  1FM9 D;  5DKS A;  4IQR A;  3IPQ A;  4L98 A;  1YP0 A;  3B67 A;  1T7F A;  4ZN7 A;  1PQC A;  1Z5X U;  2PIT A;  3OSW A;  3UUD B;  2GPV A;  3V3Q A;  3V9V A;  4FHI A;  3R8I A;  4KZM A;  3OKH A;  5DSH A;  1T7T A;  2AA6 A;  5I4V A;  4IVW A;  1FCY A;  4OHA A;  1LV2 A;  1YJE A;  2YLO A;  4A4V A;  5SYZ A;  5DZ0 A;  3A9E B;  3RVF A;  4G1Y A;  4ZNS A;  4N5G A;  4NQA B;  1T65 A;  2QZO B;  3R5M A;  2AA2 A;  2Q59 B;  4LNX A;  1PQ6 A;  1OSV A;  4P6W A;  4Q0A C;  2AX6 A;  3CS4 A;  1Z5X E;  5KRK A;  2PIO A;  3R5N A;  2PIW A;  3ERT A;  1XOW A;  2OVH A;  5DXQ A;  4OIV A;  3M7R A;  4IVY A;  4HEE X;  2PIX A;  1HJ1 A;  3AFR A;  5DXK A;  1OVL B;  2QA8 A;  5EI1 A;  3B65 A;  5ICK A;  2ZK3 A;  3MNE A;  1ERR A;  4JL4 A;  3R8A A;  5FQV A;  3R8D A;  3CJW A;  4PWL A;  1R20 D;  1RDT D;  4RUP A;  4APU A;  3K23 A;  5KRI A;  3FEI A;  5E15 A;  3ET0 A;  5DXP A;  3A2H A;  1S9P A;  2NPA A;  4ZNW A;  3W0I A;  2QXS A;  4J5W C;  4J26 A;  4KZJ A;  4XI3 A;  1ZGY A;  3UVV B;  3L3Z A;  3DZU D;  5AVL A;  2OZ7 A;  2G5O A;  1MZN A;  5DL4 A;  3OOK A;  2GPO A;  2Q6S A;  3OAP A;  2QE4 A;  3VJI A;  4K6I A;  4POJ A;  1XP1 A;  1XAP A;  3D24 A;  1YYE A;  5E1C A;  2IOK A;  1SR7 A;  1XNN A;  4XUH A;  4ZI1 A;  1NUO A;  2QNV A;  2QXM A;  1ZH7 A;  3ADS A;  2YAT A;  2B50 A;  3KYT A;  4TV1 A;  3WJ4 A;  5DRJ A;  1XIU A;  4M8E A;  4PXM A;  4QE8 A;  5DIG A;  5HYK A;  2Q8S A;  3FXV A;  5DUH A;  5APK A;  4DQM A;  5H1E A;  3A78 A;  2R6Y A;  3VI8 A;  2JF9 A;  1FM6 D;  3PBA A;  4G21 A;  5KRC A;  3L0L A;  5DX3 A;  2GWX A;  2P54 A;  4OED A;  5AYG A;  1FCZ A;  3D5F A;  3SP6 A;  3VT5 A;  3MNO A;  3TKC A;  4KZI A;  4OKB A;  3VT3 A;  3VRU A;  3KMZ A;  3FS1 A;  5DKB A;  5GIE A;  3CDP A;  1S0Z A;  1IE8 A;  1NRL A;  1TFC A;  2VV0 A;  3OZJ A;  4G2I A;  5DWG A;  3NSQ A;  4UDD A;  1I38 A;  2PIN A;  1QKU A;  3B0Q A;  4UDC A;  4MG9 B;  3ADT A;  1PRG A;  3UP3 A;  3WTQ A;  4N8R A;  1MVC A;  1P93 A;  2FSZ A;  3ADV A;  2ZK6 A;  5E7V A;  5AVI A;  5AZT A;  2BJ4 A;  3DCT A;  5DKG A;  3CS8 A;  4K7A A;  3NOA A;  5L11 A;  5DYD A;  3GZ9 A;  4ZO1 B;  3RLJ A;  4MG5 A;  4TUZ B;  2ZKC A;  4POH A;  4RE8 A;  4PPP A;  1XDK B;  1Y0S A;  1M13 A;  1ZUC A;  2G0H A;  4PRG A;  5G45 A;  2QGT A;  3X36 A;  3VRV A;  1T7R A;  2PKL A;  3L3X A;  4S0T A;  2HAM A;  3RLL A;  3HC5 A;  1XV9 B;  3CQV A;  1T7M A;  1I7I A;  1OSH A;  4JAZ A;  5DX3 B;  1YIM A;  2QTU A;  1YY4 A;  4G1Z A;  2YHD A;  2Z4J A;  3TY0 A;  3HLV A;  3B3K A;  4LSJ A;  1UHL B;  2PNU A;  2GPP A;  4CI4 A;  4YT1 A;  3VN2 A;  2Q5S A;  5KD9 A;  4ITE A;  5KR9 A;  4OJB A;  2Q6R A;  2F4B A;  2Z4B A;  4OZR E;  3WT5 A;  4JYH A;  5G3J A;  2B1Z A;  3WWR A;  1RKG A;  3DZY D;  3UUA A;  1X7E A;  1QKM A;  2Q1V A;  2YFE A;  2YLY A;  3OMO A;  5DWL A;  2ZK5 A;  2PIV A;  4DOR A;  5KYA A;  4JYG A;  5IZ0 A;  4DM8 A;  1R6G A;  3R2A A;  3Q95 B;  5KCD A;  2Q7K A;  2B23 A;  5F9B A;  4IV2 A;  5FQP A;  3ZR7 A;  2PRG A;  2ACL B;  2QA6 A;  3OMP A;  2GIU A;  3RY9 A;  4YMQ A;  3W0G A;  2HVC A;  3VSP A;  5DVS A;  5DP0 A;  2O4R A;  2ZXN A;  3F5C B;  3VRT A;  2HWR A;  5LGA A;  3AX8 A;  2ZFX A;  2P1V A;  4OJ4 A;  4OK1 A;  5DY8 A;  2FVJ A;  1N83 A;  2R6W A;  4J5W A;  1BSX A;  5ETH A;  3GD2 A;  4LTW A;  4IA7 A;  2Q61 A;  1Y0X X;  4DMA A;  3IPS A;  4FGY A;  3B1M A;  4OZT U;  2V7C A;  4ONI A;  5JJM A;  3V9Y A;  4X1G A;  3A2J A;  4R6S A;  5KRJ A;  1KV6 A;  4MG7 B;  3WT7 A;  3ZQT A;  2R40 A;  2V0V A;  4IS8 A;  1FCX A;  5DXG A;  5DV3 A;  2P1T A;  1NYX A;  3SP9 A;  5AZV A;  3OZ0 A;  5DZH A;  3G0W A;  4E4K A;  3GWS X;  4B7W A;  1M7W A;  4JYI A;  1FM9 A;  3D57 A;  2YJD A;  4FN9 A;  2AWH A;  3CDS A;  4N1Y A;  4OFR A;  4ZJR A;  3B0T A;  2I4P A;  5KCT A;  2YJA B;  1T74 A;  5AAV A;  5B5B A;  1K7L A;  5DLR A;  2XYX A;  3V4A A;  3VT6 A;  5KCW A;  4OZT E;  4O8F A;  1GWQ A;  4RMD A;  3FAL B;  3G8I A;  1ERE A;  4MGA B;  3LBD A;  1ZDU A;  2G44 A;  2ATH A;  1VJB A;  1GS4 A;  3ET3 A;  4OAR A;  4QJR A;  4R06 A;  1NDE A;  3WMH A;  2VV4 A;  4DK7 A;  1XQC A;  3FLI A;  3AUR A;  5AWK A;  3OLS A;  2J7Y A;  4OKX A;  2OCF A;  5DV8 A;  2ZY0 A;  5G44 A;  4OFU A;  2ZLC A;  4Q13 A;  1NAV A;  2ZAS A;  4J24 A;  1S19 A;  4FNE A;  2QPY A;  3VJT A;  2PIU A;  2NXX E;  3GN8 A;  5DWJ A;  1K4W A;  4M8H A;  5DYB A;  5KRH A;  2YLQ A;  5L7H A;  1SKX A;  5DVC A;  3V3E A;  2ZMI A;  3AUN A;  1XJ7 A;  5HCV A;  2H79 A;  4IW8 A;  3T03 A;  1UPW A;  4FHH A;  4YNK A;  5KRM A;  2A3I A;  4MDD A;  3KBA A;  5APJ A;  3K22 A;  2J14 A;  3UUC A;  4WHG A;  3G8O A;  5AK2 A;  2P7G A;  2REW A;  1R20 A;  1RDT A;  3W0Y A;  3OS8 C;  3OSI A;  1K74 D;  1RK3 A;  4PLE A;  3V9T A;  2H77 A;  1YIN A;  1NQ0 A;  4XT9 A;  3DCU A;  3UU7 A;  3FC6 A;  3DZU A;  2AMA A;  4DM6 A;  3ADW A;  2VV4 B;  1G5Y A;  3FUR A;  5DZI A;  2ZVT A;  3KDU A;  5KCU A;  4ZOM A;  2QA8 B;  5DWI A;  5G42 A;  3RUT A;  5E0W A;  3B0W A;  5C4S A;  3GBK A;  1K74 A;  2B1V A;  2P7Z A;  3KMR A;  3OMQ A;  3TKM A;  2O4J A;  4MGB A;  1ZDT A;  2PJL A;  5HZC A;  5DXR A;  1N46 A;  1FM6 A;  3P88 A;  5C4U A;  5L7G A;  3P8X A;  5ACC A;  1XVP A;  1E3K A;  2BAW A;  2O9I A;  2IOG A;  1RJK A;  3OMK A;  4QK4 A;  4X1F A;  5KCC A;  5DUG A;  4OZR U;  5HYR A;  3D90 A;  1KKQ A;  4REE A;  4MGD A;  2AA5 A;  1XB7 A;  2P7A A;  2ZL9 A;  3D6D A;  4G1D A;  3VHV A;  4IA3 A;  4TV1 B;  4PP3 A;  2QSE A;  1DKF A;  5DXE A;  3L0J A;  2P1U A;  3PEQ A;  4L96 A;  4LNW A;  3E00 D;  3NSP A;  3GWX A;  2ZNQ A;  5KRF A;  5M96 A;  1SJ0 A;  4S14 A;  2AM9 A;  2GL8 A;  5G46 A;  4OH5 A;  1E3G A;  2QMV A;  1NHZ A;  2OUZ A;  3O1E A;  5GID A;  5DU5 A;  4MG8 A;  1PQ9 A;  3H0A D;  1TXI A;  4K4J A;  4Y29 A;  1U9E A;  1YA3 A;  3E94 A;  3QT0 A;  3TX7 B;  2QH6 A;  3AZ2 A;  1NQ2 A;  5DXB A;  2HAS A;  3W0A A;  2AAX A;  2Q5G A;  1UOM A;  1RKH A;  4R2U A;  3ZRA A;  1YOW A;  5KCE A;  4G20 A;  3VT7 A;  3HVL A;  3X31 A;  3HOD A;  1G50 A;  3ADX A;  2IHQ A;  5HJS A;  1SQN A;  3IPU A;  5LWP A;  4PF3 A;  5A86 A;  3IXP D;  2JFA A;  1LBD A;  2BJ4 B;  5K13 A;  5FQS A;  2Q70 A;  1XP6 A;  1HG4 A;  1T5Z A;  3A3Z X;  3WJ5 A;  1ZKY A;  3JZB A;  4NY9 A;  5EJV A;  2Q60 A;  4EM9 A;  2VV1 A;  5DRM A;  3ET2 A;  3DZY A;  3K6P A;  2AX7 A;  4RUJ A;  4OH6 A;  2XHS A;  5EHJ A;  1R1K D;  4XLD A;  5FQR A;  3F7D A;  4OGH A;  2GPU A;  4A4W A;  2ZXM A;  4J5X C;  5DIE A;  4E2J A;  3DT3 A;  5G43 A;  2EWP A;  2JJ3 A;  3IMY A;  4LBD A;  5B41 A;  3G9E A;  4OEZ A;  1KNU A;  3VTC A;  2ZMH A;  2FAI A;  3OSA A;  4NB6 A;  3UUD A;  1T63 A;  2ZXZ A;  3LMP A;  2ABI A;  3HQ5 A;  4XAO A;  3L1B A;  3W0J A;  2XKW A;  5KRO A;  2POG A;  3OS8 A;  5EC9 A;  5DV6 A;  1XLS E;  3B0R A;  4IU7 A;  4WPF A;  4WHF A;  1DB1 A;  1GWX A;  1X7B A;  2HB8 A;  4XHD A;  3HZF A;  5E14 A;  3UUA B;  3W0C A;  5DZ3 A;  2E2R A;  4EMA A;  3CS6 A;  1X7J A;  3BC5 A;  2NW4 A;  1ZEO A;  3A9E A;  4S15 A;  4IA2 A;  3B5R A;  3X1I A;  2QZO A;  2QW4 A;  3X1H A;  2Q59 A;  3AN3 A;  3KWY A;  2P15 A;  4OLM A;  1XQ3 A;  2PIP L;  3R29 A;  4YPQ A;  2ZNO A;  4UDB A;  5HJP A;  4ZNT A;  4QL8 A;  2HBH A;  3GYU A;  3CLD A;  3OLL A;  4IWC A;  4PP5 A;  4ZJW A;  3EYB A;  1OVL A;  2ZLA A;  3P89 A;  4OKT A;  1S0X A;  1L2I A;  3OKI A;  2PIR A;  2GP7 A;  4RZE A;  2W8Y A;  4WQP A;  4BCR A;  5AAU A;  2GTK A;  5JJM B;  4PLD A;  1XNX A;  1I37 A;  3GYT A;  3A40 X;  3ET1 A;  5DI7 A;  3UVV A;  4S0S A;  1Y9R A;  1YMT A;  3E7C A;  3BEJ A;  3VTB A;  5DUE A;  3PRG A;  2NXX A;  2Q1H A;  1EXX A;  3ILZ A;  5APH A;  4ZN9 A;  4XTA A;  2ZK4 A;  4QE6 A;  4OKW A;  2Q3Y A;  3V49 A;  1EXA A;  4RAK A;  4WLB A;  4NIE A;  4CI5 A;  5AAV B;  5HJP B;  3KDT A;  4ZNV A;  4RUO X;  4OEY A;  3B66 A;  1G2N A;  1GWR A;  4HLW A;  3RUU A;  4NUF A;  3PLZ A;  5EGV A;  3KFC A;  3L0E A;  5E0X A;  4DOS A;  4WVD A;  2NV7 A;  1A52 A;  1WM0 X;  3WGP A;  2HFP A;  3JZC A;  4G2H A;  1M2Z A;  4UDA A;  2OVM A;  2QAB A;  3SZ1 A;  4IV4 A;  5IXK A;  2ZK1 A;  4ITF A;  1QKN A;  1FBY A;  2I0J A;  2ZNP A;  5E19 A;  2Q7J A;  3WFF A;  4A2J A;  4E4Q A;  2AMB A;  2OAX A;  5KRL A;  1YUC A;  5C4T A;  3IA6 A;  4Q50 A;  5JI0 D;  1U3Q A;  4MG9 A;  5GT4 A;  2VST A;  3VT8 A;  1R5K A;  3B68 A;  4J5X A;  4RMC A;  1N4H A;  3AN4 A;  1PK5 A;  2VV3 A;  4ZNH A;  5KRA A;  2Q5P A;  1QKT A;  3OLF A;  4TUZ A;  2AB2 A;  1T79 A;  5AWJ A;  1XDK A;  5DXM A;  2PIQ A;  3KPZ A;  5IAW A;  5FQT A;  1NQ7 A;  1XV9 A;  2P4Y A;  3L03 A;  3AUQ A;  1PDU A;  2I0G A;  4XUM A;  3ZRB A;  2OM9 A;  3ADU A;  1L2J A;  5DMC A;  4REF A;  3HC6 A;  3UU7 B;  1ZAF A;  1PZL A;  3FC6 B;  1NAX A;  4OIU A;  2XYW A;  3VTD A;  3VRW A;  4JGV A;  3CTB A;  1UHL A;  2HWQ A;  1H9U A;  4RZF A;  1T76 A;  1Q4X A;  2QGW A;  2QR9 A; 
#chains in the Genus database with same CATH topology
 4IA1 A;  5C4O A;  4F9M A;  2LBD A;  4P6X A;  1X78 A;  2AYR A;  4DK8 A;  1XP9 A;  3PCU A;  4OC7 A;  4QM0 A;  5G5W A;  2AXA A;  4IWF A;  2J4A A;  5KCF A;  2VV2 A;  3UP0 A;  2ZK2 A;  2AX9 A;  4MGB B;  3WT6 A;  3K8S A;  4IW6 A;  5CJ6 A;  1MV9 A;  1X7R A;  4MG6 A;  3E00 A;  3Q95 A;  4PPS A;  5DK9 A;  5DVV A;  4PVU A;  3W0H A;  2ACL A;  3AZ1 A;  3FUG A;  3AZ3 A;  1XVP B;  3VJS A;  1IE9 A;  5L7E A;  3OMM A;  3H0A A;  3F5C A;  2Q7L A;  5DTV A;  3OOF A;  2ZBS A;  4MGC A;  4MGD B;  4PP6 A;  2ZK0 A;  3A2I A;  1T73 A;  4N73 A;  4OIL A;  4OEA A;  3W5P A;  4RFW A;  1YOK A;  2AX8 A;  1DKF B;  3N00 A;  3P0U A;  1XPC A;  3W5Q A;  3BQD A;  3CWD A;  3H52 A;  2Q7I A;  4ZNU A;  5DMF A;  4RME A;  3ERD A;  3IXP A;  2Q6J A;  4MG7 A;  5DWE A;  3S9S A;  2POB A;  3MNP A;  4MG8 B;  2HAR A;  1OT7 A;  1ILH A;  2AA7 A;  5DKE A;  2HB7 A;  1NQ1 A;  2J7X A;  3FEJ A;  2VSR A;  3OS9 A;  2I4Z A;  1U3R A;  5DXB B;  5DZ1 A;  3PO9 A;  1G1U A;  2XYJ A;  3VHU A;  1R1K A;  3VJH A;  2ZNN A;  3U9Q A;  2YLP A;  4ZO1 X;  5DID A;  3VHW A;  3W5T A;  3WFG A;  3VT9 A;  3KMG A;  1Z95 A;  3DR1 A;  1U3S A;  1S9Q A;  4IUI A;  1ILG A;  3HM1 A;  1XLS A;  4OJ9 A;  5GIC A;  1P8D A;  1A28 A;  4CSJ A;  2HCD A;  1I7G A;  5KYJ A;  1FD0 A;  4RZG A;  5JY3 A;  3VSO A;  3DY6 A;  3W5R A;  2ZMJ A;  2JFA B;  5EIT A;  4RWV A;  2I4J A;  3FAL A;  2R40 D;  2AO6 A;  3HO0 A;  4MGA A;  1X76 A;  1PCG A;  3VT4 A;  2VV1 B;  1UPV A;  2HC4 A;  3O1D A;  1XZX X;  3OGT A;  2G0G A;  1FM9 D;  5DKS A;  4IQR A;  3IPQ A;  4L98 A;  1YP0 A;  3B67 A;  1T7F A;  4ZN7 A;  1PQC A;  1Z5X U;  2PIT A;  3OSW A;  3UUD B;  2GPV A;  3V3Q A;  3V9V A;  4FHI A;  3R8I A;  4KZM A;  3OKH A;  5DSH A;  1T7T A;  2AA6 A;  5I4V A;  4IVW A;  1FCY A;  4OHA A;  1LV2 A;  1YJE A;  2YLO A;  4A4V A;  5SYZ A;  5DZ0 A;  3A9E B;  3RVF A;  4G1Y A;  4ZNS A;  4N5G A;  4NQA B;  1T65 A;  2QZO B;  3R5M A;  2AA2 A;  2Q59 B;  4LNX A;  1PQ6 A;  1OSV A;  4P6W A;  4Q0A C;  2AX6 A;  3CS4 A;  1Z5X E;  5KRK A;  2PIO A;  3R5N A;  2PIW A;  3ERT A;  1XOW A;  2OVH A;  5DXQ A;  4OIV A;  3M7R A;  4IVY A;  4HEE X;  2PIX A;  1HJ1 A;  3AFR A;  5DXK A;  1OVL B;  2QA8 A;  5EI1 A;  3B65 A;  5ICK A;  2ZK3 A;  3MNE A;  1ERR A;  4JL4 A;  3R8A A;  5FQV A;  3R8D A;  3CJW A;  4PWL A;  1R20 D;  1RDT D;  4RUP A;  4APU A;  3K23 A;  5KRI A;  3FEI A;  5E15 A;  3ET0 A;  5DXP A;  3A2H A;  1S9P A;  2NPA A;  4ZNW A;  3W0I A;  2QXS A;  4J5W C;  4J26 A;  4KZJ A;  4XI3 A;  1ZGY A;  3UVV B;  3L3Z A;  3DZU D;  5AVL A;  2OZ7 A;  2G5O A;  1MZN A;  5DL4 A;  3OOK A;  2GPO A;  2Q6S A;  3OAP A;  2QE4 A;  3VJI A;  4K6I A;  4POJ A;  1XP1 A;  1XAP A;  3D24 A;  1YYE A;  5E1C A;  2IOK A;  1SR7 A;  1XNN A;  4XUH A;  4ZI1 A;  1NUO A;  2QNV A;  2QXM A;  1ZH7 A;  3ADS A;  2YAT A;  2B50 A;  3KYT A;  4TV1 A;  3WJ4 A;  5DRJ A;  1XIU A;  4M8E A;  4PXM A;  4QE8 A;  5DIG A;  5HYK A;  2Q8S A;  3FXV A;  5DUH A;  5APK A;  4DQM A;  5H1E A;  3A78 A;  2R6Y A;  3VI8 A;  2JF9 A;  1FM6 D;  3PBA A;  4G21 A;  5KRC A;  3L0L A;  5DX3 A;  2GWX A;  2P54 A;  4OED A;  5AYG A;  1FCZ A;  3D5F A;  3SP6 A;  3VT5 A;  3MNO A;  3TKC A;  4KZI A;  4OKB A;  3VT3 A;  3VRU A;  3KMZ A;  3FS1 A;  5DKB A;  5GIE A;  3CDP A;  1S0Z A;  1IE8 A;  1NRL A;  1TFC A;  2VV0 A;  3OZJ A;  4G2I A;  5DWG A;  3NSQ A;  4UDD A;  1I38 A;  2PIN A;  1QKU A;  3B0Q A;  4UDC A;  4MG9 B;  3ADT A;  1PRG A;  3UP3 A;  3WTQ A;  4N8R A;  1MVC A;  1P93 A;  2FSZ A;  3ADV A;  2ZK6 A;  5E7V A;  5AVI A;  5AZT A;  2BJ4 A;  3DCT A;  5DKG A;  3CS8 A;  4K7A A;  3NOA A;  5L11 A;  5DYD A;  3GZ9 A;  4ZO1 B;  3RLJ A;  4MG5 A;  4TUZ B;  2ZKC A;  4POH A;  4RE8 A;  4PPP A;  1XDK B;  1Y0S A;  1M13 A;  1ZUC A;  2G0H A;  4PRG A;  5G45 A;  2QGT A;  3X36 A;  3VRV A;  1T7R A;  2PKL A;  3L3X A;  4S0T A;  2HAM A;  3RLL A;  3HC5 A;  1XV9 B;  3CQV A;  1T7M A;  1I7I A;  1OSH A;  4JAZ A;  5DX3 B;  1YIM A;  2QTU A;  1YY4 A;  4G1Z A;  2YHD A;  2Z4J A;  3TY0 A;  3HLV A;  3B3K A;  4LSJ A;  1UHL B;  2PNU A;  2GPP A;  4CI4 A;  4YT1 A;  3VN2 A;  2Q5S A;  5KD9 A;  4ITE A;  5KR9 A;  4OJB A;  2Q6R A;  2F4B A;  2Z4B A;  4OZR E;  3WT5 A;  4JYH A;  5G3J A;  2B1Z A;  3WWR A;  1RKG A;  3DZY D;  3UUA A;  1X7E A;  1QKM A;  2Q1V A;  2YFE A;  2YLY A;  3OMO A;  5DWL A;  2ZK5 A;  2PIV A;  4DOR A;  5KYA A;  4JYG A;  5IZ0 A;  4DM8 A;  1R6G A;  3R2A A;  3Q95 B;  5KCD A;  2Q7K A;  2B23 A;  5F9B A;  4IV2 A;  5FQP A;  3ZR7 A;  2PRG A;  2ACL B;  2QA6 A;  3OMP A;  2GIU A;  3RY9 A;  4YMQ A;  3W0G A;  2HVC A;  3VSP A;  5DVS A;  5DP0 A;  2O4R A;  2ZXN A;  3F5C B;  3VRT A;  2HWR A;  5LGA A;  3AX8 A;  2ZFX A;  2P1V A;  4OJ4 A;  4OK1 A;  5DY8 A;  2FVJ A;  1N83 A;  2R6W A;  4J5W A;  1BSX A;  5ETH A;  3GD2 A;  4LTW A;  4IA7 A;  2Q61 A;  1Y0X X;  4DMA A;  3IPS A;  4FGY A;  3B1M A;  4OZT U;  2V7C A;  4ONI A;  5JJM A;  3V9Y A;  4X1G A;  3A2J A;  4R6S A;  5KRJ A;  1KV6 A;  4MG7 B;  3WT7 A;  3ZQT A;  2R40 A;  2V0V A;  4IS8 A;  1FCX A;  5DXG A;  5DV3 A;  2P1T A;  1NYX A;  3SP9 A;  5AZV A;  3OZ0 A;  5DZH A;  3G0W A;  4E4K A;  3GWS X;  4B7W A;  1M7W A;  4JYI A;  1FM9 A;  3D57 A;  2YJD A;  4FN9 A;  2AWH A;  3CDS A;  4N1Y A;  4OFR A;  4ZJR A;  3B0T A;  2I4P A;  5KCT A;  2YJA B;  1T74 A;  5AAV A;  5B5B A;  1K7L A;  5DLR A;  2XYX A;  3V4A A;  3VT6 A;  5KCW A;  4OZT E;  4O8F A;  1GWQ A;  4RMD A;  3FAL B;  3G8I A;  1ERE A;  4MGA B;  3LBD A;  1ZDU A;  2G44 A;  2ATH A;  1VJB A;  1GS4 A;  3ET3 A;  4OAR A;  4QJR A;  4R06 A;  1NDE A;  3WMH A;  2VV4 A;  4DK7 A;  1XQC A;  3FLI A;  3AUR A;  5AWK A;  3OLS A;  2J7Y A;  4OKX A;  2OCF A;  5DV8 A;  2ZY0 A;  5G44 A;  4OFU A;  2ZLC A;  4Q13 A;  1NAV A;  2ZAS A;  4J24 A;  1S19 A;  4FNE A;  2QPY A;  3VJT A;  2PIU A;  2NXX E;  3GN8 A;  5DWJ A;  1K4W A;  4M8H A;  5DYB A;  5KRH A;  2YLQ A;  5L7H A;  1SKX A;  5DVC A;  3V3E A;  2ZMI A;  3AUN A;  1XJ7 A;  5HCV A;  2H79 A;  4IW8 A;  3T03 A;  1UPW A;  4FHH A;  4YNK A;  5KRM A;  2A3I A;  4MDD A;  3KBA A;  5APJ A;  3K22 A;  2J14 A;  3UUC A;  4WHG A;  3G8O A;  5AK2 A;  2P7G A;  2REW A;  1R20 A;  1RDT A;  3W0Y A;  3OS8 C;  3OSI A;  1K74 D;  1RK3 A;  4PLE A;  3V9T A;  2H77 A;  1YIN A;  1NQ0 A;  4XT9 A;  3DCU A;  3UU7 A;  3FC6 A;  3DZU A;  2AMA A;  4DM6 A;  3ADW A;  2VV4 B;  1G5Y A;  3FUR A;  5DZI A;  2ZVT A;  3KDU A;  5KCU A;  4ZOM A;  2QA8 B;  5DWI A;  5G42 A;  3RUT A;  5E0W A;  3B0W A;  5C4S A;  3GBK A;  1K74 A;  2B1V A;  2P7Z A;  3KMR A;  3OMQ A;  3TKM A;  2O4J A;  4MGB A;  1ZDT A;  2PJL A;  5HZC A;  5DXR A;  1N46 A;  1FM6 A;  3P88 A;  5C4U A;  5L7G A;  3P8X A;  5ACC A;  1XVP A;  1E3K A;  2BAW A;  2O9I A;  2IOG A;  1RJK A;  3OMK A;  4QK4 A;  4X1F A;  5KCC A;  5DUG A;  4OZR U;  5HYR A;  3D90 A;  1KKQ A;  4REE A;  4MGD A;  2AA5 A;  1XB7 A;  2P7A A;  2ZL9 A;  3D6D A;  4G1D A;  3VHV A;  4IA3 A;  4TV1 B;  4PP3 A;  2QSE A;  1DKF A;  5DXE A;  3L0J A;  2P1U A;  3PEQ A;  4L96 A;  4LNW A;  3E00 D;  3NSP A;  3GWX A;  2ZNQ A;  5KRF A;  5M96 A;  1SJ0 A;  4S14 A;  2AM9 A;  2GL8 A;  5G46 A;  4OH5 A;  1E3G A;  2QMV A;  1NHZ A;  2OUZ A;  3O1E A;  5GID A;  5DU5 A;  4MG8 A;  1PQ9 A;  3H0A D;  1TXI A;  4K4J A;  4Y29 A;  1U9E A;  1YA3 A;  3E94 A;  3QT0 A;  3TX7 B;  2QH6 A;  3AZ2 A;  1NQ2 A;  5DXB A;  2HAS A;  3W0A A;  2AAX A;  2Q5G A;  1UOM A;  1RKH A;  4R2U A;  3ZRA A;  1YOW A;  5KCE A;  4G20 A;  3VT7 A;  3HVL A;  3X31 A;  3HOD A;  1G50 A;  3ADX A;  2IHQ A;  5HJS A;  1SQN A;  3IPU A;  5LWP A;  4PF3 A;  5A86 A;  3IXP D;  2JFA A;  1LBD A;  2BJ4 B;  5K13 A;  5FQS A;  2Q70 A;  1XP6 A;  1HG4 A;  1T5Z A;  3A3Z X;  3WJ5 A;  1ZKY A;  3JZB A;  4NY9 A;  5EJV A;  2Q60 A;  4EM9 A;  2VV1 A;  5DRM A;  3ET2 A;  3DZY A;  3K6P A;  2AX7 A;  4RUJ A;  4OH6 A;  2XHS A;  5EHJ A;  1R1K D;  4XLD A;  5FQR A;  3F7D A;  4OGH A;  2GPU A;  4A4W A;  2ZXM A;  4J5X C;  5DIE A;  4E2J A;  3DT3 A;  5G43 A;  2EWP A;  2JJ3 A;  3IMY A;  4LBD A;  5B41 A;  3G9E A;  4OEZ A;  1KNU A;  3VTC A;  2ZMH A;  2FAI A;  3OSA A;  4NB6 A;  3UUD A;  1T63 A;  2ZXZ A;  3LMP A;  2ABI A;  3HQ5 A;  4XAO A;  3L1B A;  3W0J A;  2XKW A;  5KRO A;  2POG A;  3OS8 A;  5EC9 A;  5DV6 A;  1XLS E;  3B0R A;  4IU7 A;  4WPF A;  4WHF A;  1DB1 A;  1GWX A;  1X7B A;  2HB8 A;  4XHD A;  3HZF A;  5E14 A;  3UUA B;  3W0C A;  5DZ3 A;  2E2R A;  4EMA A;  3CS6 A;  1X7J A;  3BC5 A;  2NW4 A;  1ZEO A;  3A9E A;  4S15 A;  4IA2 A;  3B5R A;  3X1I A;  2QZO A;  2QW4 A;  3X1H A;  2Q59 A;  3AN3 A;  3KWY A;  2P15 A;  4OLM A;  1XQ3 A;  2PIP L;  3R29 A;  4YPQ A;  2ZNO A;  4UDB A;  5HJP A;  4ZNT A;  4QL8 A;  2HBH A;  3GYU A;  3CLD A;  3OLL A;  4IWC A;  4PP5 A;  4ZJW A;  3EYB A;  1OVL A;  2ZLA A;  3P89 A;  4OKT A;  1S0X A;  1L2I A;  3OKI A;  2PIR A;  2GP7 A;  4RZE A;  2W8Y A;  4WQP A;  4BCR A;  5AAU A;  2GTK A;  5JJM B;  4PLD A;  1XNX A;  1I37 A;  3GYT A;  3A40 X;  3ET1 A;  5DI7 A;  3UVV A;  4S0S A;  1Y9R A;  1YMT A;  3E7C A;  3BEJ A;  3VTB A;  5DUE A;  3PRG A;  2NXX A;  2Q1H A;  1EXX A;  3ILZ A;  5APH A;  4ZN9 A;  4XTA A;  2ZK4 A;  4QE6 A;  4OKW A;  2Q3Y A;  3V49 A;  1EXA A;  4RAK A;  4WLB A;  4NIE A;  4CI5 A;  5AAV B;  5HJP B;  3KDT A;  4ZNV A;  4RUO X;  4OEY A;  3B66 A;  1G2N A;  1GWR A;  4HLW A;  3RUU A;  4NUF A;  3PLZ A;  5EGV A;  3KFC A;  3L0E A;  5E0X A;  4DOS A;  4WVD A;  2NV7 A;  1A52 A;  1WM0 X;  3WGP A;  2HFP A;  3JZC A;  4G2H A;  1M2Z A;  4UDA A;  2OVM A;  2QAB A;  3SZ1 A;  4IV4 A;  5IXK A;  2ZK1 A;  4ITF A;  1QKN A;  1FBY A;  2I0J A;  2ZNP A;  5E19 A;  2Q7J A;  3WFF A;  4A2J A;  4E4Q A;  2AMB A;  2OAX A;  5KRL A;  1YUC A;  5C4T A;  3IA6 A;  4Q50 A;  5JI0 D;  1U3Q A;  4MG9 A;  5GT4 A;  2VST A;  3VT8 A;  1R5K A;  3B68 A;  4J5X A;  4RMC A;  1N4H A;  3AN4 A;  1PK5 A;  2VV3 A;  4ZNH A;  5KRA A;  2Q5P A;  1QKT A;  3OLF A;  4TUZ A;  2AB2 A;  1T79 A;  5AWJ A;  1XDK A;  5DXM A;  2PIQ A;  3KPZ A;  5IAW A;  5FQT A;  1NQ7 A;  1XV9 A;  2P4Y A;  3L03 A;  3AUQ A;  1PDU A;  2I0G A;  4XUM A;  3ZRB A;  2OM9 A;  3ADU A;  1L2J A;  5DMC A;  4REF A;  3HC6 A;  3UU7 B;  1ZAF A;  1PZL A;  3FC6 B;  1NAX A;  4OIU A;  2XYW A;  3VTD A;  3VRW A;  4JGV A;  3CTB A;  1UHL A;  2HWQ A;  1H9U A;  4RZF A;  1T76 A;  1Q4X A;  2QGW A;  2QR9 A; 
#chains in the Genus database with same CATH homology
 4IA1 A;  5C4O A;  4F9M A;  2LBD A;  4P6X A;  1X78 A;  2AYR A;  4DK8 A;  1XP9 A;  3PCU A;  4OC7 A;  4QM0 A;  5G5W A;  2AXA A;  4IWF A;  2J4A A;  5KCF A;  2VV2 A;  3UP0 A;  2ZK2 A;  2AX9 A;  4MGB B;  3WT6 A;  3K8S A;  4IW6 A;  5CJ6 A;  1MV9 A;  1X7R A;  4MG6 A;  3E00 A;  3Q95 A;  4PPS A;  5DK9 A;  5DVV A;  4PVU A;  3W0H A;  2ACL A;  3AZ1 A;  3FUG A;  3AZ3 A;  1XVP B;  3VJS A;  1IE9 A;  5L7E A;  3OMM A;  3H0A A;  3F5C A;  2Q7L A;  5DTV A;  3OOF A;  2ZBS A;  4MGC A;  4MGD B;  4PP6 A;  2ZK0 A;  3A2I A;  1T73 A;  4N73 A;  4OIL A;  4OEA A;  3W5P A;  4RFW A;  1YOK A;  2AX8 A;  1DKF B;  3N00 A;  3P0U A;  1XPC A;  3W5Q A;  3BQD A;  3CWD A;  3H52 A;  2Q7I A;  4ZNU A;  5DMF A;  4RME A;  3ERD A;  3IXP A;  2Q6J A;  4MG7 A;  5DWE A;  3S9S A;  2POB A;  3MNP A;  4MG8 B;  2HAR A;  1OT7 A;  1ILH A;  2AA7 A;  5DKE A;  2HB7 A;  1NQ1 A;  2J7X A;  3FEJ A;  2VSR A;  3OS9 A;  2I4Z A;  1U3R A;  5DXB B;  5DZ1 A;  3PO9 A;  1G1U A;  2XYJ A;  3VHU A;  1R1K A;  3VJH A;  2ZNN A;  3U9Q A;  2YLP A;  4ZO1 X;  5DID A;  3VHW A;  3W5T A;  3WFG A;  3VT9 A;  3KMG A;  1Z95 A;  3DR1 A;  1U3S A;  1S9Q A;  4IUI A;  1ILG A;  3HM1 A;  1XLS A;  4OJ9 A;  5GIC A;  1P8D A;  1A28 A;  4CSJ A;  2HCD A;  1I7G A;  5KYJ A;  1FD0 A;  4RZG A;  5JY3 A;  3VSO A;  3DY6 A;  3W5R A;  2ZMJ A;  2JFA B;  5EIT A;  4RWV A;  2I4J A;  3FAL A;  2R40 D;  2AO6 A;  3HO0 A;  4MGA A;  1X76 A;  1PCG A;  3VT4 A;  2VV1 B;  1UPV A;  2HC4 A;  3O1D A;  1XZX X;  3OGT A;  2G0G A;  1FM9 D;  5DKS A;  4IQR A;  3IPQ A;  4L98 A;  1YP0 A;  3B67 A;  1T7F A;  4ZN7 A;  1PQC A;  1Z5X U;  2PIT A;  3OSW A;  3UUD B;  2GPV A;  3V3Q A;  3V9V A;  4FHI A;  3R8I A;  4KZM A;  3OKH A;  5DSH A;  1T7T A;  2AA6 A;  5I4V A;  4IVW A;  1FCY A;  4OHA A;  1LV2 A;  1YJE A;  2YLO A;  4A4V A;  5SYZ A;  5DZ0 A;  3A9E B;  3RVF A;  4G1Y A;  4ZNS A;  4N5G A;  4NQA B;  1T65 A;  2QZO B;  3R5M A;  2AA2 A;  2Q59 B;  4LNX A;  1PQ6 A;  1OSV A;  4P6W A;  4Q0A C;  2AX6 A;  3CS4 A;  1Z5X E;  5KRK A;  2PIO A;  3R5N A;  2PIW A;  3ERT A;  1XOW A;  2OVH A;  5DXQ A;  4OIV A;  3M7R A;  4IVY A;  4HEE X;  2PIX A;  1HJ1 A;  3AFR A;  5DXK A;  1OVL B;  2QA8 A;  5EI1 A;  3B65 A;  5ICK A;  2ZK3 A;  3MNE A;  1ERR A;  4JL4 A;  3R8A A;  5FQV A;  3R8D A;  3CJW A;  4PWL A;  1R20 D;  1RDT D;  4RUP A;  4APU A;  3K23 A;  5KRI A;  3FEI A;  5E15 A;  3ET0 A;  5DXP A;  3A2H A;  1S9P A;  2NPA A;  4ZNW A;  3W0I A;  2QXS A;  4J5W C;  4J26 A;  4KZJ A;  4XI3 A;  1ZGY A;  3UVV B;  3L3Z A;  3DZU D;  5AVL A;  2OZ7 A;  2G5O A;  1MZN A;  5DL4 A;  3OOK A;  2GPO A;  2Q6S A;  3OAP A;  2QE4 A;  3VJI A;  4K6I A;  4POJ A;  1XP1 A;  1XAP A;  3D24 A;  1YYE A;  5E1C A;  2IOK A;  1SR7 A;  1XNN A;  4XUH A;  4ZI1 A;  1NUO A;  2QNV A;  2QXM A;  1ZH7 A;  3ADS A;  2YAT A;  2B50 A;  3KYT A;  4TV1 A;  3WJ4 A;  5DRJ A;  1XIU A;  4M8E A;  4PXM A;  4QE8 A;  5DIG A;  5HYK A;  2Q8S A;  3FXV A;  5DUH A;  5APK A;  4DQM A;  5H1E A;  3A78 A;  2R6Y A;  3VI8 A;  2JF9 A;  1FM6 D;  3PBA A;  4G21 A;  5KRC A;  3L0L A;  5DX3 A;  2GWX A;  2P54 A;  4OED A;  5AYG A;  1FCZ A;  3D5F A;  3SP6 A;  3VT5 A;  3MNO A;  3TKC A;  4KZI A;  4OKB A;  3VT3 A;  3VRU A;  3KMZ A;  3FS1 A;  5DKB A;  5GIE A;  3CDP A;  1S0Z A;  1IE8 A;  1NRL A;  1TFC A;  2VV0 A;  3OZJ A;  4G2I A;  5DWG A;  3NSQ A;  4UDD A;  1I38 A;  2PIN A;  1QKU A;  3B0Q A;  4UDC A;  4MG9 B;  3ADT A;  1PRG A;  3UP3 A;  3WTQ A;  4N8R A;  1MVC A;  1P93 A;  2FSZ A;  3ADV A;  2ZK6 A;  5E7V A;  5AVI A;  5AZT A;  2BJ4 A;  3DCT A;  5DKG A;  3CS8 A;  4K7A A;  3NOA A;  5L11 A;  5DYD A;  3GZ9 A;  4ZO1 B;  3RLJ A;  4MG5 A;  4TUZ B;  2ZKC A;  4POH A;  4RE8 A;  4PPP A;  1XDK B;  1Y0S A;  1M13 A;  1ZUC A;  2G0H A;  4PRG A;  5G45 A;  2QGT A;  3X36 A;  3VRV A;  1T7R A;  2PKL A;  3L3X A;  4S0T A;  2HAM A;  3RLL A;  3HC5 A;  1XV9 B;  3CQV A;  1T7M A;  1I7I A;  1OSH A;  4JAZ A;  5DX3 B;  1YIM A;  2QTU A;  1YY4 A;  4G1Z A;  2YHD A;  2Z4J A;  3TY0 A;  3HLV A;  3B3K A;  4LSJ A;  1UHL B;  2PNU A;  2GPP A;  4CI4 A;  4YT1 A;  3VN2 A;  2Q5S A;  5KD9 A;  4ITE A;  5KR9 A;  4OJB A;  2Q6R A;  2F4B A;  2Z4B A;  4OZR E;  3WT5 A;  4JYH A;  5G3J A;  2B1Z A;  3WWR A;  1RKG A;  3DZY D;  3UUA A;  1X7E A;  1QKM A;  2Q1V A;  2YFE A;  2YLY A;  3OMO A;  5DWL A;  2ZK5 A;  2PIV A;  4DOR A;  5KYA A;  4JYG A;  5IZ0 A;  4DM8 A;  1R6G A;  3R2A A;  3Q95 B;  5KCD A;  2Q7K A;  2B23 A;  5F9B A;  4IV2 A;  5FQP A;  3ZR7 A;  2PRG A;  2ACL B;  2QA6 A;  3OMP A;  2GIU A;  3RY9 A;  4YMQ A;  3W0G A;  2HVC A;  3VSP A;  5DVS A;  5DP0 A;  2O4R A;  2ZXN A;  3F5C B;  3VRT A;  2HWR A;  5LGA A;  3AX8 A;  2ZFX A;  2P1V A;  4OJ4 A;  4OK1 A;  5DY8 A;  2FVJ A;  1N83 A;  2R6W A;  4J5W A;  1BSX A;  5ETH A;  3GD2 A;  4LTW A;  4IA7 A;  2Q61 A;  1Y0X X;  4DMA A;  3IPS A;  4FGY A;  3B1M A;  4OZT U;  2V7C A;  4ONI A;  5JJM A;  3V9Y A;  4X1G A;  3A2J A;  4R6S A;  5KRJ A;  1KV6 A;  4MG7 B;  3WT7 A;  3ZQT A;  2R40 A;  2V0V A;  4IS8 A;  1FCX A;  5DXG A;  5DV3 A;  2P1T A;  1NYX A;  3SP9 A;  5AZV A;  3OZ0 A;  5DZH A;  3G0W A;  4E4K A;  3GWS X;  4B7W A;  1M7W A;  4JYI A;  1FM9 A;  3D57 A;  2YJD A;  4FN9 A;  2AWH A;  3CDS A;  4N1Y A;  4OFR A;  4ZJR A;  3B0T A;  2I4P A;  5KCT A;  2YJA B;  1T74 A;  5AAV A;  5B5B A;  1K7L A;  5DLR A;  2XYX A;  3V4A A;  3VT6 A;  5KCW A;  4OZT E;  4O8F A;  1GWQ A;  4RMD A;  3FAL B;  3G8I A;  1ERE A;  4MGA B;  3LBD A;  1ZDU A;  2G44 A;  2ATH A;  1VJB A;  1GS4 A;  3ET3 A;  4OAR A;  4QJR A;  4R06 A;  1NDE A;  3WMH A;  2VV4 A;  4DK7 A;  1XQC A;  3FLI A;  3AUR A;  5AWK A;  3OLS A;  2J7Y A;  4OKX A;  2OCF A;  5DV8 A;  2ZY0 A;  5G44 A;  4OFU A;  2ZLC A;  4Q13 A;  1NAV A;  2ZAS A;  4J24 A;  1S19 A;  4FNE A;  2QPY A;  3VJT A;  2PIU A;  2NXX E;  3GN8 A;  5DWJ A;  1K4W A;  4M8H A;  5DYB A;  5KRH A;  2YLQ A;  5L7H A;  1SKX A;  5DVC A;  3V3E A;  2ZMI A;  3AUN A;  1XJ7 A;  5HCV A;  2H79 A;  4IW8 A;  3T03 A;  1UPW A;  4FHH A;  4YNK A;  5KRM A;  2A3I A;  4MDD A;  3KBA A;  5APJ A;  3K22 A;  2J14 A;  3UUC A;  4WHG A;  3G8O A;  5AK2 A;  2P7G A;  2REW A;  1R20 A;  1RDT A;  3W0Y A;  3OS8 C;  3OSI A;  1K74 D;  1RK3 A;  4PLE A;  3V9T A;  2H77 A;  1YIN A;  1NQ0 A;  4XT9 A;  3DCU A;  3UU7 A;  3FC6 A;  3DZU A;  2AMA A;  4DM6 A;  3ADW A;  2VV4 B;  1G5Y A;  3FUR A;  5DZI A;  2ZVT A;  3KDU A;  5KCU A;  4ZOM A;  2QA8 B;  5DWI A;  5G42 A;  3RUT A;  5E0W A;  3B0W A;  5C4S A;  3GBK A;  1K74 A;  2B1V A;  2P7Z A;  3KMR A;  3OMQ A;  3TKM A;  2O4J A;  4MGB A;  1ZDT A;  2PJL A;  5HZC A;  5DXR A;  1N46 A;  1FM6 A;  3P88 A;  5C4U A;  5L7G A;  3P8X A;  5ACC A;  1XVP A;  1E3K A;  2BAW A;  2O9I A;  2IOG A;  1RJK A;  3OMK A;  4QK4 A;  4X1F A;  5KCC A;  5DUG A;  4OZR U;  5HYR A;  3D90 A;  1KKQ A;  4REE A;  4MGD A;  2AA5 A;  1XB7 A;  2P7A A;  2ZL9 A;  3D6D A;  4G1D A;  3VHV A;  4IA3 A;  4TV1 B;  4PP3 A;  2QSE A;  1DKF A;  5DXE A;  3L0J A;  2P1U A;  3PEQ A;  4L96 A;  4LNW A;  3E00 D;  3NSP A;  3GWX A;  2ZNQ A;  5KRF A;  5M96 A;  1SJ0 A;  4S14 A;  2AM9 A;  2GL8 A;  5G46 A;  4OH5 A;  1E3G A;  2QMV A;  1NHZ A;  2OUZ A;  3O1E A;  5GID A;  5DU5 A;  4MG8 A;  1PQ9 A;  3H0A D;  1TXI A;  4K4J A;  4Y29 A;  1U9E A;  1YA3 A;  3E94 A;  3QT0 A;  3TX7 B;  2QH6 A;  3AZ2 A;  1NQ2 A;  5DXB A;  2HAS A;  3W0A A;  2AAX A;  2Q5G A;  1UOM A;  1RKH A;  4R2U A;  3ZRA A;  1YOW A;  5KCE A;  4G20 A;  3VT7 A;  3HVL A;  3X31 A;  3HOD A;  1G50 A;  3ADX A;  2IHQ A;  5HJS A;  1SQN A;  3IPU A;  5LWP A;  4PF3 A;  5A86 A;  3IXP D;  2JFA A;  1LBD A;  2BJ4 B;  5K13 A;  5FQS A;  2Q70 A;  1XP6 A;  1HG4 A;  1T5Z A;  3A3Z X;  3WJ5 A;  1ZKY A;  3JZB A;  4NY9 A;  5EJV A;  2Q60 A;  4EM9 A;  2VV1 A;  5DRM A;  3ET2 A;  3DZY A;  3K6P A;  2AX7 A;  4RUJ A;  4OH6 A;  2XHS A;  5EHJ A;  1R1K D;  4XLD A;  5FQR A;  3F7D A;  4OGH A;  2GPU A;  4A4W A;  2ZXM A;  4J5X C;  5DIE A;  4E2J A;  3DT3 A;  5G43 A;  2EWP A;  2JJ3 A;  3IMY A;  4LBD A;  5B41 A;  3G9E A;  4OEZ A;  1KNU A;  3VTC A;  2ZMH A;  2FAI A;  3OSA A;  4NB6 A;  3UUD A;  1T63 A;  2ZXZ A;  3LMP A;  2ABI A;  3HQ5 A;  4XAO A;  3L1B A;  3W0J A;  2XKW A;  5KRO A;  2POG A;  3OS8 A;  5EC9 A;  5DV6 A;  1XLS E;  3B0R A;  4IU7 A;  4WPF A;  4WHF A;  1DB1 A;  1GWX A;  1X7B A;  2HB8 A;  4XHD A;  3HZF A;  5E14 A;  3UUA B;  3W0C A;  5DZ3 A;  2E2R A;  4EMA A;  3CS6 A;  1X7J A;  3BC5 A;  2NW4 A;  1ZEO A;  3A9E A;  4S15 A;  4IA2 A;  3B5R A;  3X1I A;  2QZO A;  2QW4 A;  3X1H A;  2Q59 A;  3AN3 A;  3KWY A;  2P15 A;  4OLM A;  1XQ3 A;  2PIP L;  3R29 A;  4YPQ A;  2ZNO A;  4UDB A;  5HJP A;  4ZNT A;  4QL8 A;  2HBH A;  3GYU A;  3CLD A;  3OLL A;  4IWC A;  4PP5 A;  4ZJW A;  3EYB A;  1OVL A;  2ZLA A;  3P89 A;  4OKT A;  1S0X A;  1L2I A;  3OKI A;  2PIR A;  2GP7 A;  4RZE A;  2W8Y A;  4WQP A;  4BCR A;  5AAU A;  2GTK A;  5JJM B;  4PLD A;  1XNX A;  1I37 A;  3GYT A;  3A40 X;  3ET1 A;  5DI7 A;  3UVV A;  4S0S A;  1Y9R A;  1YMT A;  3E7C A;  3BEJ A;  3VTB A;  5DUE A;  3PRG A;  2NXX A;  2Q1H A;  1EXX A;  3ILZ A;  5APH A;  4ZN9 A;  4XTA A;  2ZK4 A;  4QE6 A;  4OKW A;  2Q3Y A;  3V49 A;  1EXA A;  4RAK A;  4WLB A;  4NIE A;  4CI5 A;  5AAV B;  5HJP B;  3KDT A;  4ZNV A;  4RUO X;  4OEY A;  3B66 A;  1G2N A;  1GWR A;  4HLW A;  3RUU A;  4NUF A;  3PLZ A;  5EGV A;  3KFC A;  3L0E A;  5E0X A;  4DOS A;  4WVD A;  2NV7 A;  1A52 A;  1WM0 X;  3WGP A;  2HFP A;  3JZC A;  4G2H A;  1M2Z A;  4UDA A;  2OVM A;  2QAB A;  3SZ1 A;  4IV4 A;  5IXK A;  2ZK1 A;  4ITF A;  1QKN A;  1FBY A;  2I0J A;  2ZNP A;  5E19 A;  2Q7J A;  3WFF A;  4A2J A;  4E4Q A;  2AMB A;  2OAX A;  5KRL A;  1YUC A;  5C4T A;  3IA6 A;  4Q50 A;  5JI0 D;  1U3Q A;  4MG9 A;  5GT4 A;  2VST A;  3VT8 A;  1R5K A;  3B68 A;  4J5X A;  4RMC A;  1N4H A;  3AN4 A;  1PK5 A;  2VV3 A;  4ZNH A;  5KRA A;  2Q5P A;  1QKT A;  3OLF A;  4TUZ A;  2AB2 A;  1T79 A;  5AWJ A;  1XDK A;  5DXM A;  2PIQ A;  3KPZ A;  5IAW A;  5FQT A;  1NQ7 A;  1XV9 A;  2P4Y A;  3L03 A;  3AUQ A;  1PDU A;  2I0G A;  4XUM A;  3ZRB A;  2OM9 A;  3ADU A;  1L2J A;  5DMC A;  4REF A;  3HC6 A;  3UU7 B;  1ZAF A;  1PZL A;  3FC6 B;  1NAX A;  4OIU A;  2XYW A;  3VTD A;  3VRW A;  4JGV A;  3CTB A;  1UHL A;  2HWQ A;  1H9U A;  4RZF A;  1T76 A;  1Q4X A;  2QGW A;  2QR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...