5JI0D

Ppargamma-rxralpha(s427f) heterodimer in complex with src-1, rosiglitazone, and 9-cis-retanoic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
273
structure length
269
Chain Sequence
GPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PPARgamma-RXRalpha(S427F) heterodimer in complex with SRC-1, rosiglitazone, and 9-cis-retanoic acid
rcsb
molecule keywords Retinoic acid receptor RXR-alpha
molecule tags Transferase
source organism Homo sapiens
total genus 99
structure length 269
sequence length 273
ec nomenclature
pdb deposition date 2016-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5ji0D00
1YINA 4FGYA 4ZO1B 3G9EA 2G44A 2IHQA 3CJWA 5DIDA 2YJDA 4OZTU 3E7CA 2ACLB 5DZIA 5H1EA 2Q61A 3B66A 3CLDA 2EWPA 2YLYA 3JZBA 1WM0X 5DXBB 1NUOA 2AM9A 2XYWA 4TUZA 4ZNHA 4E4QA 2HVCA 4DMAA 5AZTA 3E00D 2AA5A 1S0XA 2E2RA 5DMCA 2Q7JA 2G5OA 3ADXA 2I0JA 3IXPA 3WJ5A 3D5FA 3OS9A 2REWA 3OMKA 2PIRA 2QMVA 5KRJA 5DWJA 2R40A 3O1EA 3W0AA 3DZUA 2I4PA 4TUZB 4FNEA 1ZEOA 1X7JA 1U3RA 2QA8A 2OVHA 3W0YA 3DCTA 1T63A 3FEIA 4Q50A 4JAZA 5LWPA 5L7HA 4DQMA 5APHA 4FN9A 4G1ZA 2AXAA 2I0GA 4RMCA 3DZYD 4OKTA 2AO6A 3TKMA 3QT0A 2VV3A 2YLQA 3X36A 1R1KD 4OH6A 3VHVA 4A4WA 3V9TA 1OVLB 1FCYA 5DZ0A 5IXKA 1X7RA 2QA8B 2PITA 3AZ1A 4MG6A 4OJBA 5DXKA 5HJSA 2FVJA 5AAVA 2Q7LA 3BEJA 1BSXA 3PCUA 4IA1A 5GT4A 1PRGA 4IA2A 3PBAA 1PZLA 1XDKA 2VV0A 3OSIA 3VJIA 3IPSA 3WT5A 4WHGA 5GIEA 1Y9RA 3CDPA 1ZDUA 3EYBA 1ILGA 4PPPA 1HG4A 1T74A 1RDTD 5DVCA 5E15A 4OZTE 4OJ4A 3RY9A 3VJTA 1XIUA 1XQCA 2B23A 5EITA 3VSOA 3WMHA 1T5ZA 3ZRBA 2O4RA 4CI5A 3E00A 4IVWA 2AMBA 3ADVA 3VT5A 5C4OA 5KR9A 4O8FA 3ZQTA 5G3JA 1XDKB 4FHHA 2POBA 2Q6RA 5G46A 3CTBA 4EMAA 4XAOA 3N00A 4L96A 1S0ZA 4E2JA 4IUIA 5KCTA 3DR1A 1A52A 4G2IA 2Q5PA 5DKEA 3FALA 2GPPA 3L0LA 1XP9A 2P1TA 5E0WA 3ET0A 2ZFXA 1DKFA 4PP3A 3F7DA 5L7EA 1SJ0A 3R5NA 3V3EA 3IPUA 4IU7A 5FQSA 4S0SA 3CS8A 5K13A 2QXMA 3GYUA 2W8YA 3B5RA 1E3KA 3FALB 3OS8C 1R1KA 2QTUA 3VT3A 1YYEA 3OLLA 2HBHA 1T7TA 1DKFB 3GWSX 4OEAA 1PK5A 3FC6B 4IV4A 3HVLA 2AA2A 2ZK4A 5E7VA 1M13A 3OS8A 3W5RA 1KKQA 5AK2A 2ZK0A 3P0UA 4JYIA 3NSPA 3X1HA 4XHDA 1FD0A 4RWVA 5HZCA 5KYAA 2P54A 2AMAA 3G0WA 3KFCA 2ZXZA 4ZNVA 4DORA 2F4BA 2R6WA 1RDTA 2VV2A 2VSRA 5C4UA 4PLEA 3WFFA 1RKHA 3A2HA 3GN8A 4KZJA 4UDDA 1G50A 2JF9A 1XZXX 5G42A 1XP6A 5DWGA 2NPAA 5DL4A 5DMFA 4UDBA 2PKLA 2YJAB 1NYXA 5DRJA 1H9UA 4XUHA 3AN4A 3ET3A 3WT7A 5KCUA 5KYJA 5AVLA 3OAPA 4MG7A 5KRCA 2R40D 5DTVA 2Q59A 4IQRA 1UOMA 5A86A 3VJSA 3WFGA 3OOFA 5E19A 3VHWA 5KRAA 3L3ZA 5DKSA 3L0JA 1OSVA 2ZXMA 3LBDA 3WTQA 2IOKA 3FUGA 5KRLA 3S9SA 1S9PA 4RAKA 5HCVA 1XQ3A 4P6XA 4QL8A 3K8SA 4APUA 2Q59B 2B50A 2GIUA 3LMPA 3P8XA 1T7RA 1NQ2A 5DXMA 5EJVA 5AYGA 5FQRA 4WLBA 1FM9A 1T7MA 1TFCA 2GTKA 3E94A 3W0GA 4DK8A 2GPOA 1N83A 2H77A 3PEQA 3VT7A 2P7ZA 1HJ1A 2ZK3A 4RUJA 4MGBA 5DXQA 3DCUA 1P93A 3D90A 3DT3A 4OKWA 1X7EA 2Z4BA 5AWKA 4LNWA 5HJPA 4KZMA 4PRGA 5EGVA 1RKGA 4IW6A 4Y29A 1NAVA 4P6WA 4L98A 5DYDA 3WGPA 3FLIA 2PIWA 4E4KA 2BAWA 5DZ1A 2ZXNA 3HC6A 4KZIA 4MGBB 3ET2A 3RLJA 2G0HA 2QNVA 2ZNQA 3B68A 3OMMA 3NOAA 3W0HA 2Q1HA 1ZUCA 1PQ9A 3WT6A 2QGTA 1N46A 2ZK6A 3IPQA 2PIXA 4X1GA 5HJPB 2YLPA 5IAWA 4OZRU 1SR7A 3ADUA 3RVFA 4WVDA 3ZR7A 4M8EA 3MNPA 5KROA 1UHLA 4J5WC 5AZVA 3D57A 3R8DA 2HCDA 4UDAA 4LSJA 3H52A 4PPSA 3UUDA 5DWEA 2QPYA 4J24A 2P7GA 1Z5XU 1PCGA 3MNOA 1GWRA 2O4JA 2PNUA 3UP3A 3FXVA 4QE6A 3W5PA 3FURA 4J5WA 2PIVA 1S19A 4J26A 4XI3A 5DXGA 4JYHA 3VT9A 2PIUA 3R8IA 3KBAA 5JY3A 1UHLB 4QE8A 4YMQA 3BC5A 3AFRA 1X7BA 3UUDB 3PO9A 3UVVA 1XJ7A 2ZLCA 4N5GA 1NQ7A 1IE9A 3A9EA 4R6SA 4ZOMA 4BCRA 1M7WA 4WQPA 4M8HA 4ZNUA 3IA6A 3V3QA 4OEZA 3VTBA 1PDUA 5E0XA 3TY0A 3OZ0A 4IA7A 5HYRA 3UVVB 4N73A 3Q95A 1T73A 1Z95A 3ADTA 4OIUA 4PLDA 5KRFA 2AX9A 4YPQA 2ZBSA 2P1UA 1FM6D 2VSTA 3GYTA 2QXSA 1X76A 3ILZA 2PRGA 5EI1A 5DYBA 4IVYA 5G44A 5AAUA 1YY4A 2BJ4A 3K6PA 2J7XA 2P15A 4QM0A 1IE8A 3KPZA 3VT4A 5DXEA 3DY6A 3VT8A 3Q95B 4ONIA 3OLFA 5G5WA 1XLSE 3PRGA 4IWFA 4OEYA 4RMDA 4Q0AC 5APKA 5DRMA 3UUAA 5G45A 4OZRE 4OFUA 4ITFA 3OOKA 4OKXA 2HFPA 3AURA 3BQDA 2PIPL 3MNEA 4MGAA 2ZK5A 2Q70A 4OC7A 2BJ4B 4WHFA 1K74D 1QKUA 1I37A 5L7GA 4S15A 3R29A 3KMGA 1FM9D 4K6IA 1GWQA 4R2UA 1Z5XE 1G2NA 3HODA 4NB6A 4MG5A 4OH5A 5F9BA 2ZK1A 5EHJA 2J4AA 1I38A 2Q7KA 2ZMJA 4LNXA 4PWLA 5DIGA 5E1CA 4RZGA 2HWQA 1P8DA 1LBDA 4RZFA 3UUAB 1X78A 5FQTA 3GD2A 5GIDA 2XKWA 3OMQA 5DIEA 4MGAB 4YT1A 5KRHA 1PQCA 2ZMHA 3ET1A 1Y0SA 3OZJA 3ERTA 3K22A 2QA6A 2ZL9A 4REEA 5AAVB 2ZNPA 3D6DA 4PVUA 4G1YA 3VJHA 4QK4A 5DUEA 2AX8A 2ZLAA 2HARA 1E3GA 4RMEA 4PP6A 1EXAA 2HB8A 3W5TA 5I4VA 1NAXA 2ZKCA 3OGTA 5KD9A 3OSAA 4NUFA 3ADSA 5KCCA 1FM6A 1Y0XX 2H79A 5DK9A 4OKBA 5DSHA 4NIEA 3GBKA 3U9QA 4JL4A 3VRVA 5DV6A 4IW8A 3VTDA 2QZOA 4RZEA 4ZJRA 1XP1A 2ZNNA 1LV2A 1XPCA 1XV9A 3G8IA 3PLZA 3A3ZX 1FCXA 1I7GA 4MG7B 4QJRA 5ETHA 5GICA 5KCEA 4HEEX 4JYGA 5FQPA 3VRUA 3L0EA 3DZYA 1K74A 2Q1VA 1YIMA 4WPFA 1NQ0A 3RUTA 2O9IA 2AWHA 2Q6JA 4NY9A 4PF3A 3KWYA 2QZOB 3OKIA 3VN2A 3TKCA 1ZAFA 5B5BA 2XYXA 2FAIA 4DM6A 4X1FA 1XV9B 4POHA 1QKMA 3KDUA 2Q3YA 4IS8A 4S0TA 3L1BA 3AUNA 2OAXA 3HLVA 4OFRA 3OMOA 5DWLA 3X1IA 2AAXA 1NDEA 1XNNA 1YA3A 4DOSA 2A3IA 5DKGA 4G1DA 2P4YA 4IWCA 2OZ7A 1R20D 1NRLA 1RJKA 1R5KA 4R06A 1M2ZA 1XOWA 2AX7A 5DX3A 1XNXA 5DZHA 1YMTA 1U3SA 1L2JA 2VV1A 1R6GA 3L3XA 5ACCA 5L11A 3VRTA 3CDSA 5KCWA 5M96A 4MDDA 2NW4A 1YOWA 2JJ3A 4G2HA 5DUHA 5DVVA 3CWDA 1UPWA 3AZ2A 1YUCA 4REFA 4UDCA 2QE4A 4F9MA 5DX3B 2HAMA 4ZO1X 1XLSA 2PINA 4MGDA 2Q8SA 3VTCA 2OVMA 2AB2A 2QW4A 4G20A 2VV1B 1I7IA 4IV2A 4OLMA 2ZASA 4XTAA 1U3QA 4DK7A 2ZY0A 2QH6A 2IOGA 2ZMIA 3KDTA 3O1DA 4Q13A 3RLLA 3L03A 4ZNWA 3OMPA 5JI0D 4CSJA 1PQ6A 3UUCA 2GL8A 2GWXA 5DXRA 2QGWA 1MVCA 4OK1A 5DLRA 5DZ3A 4MGDB 2POGA 1N4HA 3KMZA 1XAPA 4ZNTA 2Q7IA 3V9YA 4OJ9A 3W0JA 1ILHA 5DP0A 4MG9A 3SP6A 5B41A 1XVPA 1NHZA 4LBDA 3V9VA 1OVLA 3OSWA 4S14A 5DXPA 4JGVA 4N1YA 4EM9A 2OUZA 2Q6SA 1YP0A 3FS1A 1TXIA 1ZKYA 3FEJA 2VV4A 4XUMA 3OLSA 5E14A 3K23A 1K7LA 4ZN7A 3OKHA 4POJA 2HB7A 5JJMA 1R20A 2G0GA 3HM1A 3UU7A 4CI4A 5C4TA 2Z4JA 3B0TA 3CS4A 4K7AA 4MG9B 1DB1A 1ZGYA 1T7FA 2P1VA 4RFWA 1XVPB 1G1UA 1YJEA 2Q60A 3GWXA 3IMYA 2YLOA 4N8RA 1GS4A 4B7WA 3A9EB 3V49A 3ERDA 5CJ6A 2VV4B 1KNUA 3CS6A 3HO0A 2GPVA 4LTWA 5DI7A 4HLWA 5JJMB 3UU7B 2LBDA 4XLDA 2HWRA 1MV9A 3GZ9A 4OIVA 4RUOX 2YFEA 1KV6A 2V0VA 3P88A 1XB7A 2J14A 3AZ3A 3WJ4A 4OHAA 3RUUA 2B1ZA 3B65A 2PJLA 2OM9A 2Q5SA 5LGAA 4OEDA 3X31A 5DVSA 4ZJWA 3UP0A 3B0RA 1OSHA 2PIOA 2ZVTA 5DKBA 1T76A 3P89A 5KRIA 3VRWA 2I4ZA 4J5XC 4ZI1A 2GPUA 5AVIA 4TV1A 1T65A 3TX7B 3W0IA 2AA7A 3R5MA 4MG8A 2P7AA 3VSPA 2FSZA 3H0AD 2ZK2A 4J5XA 3NSQA 5G43A 2NXXA 1ZH7A 1SKXA 2AA6A 3B0QA 1FBYA 3FC6A 3A40X 1ERRA 4TV1B 5DWIA 5KRMA 5FQVA 4YNKA 1SQNA 1L2IA 3A2IA 3R8AA 4MG8B 4ZNSA 5DV3A 5C4SA 3AN3A 4DM8A 3A2JA 3AX8A 3V4AA 2JFAA 2R6YA 3G8OA 4K4JA 2XYJA 2GP7A 5DY8A 3F5CA 1QKNA 3ADWA 4OILA 5SYZA 2NV7A 3AUQA 3SZ1A 2AYRA 1K4WA 2B1VA 5AWJA 5IZ0A 1EREA 5KCFA 2Q5GA 4RE8A 5KRKA 2I4JA 1UPVA 3A78A 2HASA 3WWRA 4ZN9A 1QKTA 2ABIA 3VT6A 3ZRAA 3JZCA 2JFAB 2YHDA 5APJA 3CQVA 4XT9A 5DUGA 3F5CB 2J7YA 1U9EA 2OCFA 2QSEA 3SP9A 3B3KA 5ICKA 1VJBA 2YATA 3IXPD 1RK3A 3W5QA 1YOKA 4RUPA 3KYTA 1T79A 4PP5A 4OGHA 1G5YA 3B1MA 3KMRA 1S9QA 3DZUD 3HZFA 4ITEA 5EC9A 3VI8A 2QABA 4FHIA 3VHUA 3H0AA 1FCZA 2ATHA 4IA3A 4MGCA 4PXMA 1A28A 1OT7A 2QR9A 3B67A 2AX6A 1NQ1A 3HC5A 4OARA 1EXXA 3T03A 5HYKA 3B0WA 3D24A 5DU5A 1MZNA 2NXXE 4G21A 1ZDTA 2XHSA 2ACLA 3W0CA 2V7CA 3M7RA 4A2JA 4NQAB 2PIQA 2HC4A 5KCDA 2ZNOA 3R2AA 5DV8A 1GWXA 1Q4XA 4A4VA 5DXBA 3HQ5A
chains in the Genus database with same CATH superfamily
1YINA 4FGYA 4ZO1B 3G9EA 2G44A 2IHQA 3CJWA 5DIDA 2YJDA 4OZTU 3E7CA 2ACLB 5DZIA 5H1EA 2Q61A 3B66A 3CLDA 2EWPA 2YLYA 3JZBA 1WM0X 5DXBB 1NUOA 2AM9A 2XYWA 4TUZA 4ZNHA 4E4QA 2HVCA 4DMAA 5AZTA 3E00D 2AA5A 1S0XA 2E2RA 5DMCA 2Q7JA 2G5OA 3ADXA 2I0JA 3IXPA 3WJ5A 3D5FA 3OS9A 2REWA 3OMKA 2PIRA 2QMVA 5KRJA 5DWJA 2R40A 3O1EA 3W0AA 3DZUA 2I4PA 4TUZB 4FNEA 1ZEOA 1X7JA 1U3RA 2QA8A 2OVHA 3W0YA 3DCTA 1T63A 3FEIA 4Q50A 4JAZA 5LWPA 5L7HA 4DQMA 5APHA 4FN9A 4G1ZA 2AXAA 2I0GA 4RMCA 3DZYD 4OKTA 2AO6A 3TKMA 3QT0A 2VV3A 2YLQA 3X36A 1R1KD 4OH6A 3VHVA 4A4WA 3V9TA 1OVLB 1FCYA 5DZ0A 5IXKA 1X7RA 2QA8B 2PITA 3AZ1A 4MG6A 4OJBA 5DXKA 5HJSA 2FVJA 5AAVA 2Q7LA 3BEJA 1BSXA 3PCUA 4IA1A 5GT4A 1PRGA 4IA2A 3PBAA 1PZLA 1XDKA 2VV0A 3OSIA 3VJIA 3IPSA 3WT5A 4WHGA 5GIEA 1Y9RA 3CDPA 1ZDUA 3EYBA 1ILGA 4PPPA 1HG4A 1T74A 1RDTD 5DVCA 5E15A 4OZTE 4OJ4A 3RY9A 3VJTA 1XIUA 1XQCA 2B23A 5EITA 3VSOA 3WMHA 1T5ZA 3ZRBA 2O4RA 4CI5A 3E00A 4IVWA 2AMBA 3ADVA 3VT5A 5C4OA 5KR9A 4O8FA 3ZQTA 5G3JA 1XDKB 4FHHA 2POBA 2Q6RA 5G46A 3CTBA 4EMAA 4XAOA 3N00A 4L96A 1S0ZA 4E2JA 4IUIA 5KCTA 3DR1A 1A52A 4G2IA 2Q5PA 5DKEA 3FALA 2GPPA 3L0LA 1XP9A 2P1TA 5E0WA 3ET0A 2ZFXA 1DKFA 4PP3A 3F7DA 5L7EA 1SJ0A 3R5NA 3V3EA 3IPUA 4IU7A 5FQSA 4S0SA 3CS8A 5K13A 2QXMA 3GYUA 2W8YA 3B5RA 1E3KA 3FALB 3OS8C 1R1KA 2QTUA 3VT3A 1YYEA 3OLLA 2HBHA 1T7TA 1DKFB 3GWSX 4OEAA 1PK5A 3FC6B 4IV4A 3HVLA 2AA2A 2ZK4A 5E7VA 1M13A 3OS8A 3W5RA 1KKQA 5AK2A 2ZK0A 3P0UA 4JYIA 3NSPA 3X1HA 4XHDA 1FD0A 4RWVA 5HZCA 5KYAA 2P54A 2AMAA 3G0WA 3KFCA 2ZXZA 4ZNVA 4DORA 2F4BA 2R6WA 1RDTA 2VV2A 2VSRA 5C4UA 4PLEA 3WFFA 1RKHA 3A2HA 3GN8A 4KZJA 4UDDA 1G50A 2JF9A 1XZXX 5G42A 1XP6A 5DWGA 2NPAA 5DL4A 5DMFA 4UDBA 2PKLA 2YJAB 1NYXA 5DRJA 1H9UA 4XUHA 3AN4A 3ET3A 3WT7A 5KCUA 5KYJA 5AVLA 3OAPA 4MG7A 5KRCA 2R40D 5DTVA 2Q59A 4IQRA 1UOMA 5A86A 3VJSA 3WFGA 3OOFA 5E19A 3VHWA 5KRAA 3L3ZA 5DKSA 3L0JA 1OSVA 2ZXMA 3LBDA 3WTQA 2IOKA 3FUGA 5KRLA 3S9SA 1S9PA 4RAKA 5HCVA 1XQ3A 4P6XA 4QL8A 3K8SA 4APUA 2Q59B 2B50A 2GIUA 3LMPA 3P8XA 1T7RA 1NQ2A 5DXMA 5EJVA 5AYGA 5FQRA 4WLBA 1FM9A 1T7MA 1TFCA 2GTKA 3E94A 3W0GA 4DK8A 2GPOA 1N83A 2H77A 3PEQA 3VT7A 2P7ZA 1HJ1A 2ZK3A 4RUJA 4MGBA 5DXQA 3DCUA 1P93A 3D90A 3DT3A 4OKWA 1X7EA 2Z4BA 5AWKA 4LNWA 5HJPA 4KZMA 4PRGA 5EGVA 1RKGA 4IW6A 4Y29A 1NAVA 4P6WA 4L98A 5DYDA 3WGPA 3FLIA 2PIWA 4E4KA 2BAWA 5DZ1A 2ZXNA 3HC6A 4KZIA 4MGBB 3ET2A 3RLJA 2G0HA 2QNVA 2ZNQA 3B68A 3OMMA 3NOAA 3W0HA 2Q1HA 1ZUCA 1PQ9A 3WT6A 2QGTA 1N46A 2ZK6A 3IPQA 2PIXA 4X1GA 5HJPB 2YLPA 5IAWA 4OZRU 1SR7A 3ADUA 3RVFA 4WVDA 3ZR7A 4M8EA 3MNPA 5KROA 1UHLA 4J5WC 5AZVA 3D57A 3R8DA 2HCDA 4UDAA 4LSJA 3H52A 4PPSA 3UUDA 5DWEA 2QPYA 4J24A 2P7GA 1Z5XU 1PCGA 3MNOA 1GWRA 2O4JA 2PNUA 3UP3A 3FXVA 4QE6A 3W5PA 3FURA 4J5WA 2PIVA 1S19A 4J26A 4XI3A 5DXGA 4JYHA 3VT9A 2PIUA 3R8IA 3KBAA 5JY3A 1UHLB 4QE8A 4YMQA 3BC5A 3AFRA 1X7BA 3UUDB 3PO9A 3UVVA 1XJ7A 2ZLCA 4N5GA 1NQ7A 1IE9A 3A9EA 4R6SA 4ZOMA 4BCRA 1M7WA 4WQPA 4M8HA 4ZNUA 3IA6A 3V3QA 4OEZA 3VTBA 1PDUA 5E0XA 3TY0A 3OZ0A 4IA7A 5HYRA 3UVVB 4N73A 3Q95A 1T73A 1Z95A 3ADTA 4OIUA 4PLDA 5KRFA 2AX9A 4YPQA 2ZBSA 2P1UA 1FM6D 2VSTA 3GYTA 2QXSA 1X76A 3ILZA 2PRGA 5EI1A 5DYBA 4IVYA 5G44A 5AAUA 1YY4A 2BJ4A 3K6PA 2J7XA 2P15A 4QM0A 1IE8A 3KPZA 3VT4A 5DXEA 3DY6A 3VT8A 3Q95B 4ONIA 3OLFA 5G5WA 1XLSE 3PRGA 4IWFA 4OEYA 4RMDA 4Q0AC 5APKA 5DRMA 3UUAA 5G45A 4OZRE 4OFUA 4ITFA 3OOKA 4OKXA 2HFPA 3AURA 3BQDA 2PIPL 3MNEA 4MGAA 2ZK5A 2Q70A 4OC7A 2BJ4B 4WHFA 1K74D 1QKUA 1I37A 5L7GA 4S15A 3R29A 3KMGA 1FM9D 4K6IA 1GWQA 4R2UA 1Z5XE 1G2NA 3HODA 4NB6A 4MG5A 4OH5A 5F9BA 2ZK1A 5EHJA 2J4AA 1I38A 2Q7KA 2ZMJA 4LNXA 4PWLA 5DIGA 5E1CA 4RZGA 2HWQA 1P8DA 1LBDA 4RZFA 3UUAB 1X78A 5FQTA 3GD2A 5GIDA 2XKWA 3OMQA 5DIEA 4MGAB 4YT1A 5KRHA 1PQCA 2ZMHA 3ET1A 1Y0SA 3OZJA 3ERTA 3K22A 2QA6A 2ZL9A 4REEA 5AAVB 2ZNPA 3D6DA 4PVUA 4G1YA 3VJHA 4QK4A 5DUEA 2AX8A 2ZLAA 2HARA 1E3GA 4RMEA 4PP6A 1EXAA 2HB8A 3W5TA 5I4VA 1NAXA 2ZKCA 3OGTA 5KD9A 3OSAA 4NUFA 3ADSA 5KCCA 1FM6A 1Y0XX 2H79A 5DK9A 4OKBA 5DSHA 4NIEA 3GBKA 3U9QA 4JL4A 3VRVA 5DV6A 4IW8A 3VTDA 2QZOA 4RZEA 4ZJRA 1XP1A 2ZNNA 1LV2A 1XPCA 1XV9A 3G8IA 3PLZA 3A3ZX 1FCXA 1I7GA 4MG7B 4QJRA 5ETHA 5GICA 5KCEA 4HEEX 4JYGA 5FQPA 3VRUA 3L0EA 3DZYA 1K74A 2Q1VA 1YIMA 4WPFA 1NQ0A 3RUTA 2O9IA 2AWHA 2Q6JA 4NY9A 4PF3A 3KWYA 2QZOB 3OKIA 3VN2A 3TKCA 1ZAFA 5B5BA 2XYXA 2FAIA 4DM6A 4X1FA 1XV9B 4POHA 1QKMA 3KDUA 2Q3YA 4IS8A 4S0TA 3L1BA 3AUNA 2OAXA 3HLVA 4OFRA 3OMOA 5DWLA 3X1IA 2AAXA 1NDEA 1XNNA 1YA3A 4DOSA 2A3IA 5DKGA 4G1DA 2P4YA 4IWCA 2OZ7A 1R20D 1NRLA 1RJKA 1R5KA 4R06A 1M2ZA 1XOWA 2AX7A 5DX3A 1XNXA 5DZHA 1YMTA 1U3SA 1L2JA 2VV1A 1R6GA 3L3XA 5ACCA 5L11A 3VRTA 3CDSA 5KCWA 5M96A 4MDDA 2NW4A 1YOWA 2JJ3A 4G2HA 5DUHA 5DVVA 3CWDA 1UPWA 3AZ2A 1YUCA 4REFA 4UDCA 2QE4A 4F9MA 5DX3B 2HAMA 4ZO1X 1XLSA 2PINA 4MGDA 2Q8SA 3VTCA 2OVMA 2AB2A 2QW4A 4G20A 2VV1B 1I7IA 4IV2A 4OLMA 2ZASA 4XTAA 1U3QA 4DK7A 2ZY0A 2QH6A 2IOGA 2ZMIA 3KDTA 3O1DA 4Q13A 3RLLA 3L03A 4ZNWA 3OMPA 5JI0D 4CSJA 1PQ6A 3UUCA 2GL8A 2GWXA 5DXRA 2QGWA 1MVCA 4OK1A 5DLRA 5DZ3A 4MGDB 2POGA 1N4HA 3KMZA 1XAPA 4ZNTA 2Q7IA 3V9YA 4OJ9A 3W0JA 1ILHA 5DP0A 4MG9A 3SP6A 5B41A 1XVPA 1NHZA 4LBDA 3V9VA 1OVLA 3OSWA 4S14A 5DXPA 4JGVA 4N1YA 4EM9A 2OUZA 2Q6SA 1YP0A 3FS1A 1TXIA 1ZKYA 3FEJA 2VV4A 4XUMA 3OLSA 5E14A 3K23A 1K7LA 4ZN7A 3OKHA 4POJA 2HB7A 5JJMA 1R20A 2G0GA 3HM1A 3UU7A 4CI4A 5C4TA 2Z4JA 3B0TA 3CS4A 4K7AA 4MG9B 1DB1A 1ZGYA 1T7FA 2P1VA 4RFWA 1XVPB 1G1UA 1YJEA 2Q60A 3GWXA 3IMYA 2YLOA 4N8RA 1GS4A 4B7WA 3A9EB 3V49A 3ERDA 5CJ6A 2VV4B 1KNUA 3CS6A 3HO0A 2GPVA 4LTWA 5DI7A 4HLWA 5JJMB 3UU7B 2LBDA 4XLDA 2HWRA 1MV9A 3GZ9A 4OIVA 4RUOX 2YFEA 1KV6A 2V0VA 3P88A 1XB7A 2J14A 3AZ3A 3WJ4A 4OHAA 3RUUA 2B1ZA 3B65A 2PJLA 2OM9A 2Q5SA 5LGAA 4OEDA 3X31A 5DVSA 4ZJWA 3UP0A 3B0RA 1OSHA 2PIOA 2ZVTA 5DKBA 1T76A 3P89A 5KRIA 3VRWA 2I4ZA 4J5XC 4ZI1A 2GPUA 5AVIA 4TV1A 1T65A 3TX7B 3W0IA 2AA7A 3R5MA 4MG8A 2P7AA 3VSPA 2FSZA 3H0AD 2ZK2A 4J5XA 3NSQA 5G43A 2NXXA 1ZH7A 1SKXA 2AA6A 3B0QA 1FBYA 3FC6A 3A40X 1ERRA 4TV1B 5DWIA 5KRMA 5FQVA 4YNKA 1SQNA 1L2IA 3A2IA 3R8AA 4MG8B 4ZNSA 5DV3A 5C4SA 3AN3A 4DM8A 3A2JA 3AX8A 3V4AA 2JFAA 2R6YA 3G8OA 4K4JA 2XYJA 2GP7A 5DY8A 3F5CA 1QKNA 3ADWA 4OILA 5SYZA 2NV7A 3AUQA 3SZ1A 2AYRA 1K4WA 2B1VA 5AWJA 5IZ0A 1EREA 5KCFA 2Q5GA 4RE8A 5KRKA 2I4JA 1UPVA 3A78A 2HASA 3WWRA 4ZN9A 1QKTA 2ABIA 3VT6A 3ZRAA 3JZCA 2JFAB 2YHDA 5APJA 3CQVA 4XT9A 5DUGA 3F5CB 2J7YA 1U9EA 2OCFA 2QSEA 3SP9A 3B3KA 5ICKA 1VJBA 2YATA 3IXPD 1RK3A 3W5QA 1YOKA 4RUPA 3KYTA 1T79A 4PP5A 4OGHA 1G5YA 3B1MA 3KMRA 1S9QA 3DZUD 3HZFA 4ITEA 5EC9A 3VI8A 2QABA 4FHIA 3VHUA 3H0AA 1FCZA 2ATHA 4IA3A 4MGCA 4PXMA 1A28A 1OT7A 2QR9A 3B67A 2AX6A 1NQ1A 3HC5A 4OARA 1EXXA 3T03A 5HYKA 3B0WA 3D24A 5DU5A 1MZNA 2NXXE 4G21A 1ZDTA 2XHSA 2ACLA 3W0CA 2V7CA 3M7RA 4A2JA 4NQAB 2PIQA 2HC4A 5KCDA 2ZNOA 3R2AA 5DV8A 1GWXA 1Q4XA 4A4VA 5DXBA 3HQ5A
chains in the Genus database with same CATH topology
1YINA 4FGYA 4ZO1B 3G9EA 2G44A 2IHQA 3CJWA 5DIDA 2YJDA 4OZTU 3E7CA 2ACLB 5DZIA 5H1EA 2Q61A 3B66A 3CLDA 2EWPA 2YLYA 3JZBA 1WM0X 5DXBB 1NUOA 2AM9A 2XYWA 4TUZA 4ZNHA 4E4QA 2HVCA 4DMAA 5AZTA 3E00D 2AA5A 1S0XA 2E2RA 5DMCA 2Q7JA 2G5OA 3ADXA 2I0JA 3IXPA 3WJ5A 3D5FA 3OS9A 2REWA 3OMKA 2PIRA 2QMVA 5KRJA 5DWJA 2R40A 3O1EA 3W0AA 3DZUA 2I4PA 4TUZB 4FNEA 1ZEOA 1X7JA 1U3RA 2QA8A 2OVHA 3W0YA 3DCTA 1T63A 3FEIA 4Q50A 4JAZA 5LWPA 5L7HA 4DQMA 5APHA 4FN9A 4G1ZA 2AXAA 2I0GA 4RMCA 3DZYD 4OKTA 2AO6A 3TKMA 3QT0A 2VV3A 2YLQA 3X36A 1R1KD 4OH6A 3VHVA 4A4WA 3V9TA 1OVLB 1FCYA 5DZ0A 5IXKA 1X7RA 2QA8B 2PITA 3AZ1A 4MG6A 4OJBA 5DXKA 5HJSA 2FVJA 5AAVA 2Q7LA 3BEJA 1BSXA 3PCUA 4IA1A 5GT4A 1PRGA 4IA2A 3PBAA 1PZLA 1XDKA 2VV0A 3OSIA 3VJIA 3IPSA 3WT5A 4WHGA 5GIEA 1Y9RA 3CDPA 1ZDUA 3EYBA 1ILGA 4PPPA 1HG4A 1T74A 1RDTD 5DVCA 5E15A 4OZTE 4OJ4A 3RY9A 3VJTA 1XIUA 1XQCA 2B23A 5EITA 3VSOA 3WMHA 1T5ZA 3ZRBA 2O4RA 4CI5A 3E00A 4IVWA 2AMBA 3ADVA 3VT5A 5C4OA 5KR9A 4O8FA 3ZQTA 5G3JA 1XDKB 4FHHA 2POBA 2Q6RA 5G46A 3CTBA 4EMAA 4XAOA 3N00A 4L96A 1S0ZA 4E2JA 4IUIA 5KCTA 3DR1A 1A52A 4G2IA 2Q5PA 5DKEA 3FALA 2GPPA 3L0LA 1XP9A 2P1TA 5E0WA 3ET0A 2ZFXA 1DKFA 4PP3A 3F7DA 5L7EA 1SJ0A 3R5NA 3V3EA 3IPUA 4IU7A 5FQSA 4S0SA 3CS8A 5K13A 2QXMA 3GYUA 2W8YA 3B5RA 1E3KA 3FALB 3OS8C 1R1KA 2QTUA 3VT3A 1YYEA 3OLLA 2HBHA 1T7TA 1DKFB 3GWSX 4OEAA 1PK5A 3FC6B 4IV4A 3HVLA 2AA2A 2ZK4A 5E7VA 1M13A 3OS8A 3W5RA 1KKQA 5AK2A 2ZK0A 3P0UA 4JYIA 3NSPA 3X1HA 4XHDA 1FD0A 4RWVA 5HZCA 5KYAA 2P54A 2AMAA 3G0WA 3KFCA 2ZXZA 4ZNVA 4DORA 2F4BA 2R6WA 1RDTA 2VV2A 2VSRA 5C4UA 4PLEA 3WFFA 1RKHA 3A2HA 3GN8A 4KZJA 4UDDA 1G50A 2JF9A 1XZXX 5G42A 1XP6A 5DWGA 2NPAA 5DL4A 5DMFA 4UDBA 2PKLA 2YJAB 1NYXA 5DRJA 1H9UA 4XUHA 3AN4A 3ET3A 3WT7A 5KCUA 5KYJA 5AVLA 3OAPA 4MG7A 5KRCA 2R40D 5DTVA 2Q59A 4IQRA 1UOMA 5A86A 3VJSA 3WFGA 3OOFA 5E19A 3VHWA 5KRAA 3L3ZA 5DKSA 3L0JA 1OSVA 2ZXMA 3LBDA 3WTQA 2IOKA 3FUGA 5KRLA 3S9SA 1S9PA 4RAKA 5HCVA 1XQ3A 4P6XA 4QL8A 3K8SA 4APUA 2Q59B 2B50A 2GIUA 3LMPA 3P8XA 1T7RA 1NQ2A 5DXMA 5EJVA 5AYGA 5FQRA 4WLBA 1FM9A 1T7MA 1TFCA 2GTKA 3E94A 3W0GA 4DK8A 2GPOA 1N83A 2H77A 3PEQA 3VT7A 2P7ZA 1HJ1A 2ZK3A 4RUJA 4MGBA 5DXQA 3DCUA 1P93A 3D90A 3DT3A 4OKWA 1X7EA 2Z4BA 5AWKA 4LNWA 5HJPA 4KZMA 4PRGA 5EGVA 1RKGA 4IW6A 4Y29A 1NAVA 4P6WA 4L98A 5DYDA 3WGPA 3FLIA 2PIWA 4E4KA 2BAWA 5DZ1A 2ZXNA 3HC6A 4KZIA 4MGBB 3ET2A 3RLJA 2G0HA 2QNVA 2ZNQA 3B68A 3OMMA 3NOAA 3W0HA 2Q1HA 1ZUCA 1PQ9A 3WT6A 2QGTA 1N46A 2ZK6A 3IPQA 2PIXA 4X1GA 5HJPB 2YLPA 5IAWA 4OZRU 1SR7A 3ADUA 3RVFA 4WVDA 3ZR7A 4M8EA 3MNPA 5KROA 1UHLA 4J5WC 5AZVA 3D57A 3R8DA 2HCDA 4UDAA 4LSJA 3H52A 4PPSA 3UUDA 5DWEA 2QPYA 4J24A 2P7GA 1Z5XU 1PCGA 3MNOA 1GWRA 2O4JA 2PNUA 3UP3A 3FXVA 4QE6A 3W5PA 3FURA 4J5WA 2PIVA 1S19A 4J26A 4XI3A 5DXGA 4JYHA 3VT9A 2PIUA 3R8IA 3KBAA 5JY3A 1UHLB 4QE8A 4YMQA 3BC5A 3AFRA 1X7BA 3UUDB 3PO9A 3UVVA 1XJ7A 2ZLCA 4N5GA 1NQ7A 1IE9A 3A9EA 4R6SA 4ZOMA 4BCRA 1M7WA 4WQPA 4M8HA 4ZNUA 3IA6A 3V3QA 4OEZA 3VTBA 1PDUA 5E0XA 3TY0A 3OZ0A 4IA7A 5HYRA 3UVVB 4N73A 3Q95A 1T73A 1Z95A 3ADTA 4OIUA 4PLDA 5KRFA 2AX9A 4YPQA 2ZBSA 2P1UA 1FM6D 2VSTA 3GYTA 2QXSA 1X76A 3ILZA 2PRGA 5EI1A 5DYBA 4IVYA 5G44A 5AAUA 1YY4A 2BJ4A 3K6PA 2J7XA 2P15A 4QM0A 1IE8A 3KPZA 3VT4A 5DXEA 3DY6A 3VT8A 3Q95B 4ONIA 3OLFA 5G5WA 1XLSE 3PRGA 4IWFA 4OEYA 4RMDA 4Q0AC 5APKA 5DRMA 3UUAA 5G45A 4OZRE 4OFUA 4ITFA 3OOKA 4OKXA 2HFPA 3AURA 3BQDA 2PIPL 3MNEA 4MGAA 2ZK5A 2Q70A 4OC7A 2BJ4B 4WHFA 1K74D 1QKUA 1I37A 5L7GA 4S15A 3R29A 3KMGA 1FM9D 4K6IA 1GWQA 4R2UA 1Z5XE 1G2NA 3HODA 4NB6A 4MG5A 4OH5A 5F9BA 2ZK1A 5EHJA 2J4AA 1I38A 2Q7KA 2ZMJA 4LNXA 4PWLA 5DIGA 5E1CA 4RZGA 2HWQA 1P8DA 1LBDA 4RZFA 3UUAB 1X78A 5FQTA 3GD2A 5GIDA 2XKWA 3OMQA 5DIEA 4MGAB 4YT1A 5KRHA 1PQCA 2ZMHA 3ET1A 1Y0SA 3OZJA 3ERTA 3K22A 2QA6A 2ZL9A 4REEA 5AAVB 2ZNPA 3D6DA 4PVUA 4G1YA 3VJHA 4QK4A 5DUEA 2AX8A 2ZLAA 2HARA 1E3GA 4RMEA 4PP6A 1EXAA 2HB8A 3W5TA 5I4VA 1NAXA 2ZKCA 3OGTA 5KD9A 3OSAA 4NUFA 3ADSA 5KCCA 1FM6A 1Y0XX 2H79A 5DK9A 4OKBA 5DSHA 4NIEA 3GBKA 3U9QA 4JL4A 3VRVA 5DV6A 4IW8A 3VTDA 2QZOA 4RZEA 4ZJRA 1XP1A 2ZNNA 1LV2A 1XPCA 1XV9A 3G8IA 3PLZA 3A3ZX 1FCXA 1I7GA 4MG7B 4QJRA 5ETHA 5GICA 5KCEA 4HEEX 4JYGA 5FQPA 3VRUA 3L0EA 3DZYA 1K74A 2Q1VA 1YIMA 4WPFA 1NQ0A 3RUTA 2O9IA 2AWHA 2Q6JA 4NY9A 4PF3A 3KWYA 2QZOB 3OKIA 3VN2A 3TKCA 1ZAFA 5B5BA 2XYXA 2FAIA 4DM6A 4X1FA 1XV9B 4POHA 1QKMA 3KDUA 2Q3YA 4IS8A 4S0TA 3L1BA 3AUNA 2OAXA 3HLVA 4OFRA 3OMOA 5DWLA 3X1IA 2AAXA 1NDEA 1XNNA 1YA3A 4DOSA 2A3IA 5DKGA 4G1DA 2P4YA 4IWCA 2OZ7A 1R20D 1NRLA 1RJKA 1R5KA 4R06A 1M2ZA 1XOWA 2AX7A 5DX3A 1XNXA 5DZHA 1YMTA 1U3SA 1L2JA 2VV1A 1R6GA 3L3XA 5ACCA 5L11A 3VRTA 3CDSA 5KCWA 5M96A 4MDDA 2NW4A 1YOWA 2JJ3A 4G2HA 5DUHA 5DVVA 3CWDA 1UPWA 3AZ2A 1YUCA 4REFA 4UDCA 2QE4A 4F9MA 5DX3B 2HAMA 4ZO1X 1XLSA 2PINA 4MGDA 2Q8SA 3VTCA 2OVMA 2AB2A 2QW4A 4G20A 2VV1B 1I7IA 4IV2A 4OLMA 2ZASA 4XTAA 1U3QA 4DK7A 2ZY0A 2QH6A 2IOGA 2ZMIA 3KDTA 3O1DA 4Q13A 3RLLA 3L03A 4ZNWA 3OMPA 5JI0D 4CSJA 1PQ6A 3UUCA 2GL8A 2GWXA 5DXRA 2QGWA 1MVCA 4OK1A 5DLRA 5DZ3A 4MGDB 2POGA 1N4HA 3KMZA 1XAPA 4ZNTA 2Q7IA 3V9YA 4OJ9A 3W0JA 1ILHA 5DP0A 4MG9A 3SP6A 5B41A 1XVPA 1NHZA 4LBDA 3V9VA 1OVLA 3OSWA 4S14A 5DXPA 4JGVA 4N1YA 4EM9A 2OUZA 2Q6SA 1YP0A 3FS1A 1TXIA 1ZKYA 3FEJA 2VV4A 4XUMA 3OLSA 5E14A 3K23A 1K7LA 4ZN7A 3OKHA 4POJA 2HB7A 5JJMA 1R20A 2G0GA 3HM1A 3UU7A 4CI4A 5C4TA 2Z4JA 3B0TA 3CS4A 4K7AA 4MG9B 1DB1A 1ZGYA 1T7FA 2P1VA 4RFWA 1XVPB 1G1UA 1YJEA 2Q60A 3GWXA 3IMYA 2YLOA 4N8RA 1GS4A 4B7WA 3A9EB 3V49A 3ERDA 5CJ6A 2VV4B 1KNUA 3CS6A 3HO0A 2GPVA 4LTWA 5DI7A 4HLWA 5JJMB 3UU7B 2LBDA 4XLDA 2HWRA 1MV9A 3GZ9A 4OIVA 4RUOX 2YFEA 1KV6A 2V0VA 3P88A 1XB7A 2J14A 3AZ3A 3WJ4A 4OHAA 3RUUA 2B1ZA 3B65A 2PJLA 2OM9A 2Q5SA 5LGAA 4OEDA 3X31A 5DVSA 4ZJWA 3UP0A 3B0RA 1OSHA 2PIOA 2ZVTA 5DKBA 1T76A 3P89A 5KRIA 3VRWA 2I4ZA 4J5XC 4ZI1A 2GPUA 5AVIA 4TV1A 1T65A 3TX7B 3W0IA 2AA7A 3R5MA 4MG8A 2P7AA 3VSPA 2FSZA 3H0AD 2ZK2A 4J5XA 3NSQA 5G43A 2NXXA 1ZH7A 1SKXA 2AA6A 3B0QA 1FBYA 3FC6A 3A40X 1ERRA 4TV1B 5DWIA 5KRMA 5FQVA 4YNKA 1SQNA 1L2IA 3A2IA 3R8AA 4MG8B 4ZNSA 5DV3A 5C4SA 3AN3A 4DM8A 3A2JA 3AX8A 3V4AA 2JFAA 2R6YA 3G8OA 4K4JA 2XYJA 2GP7A 5DY8A 3F5CA 1QKNA 3ADWA 4OILA 5SYZA 2NV7A 3AUQA 3SZ1A 2AYRA 1K4WA 2B1VA 5AWJA 5IZ0A 1EREA 5KCFA 2Q5GA 4RE8A 5KRKA 2I4JA 1UPVA 3A78A 2HASA 3WWRA 4ZN9A 1QKTA 2ABIA 3VT6A 3ZRAA 3JZCA 2JFAB 2YHDA 5APJA 3CQVA 4XT9A 5DUGA 3F5CB 2J7YA 1U9EA 2OCFA 2QSEA 3SP9A 3B3KA 5ICKA 1VJBA 2YATA 3IXPD 1RK3A 3W5QA 1YOKA 4RUPA 3KYTA 1T79A 4PP5A 4OGHA 1G5YA 3B1MA 3KMRA 1S9QA 3DZUD 3HZFA 4ITEA 5EC9A 3VI8A 2QABA 4FHIA 3VHUA 3H0AA 1FCZA 2ATHA 4IA3A 4MGCA 4PXMA 1A28A 1OT7A 2QR9A 3B67A 2AX6A 1NQ1A 3HC5A 4OARA 1EXXA 3T03A 5HYKA 3B0WA 3D24A 5DU5A 1MZNA 2NXXE 4G21A 1ZDTA 2XHSA 2ACLA 3W0CA 2V7CA 3M7RA 4A2JA 4NQAB 2PIQA 2HC4A 5KCDA 2ZNOA 3R2AA 5DV8A 1GWXA 1Q4XA 4A4VA 5DXBA 3HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIN A;  4FGY A;  4ZO1 B;  3G9E A;  2G44 A;  2IHQ A;  3CJW A;  5DID A;  2YJD A;  4OZT U;  3E7C A;  2ACL B;  5DZI A;  5H1E A;  2Q61 A;  3B66 A;  3CLD A;  2EWP A;  2YLY A;  3JZB A;  1WM0 X;  5DXB B;  1NUO A;  2AM9 A;  2XYW A;  4TUZ A;  4ZNH A;  4E4Q A;  2HVC A;  4DMA A;  5AZT A;  3E00 D;  2AA5 A;  1S0X A;  2E2R A;  5DMC A;  2Q7J A;  2G5O A;  3ADX A;  2I0J A;  3IXP A;  3WJ5 A;  3D5F A;  3OS9 A;  2REW A;  3OMK A;  2PIR A;  2QMV A;  5KRJ A;  5DWJ A;  2R40 A;  3O1E A;  3W0A A;  3DZU A;  2I4P A;  4TUZ B;  4FNE A;  1ZEO A;  1X7J A;  1U3R A;  2QA8 A;  2OVH A;  3W0Y A;  3DCT A;  1T63 A;  3FEI A;  4Q50 A;  4JAZ A;  5LWP A;  5L7H A;  4DQM A;  5APH A;  4FN9 A;  4G1Z A;  2AXA A;  2I0G A;  4RMC A;  3DZY D;  4OKT A;  2AO6 A;  3TKM A;  3QT0 A;  2VV3 A;  2YLQ A;  3X36 A;  1R1K D;  4OH6 A;  3VHV A;  4A4W A;  3V9T A;  1OVL B;  1FCY A;  5DZ0 A;  5IXK A;  1X7R A;  2QA8 B;  2PIT A;  3AZ1 A;  4MG6 A;  4OJB A;  5DXK A;  5HJS A;  2FVJ A;  5AAV A;  2Q7L A;  3BEJ A;  1BSX A;  3PCU A;  4IA1 A;  5GT4 A;  1PRG A;  4IA2 A;  3PBA A;  1PZL A;  1XDK A;  2VV0 A;  3OSI A;  3VJI A;  3IPS A;  3WT5 A;  4WHG A;  5GIE A;  1Y9R A;  3CDP A;  1ZDU A;  3EYB A;  1ILG A;  4PPP A;  1HG4 A;  1T74 A;  1RDT D;  5DVC A;  5E15 A;  4OZT E;  4OJ4 A;  3RY9 A;  3VJT A;  1XIU A;  1XQC A;  2B23 A;  5EIT A;  3VSO A;  3WMH A;  1T5Z A;  3ZRB A;  2O4R A;  4CI5 A;  3E00 A;  4IVW A;  2AMB A;  3ADV A;  3VT5 A;  5C4O A;  5KR9 A;  4O8F A;  3ZQT A;  5G3J A;  1XDK B;  4FHH A;  2POB A;  2Q6R A;  5G46 A;  3CTB A;  4EMA A;  4XAO A;  3N00 A;  4L96 A;  1S0Z A;  4E2J A;  4IUI A;  5KCT A;  3DR1 A;  1A52 A;  4G2I A;  2Q5P A;  5DKE A;  3FAL A;  2GPP A;  3L0L A;  1XP9 A;  2P1T A;  5E0W A;  3ET0 A;  2ZFX A;  1DKF A;  4PP3 A;  3F7D A;  5L7E A;  1SJ0 A;  3R5N A;  3V3E A;  3IPU A;  4IU7 A;  5FQS A;  4S0S A;  3CS8 A;  5K13 A;  2QXM A;  3GYU A;  2W8Y A;  3B5R A;  1E3K A;  3FAL B;  3OS8 C;  1R1K A;  2QTU A;  3VT3 A;  1YYE A;  3OLL A;  2HBH A;  1T7T A;  1DKF B;  3GWS X;  4OEA A;  1PK5 A;  3FC6 B;  4IV4 A;  3HVL A;  2AA2 A;  2ZK4 A;  5E7V A;  1M13 A;  3OS8 A;  3W5R A;  1KKQ A;  5AK2 A;  2ZK0 A;  3P0U A;  4JYI A;  3NSP A;  3X1H A;  4XHD A;  1FD0 A;  4RWV A;  5HZC A;  5KYA A;  2P54 A;  2AMA A;  3G0W A;  3KFC A;  2ZXZ A;  4ZNV A;  4DOR A;  2F4B A;  2R6W A;  1RDT A;  2VV2 A;  2VSR A;  5C4U A;  4PLE A;  3WFF A;  1RKH A;  3A2H A;  3GN8 A;  4KZJ A;  4UDD A;  1G50 A;  2JF9 A;  1XZX X;  5G42 A;  1XP6 A;  5DWG A;  2NPA A;  5DL4 A;  5DMF A;  4UDB A;  2PKL A;  2YJA B;  1NYX A;  5DRJ A;  1H9U A;  4XUH A;  3AN4 A;  3ET3 A;  3WT7 A;  5KCU A;  5KYJ A;  5AVL A;  3OAP A;  4MG7 A;  5KRC A;  2R40 D;  5DTV A;  2Q59 A;  4IQR A;  1UOM A;  5A86 A;  3VJS A;  3WFG A;  3OOF A;  5E19 A;  3VHW A;  5KRA A;  3L3Z A;  5DKS A;  3L0J A;  1OSV A;  2ZXM A;  3LBD A;  3WTQ A;  2IOK A;  3FUG A;  5KRL A;  3S9S A;  1S9P A;  4RAK A;  5HCV A;  1XQ3 A;  4P6X A;  4QL8 A;  3K8S A;  4APU A;  2Q59 B;  2B50 A;  2GIU A;  3LMP A;  3P8X A;  1T7R A;  1NQ2 A;  5DXM A;  5EJV A;  5AYG A;  5FQR A;  4WLB A;  1FM9 A;  1T7M A;  1TFC A;  2GTK A;  3E94 A;  3W0G A;  4DK8 A;  2GPO A;  1N83 A;  2H77 A;  3PEQ A;  3VT7 A;  2P7Z A;  1HJ1 A;  2ZK3 A;  4RUJ A;  4MGB A;  5DXQ A;  3DCU A;  1P93 A;  3D90 A;  3DT3 A;  4OKW A;  1X7E A;  2Z4B A;  5AWK A;  4LNW A;  5HJP A;  4KZM A;  4PRG A;  5EGV A;  1RKG A;  4IW6 A;  4Y29 A;  1NAV A;  4P6W A;  4L98 A;  5DYD A;  3WGP A;  3FLI A;  2PIW A;  4E4K A;  2BAW A;  5DZ1 A;  2ZXN A;  3HC6 A;  4KZI A;  4MGB B;  3ET2 A;  3RLJ A;  2G0H A;  2QNV A;  2ZNQ A;  3B68 A;  3OMM A;  3NOA A;  3W0H A;  2Q1H A;  1ZUC A;  1PQ9 A;  3WT6 A;  2QGT A;  1N46 A;  2ZK6 A;  3IPQ A;  2PIX A;  4X1G A;  5HJP B;  2YLP A;  5IAW A;  4OZR U;  1SR7 A;  3ADU A;  3RVF A;  4WVD A;  3ZR7 A;  4M8E A;  3MNP A;  5KRO A;  1UHL A;  4J5W C;  5AZV A;  3D57 A;  3R8D A;  2HCD A;  4UDA A;  4LSJ A;  3H52 A;  4PPS A;  3UUD A;  5DWE A;  2QPY A;  4J24 A;  2P7G A;  1Z5X U;  1PCG A;  3MNO A;  1GWR A;  2O4J A;  2PNU A;  3UP3 A;  3FXV A;  4QE6 A;  3W5P A;  3FUR A;  4J5W A;  2PIV A;  1S19 A;  4J26 A;  4XI3 A;  5DXG A;  4JYH A;  3VT9 A;  2PIU A;  3R8I A;  3KBA A;  5JY3 A;  1UHL B;  4QE8 A;  4YMQ A;  3BC5 A;  3AFR A;  1X7B A;  3UUD B;  3PO9 A;  3UVV A;  1XJ7 A;  2ZLC A;  4N5G A;  1NQ7 A;  1IE9 A;  3A9E A;  4R6S A;  4ZOM A;  4BCR A;  1M7W A;  4WQP A;  4M8H A;  4ZNU A;  3IA6 A;  3V3Q A;  4OEZ A;  3VTB A;  1PDU A;  5E0X A;  3TY0 A;  3OZ0 A;  4IA7 A;  5HYR A;  3UVV B;  4N73 A;  3Q95 A;  1T73 A;  1Z95 A;  3ADT A;  4OIU A;  4PLD A;  5KRF A;  2AX9 A;  4YPQ A;  2ZBS A;  2P1U A;  1FM6 D;  2VST A;  3GYT A;  2QXS A;  1X76 A;  3ILZ A;  2PRG A;  5EI1 A;  5DYB A;  4IVY A;  5G44 A;  5AAU A;  1YY4 A;  2BJ4 A;  3K6P A;  2J7X A;  2P15 A;  4QM0 A;  1IE8 A;  3KPZ A;  3VT4 A;  5DXE A;  3DY6 A;  3VT8 A;  3Q95 B;  4ONI A;  3OLF A;  5G5W A;  1XLS E;  3PRG A;  4IWF A;  4OEY A;  4RMD A;  4Q0A C;  5APK A;  5DRM A;  3UUA A;  5G45 A;  4OZR E;  4OFU A;  4ITF A;  3OOK A;  4OKX A;  2HFP A;  3AUR A;  3BQD A;  2PIP L;  3MNE A;  4MGA A;  2ZK5 A;  2Q70 A;  4OC7 A;  2BJ4 B;  4WHF A;  1K74 D;  1QKU A;  1I37 A;  5L7G A;  4S15 A;  3R29 A;  3KMG A;  1FM9 D;  4K6I A;  1GWQ A;  4R2U A;  1Z5X E;  1G2N A;  3HOD A;  4NB6 A;  4MG5 A;  4OH5 A;  5F9B A;  2ZK1 A;  5EHJ A;  2J4A A;  1I38 A;  2Q7K A;  2ZMJ A;  4LNX A;  4PWL A;  5DIG A;  5E1C A;  4RZG A;  2HWQ A;  1P8D A;  1LBD A;  4RZF A;  3UUA B;  1X78 A;  5FQT A;  3GD2 A;  5GID A;  2XKW A;  3OMQ A;  5DIE A;  4MGA B;  4YT1 A;  5KRH A;  1PQC A;  2ZMH A;  3ET1 A;  1Y0S A;  3OZJ A;  3ERT A;  3K22 A;  2QA6 A;  2ZL9 A;  4REE A;  5AAV B;  2ZNP A;  3D6D A;  4PVU A;  4G1Y A;  3VJH A;  4QK4 A;  5DUE A;  2AX8 A;  2ZLA A;  2HAR A;  1E3G A;  4RME A;  4PP6 A;  1EXA A;  2HB8 A;  3W5T A;  5I4V A;  1NAX A;  2ZKC A;  3OGT A;  5KD9 A;  3OSA A;  4NUF A;  3ADS A;  5KCC A;  1FM6 A;  1Y0X X;  2H79 A;  5DK9 A;  4OKB A;  5DSH A;  4NIE A;  3GBK A;  3U9Q A;  4JL4 A;  3VRV A;  5DV6 A;  4IW8 A;  3VTD A;  2QZO A;  4RZE A;  4ZJR A;  1XP1 A;  2ZNN A;  1LV2 A;  1XPC A;  1XV9 A;  3G8I A;  3PLZ A;  3A3Z X;  1FCX A;  1I7G A;  4MG7 B;  4QJR A;  5ETH A;  5GIC A;  5KCE A;  4HEE X;  4JYG A;  5FQP A;  3VRU A;  3L0E A;  3DZY A;  1K74 A;  2Q1V A;  1YIM A;  4WPF A;  1NQ0 A;  3RUT A;  2O9I A;  2AWH A;  2Q6J A;  4NY9 A;  4PF3 A;  3KWY A;  2QZO B;  3OKI A;  3VN2 A;  3TKC A;  1ZAF A;  5B5B A;  2XYX A;  2FAI A;  4DM6 A;  4X1F A;  1XV9 B;  4POH A;  1QKM A;  3KDU A;  2Q3Y A;  4IS8 A;  4S0T A;  3L1B A;  3AUN A;  2OAX A;  3HLV A;  4OFR A;  3OMO A;  5DWL A;  3X1I A;  2AAX A;  1NDE A;  1XNN A;  1YA3 A;  4DOS A;  2A3I A;  5DKG A;  4G1D A;  2P4Y A;  4IWC A;  2OZ7 A;  1R20 D;  1NRL A;  1RJK A;  1R5K A;  4R06 A;  1M2Z A;  1XOW A;  2AX7 A;  5DX3 A;  1XNX A;  5DZH A;  1YMT A;  1U3S A;  1L2J A;  2VV1 A;  1R6G A;  3L3X A;  5ACC A;  5L11 A;  3VRT A;  3CDS A;  5KCW A;  5M96 A;  4MDD A;  2NW4 A;  1YOW A;  2JJ3 A;  4G2H A;  5DUH A;  5DVV A;  3CWD A;  1UPW A;  3AZ2 A;  1YUC A;  4REF A;  4UDC A;  2QE4 A;  4F9M A;  5DX3 B;  2HAM A;  4ZO1 X;  1XLS A;  2PIN A;  4MGD A;  2Q8S A;  3VTC A;  2OVM A;  2AB2 A;  2QW4 A;  4G20 A;  2VV1 B;  1I7I A;  4IV2 A;  4OLM A;  2ZAS A;  4XTA A;  1U3Q A;  4DK7 A;  2ZY0 A;  2QH6 A;  2IOG A;  2ZMI A;  3KDT A;  3O1D A;  4Q13 A;  3RLL A;  3L03 A;  4ZNW A;  3OMP A;  5JI0 D;  4CSJ A;  1PQ6 A;  3UUC A;  2GL8 A;  2GWX A;  5DXR A;  2QGW A;  1MVC A;  4OK1 A;  5DLR A;  5DZ3 A;  4MGD B;  2POG A;  1N4H A;  3KMZ A;  1XAP A;  4ZNT A;  2Q7I A;  3V9Y A;  4OJ9 A;  3W0J A;  1ILH A;  5DP0 A;  4MG9 A;  3SP6 A;  5B41 A;  1XVP A;  1NHZ A;  4LBD A;  3V9V A;  1OVL A;  3OSW A;  4S14 A;  5DXP A;  4JGV A;  4N1Y A;  4EM9 A;  2OUZ A;  2Q6S A;  1YP0 A;  3FS1 A;  1TXI A;  1ZKY A;  3FEJ A;  2VV4 A;  4XUM A;  3OLS A;  5E14 A;  3K23 A;  1K7L A;  4ZN7 A;  3OKH A;  4POJ A;  2HB7 A;  5JJM A;  1R20 A;  2G0G A;  3HM1 A;  3UU7 A;  4CI4 A;  5C4T A;  2Z4J A;  3B0T A;  3CS4 A;  4K7A A;  4MG9 B;  1DB1 A;  1ZGY A;  1T7F A;  2P1V A;  4RFW A;  1XVP B;  1G1U A;  1YJE A;  2Q60 A;  3GWX A;  3IMY A;  2YLO A;  4N8R A;  1GS4 A;  4B7W A;  3A9E B;  3V49 A;  3ERD A;  5CJ6 A;  2VV4 B;  1KNU A;  3CS6 A;  3HO0 A;  2GPV A;  4LTW A;  5DI7 A;  4HLW A;  5JJM B;  3UU7 B;  2LBD A;  4XLD A;  2HWR A;  1MV9 A;  3GZ9 A;  4OIV A;  4RUO X;  2YFE A;  1KV6 A;  2V0V A;  3P88 A;  1XB7 A;  2J14 A;  3AZ3 A;  3WJ4 A;  4OHA A;  3RUU A;  2B1Z A;  3B65 A;  2PJL A;  2OM9 A;  2Q5S A;  5LGA A;  4OED A;  3X31 A;  5DVS A;  4ZJW A;  3UP0 A;  3B0R A;  1OSH A;  2PIO A;  2ZVT A;  5DKB A;  1T76 A;  3P89 A;  5KRI A;  3VRW A;  2I4Z A;  4J5X C;  4ZI1 A;  2GPU A;  5AVI A;  4TV1 A;  1T65 A;  3TX7 B;  3W0I A;  2AA7 A;  3R5M A;  4MG8 A;  2P7A A;  3VSP A;  2FSZ A;  3H0A D;  2ZK2 A;  4J5X A;  3NSQ A;  5G43 A;  2NXX A;  1ZH7 A;  1SKX A;  2AA6 A;  3B0Q A;  1FBY A;  3FC6 A;  3A40 X;  1ERR A;  4TV1 B;  5DWI A;  5KRM A;  5FQV A;  4YNK A;  1SQN A;  1L2I A;  3A2I A;  3R8A A;  4MG8 B;  4ZNS A;  5DV3 A;  5C4S A;  3AN3 A;  4DM8 A;  3A2J A;  3AX8 A;  3V4A A;  2JFA A;  2R6Y A;  3G8O A;  4K4J A;  2XYJ A;  2GP7 A;  5DY8 A;  3F5C A;  1QKN A;  3ADW A;  4OIL A;  5SYZ A;  2NV7 A;  3AUQ A;  3SZ1 A;  2AYR A;  1K4W A;  2B1V A;  5AWJ A;  5IZ0 A;  1ERE A;  5KCF A;  2Q5G A;  4RE8 A;  5KRK A;  2I4J A;  1UPV A;  3A78 A;  2HAS A;  3WWR A;  4ZN9 A;  1QKT A;  2ABI A;  3VT6 A;  3ZRA A;  3JZC A;  2JFA B;  2YHD A;  5APJ A;  3CQV A;  4XT9 A;  5DUG A;  3F5C B;  2J7Y A;  1U9E A;  2OCF A;  2QSE A;  3SP9 A;  3B3K A;  5ICK A;  1VJB A;  2YAT A;  3IXP D;  1RK3 A;  3W5Q A;  1YOK A;  4RUP A;  3KYT A;  1T79 A;  4PP5 A;  4OGH A;  1G5Y A;  3B1M A;  3KMR A;  1S9Q A;  3DZU D;  3HZF A;  4ITE A;  5EC9 A;  3VI8 A;  2QAB A;  4FHI A;  3VHU A;  3H0A A;  1FCZ A;  2ATH A;  4IA3 A;  4MGC A;  4PXM A;  1A28 A;  1OT7 A;  2QR9 A;  3B67 A;  2AX6 A;  1NQ1 A;  3HC5 A;  4OAR A;  1EXX A;  3T03 A;  5HYK A;  3B0W A;  3D24 A;  5DU5 A;  1MZN A;  2NXX E;  4G21 A;  1ZDT A;  2XHS A;  2ACL A;  3W0C A;  2V7C A;  3M7R A;  4A2J A;  4NQA B;  2PIQ A;  2HC4 A;  5KCD A;  2ZNO A;  3R2A A;  5DV8 A;  1GWX A;  1Q4X A;  4A4V A;  5DXB A;  3HQ5 A; 
#chains in the Genus database with same CATH topology
 1YIN A;  4FGY A;  4ZO1 B;  3G9E A;  2G44 A;  2IHQ A;  3CJW A;  5DID A;  2YJD A;  4OZT U;  3E7C A;  2ACL B;  5DZI A;  5H1E A;  2Q61 A;  3B66 A;  3CLD A;  2EWP A;  2YLY A;  3JZB A;  1WM0 X;  5DXB B;  1NUO A;  2AM9 A;  2XYW A;  4TUZ A;  4ZNH A;  4E4Q A;  2HVC A;  4DMA A;  5AZT A;  3E00 D;  2AA5 A;  1S0X A;  2E2R A;  5DMC A;  2Q7J A;  2G5O A;  3ADX A;  2I0J A;  3IXP A;  3WJ5 A;  3D5F A;  3OS9 A;  2REW A;  3OMK A;  2PIR A;  2QMV A;  5KRJ A;  5DWJ A;  2R40 A;  3O1E A;  3W0A A;  3DZU A;  2I4P A;  4TUZ B;  4FNE A;  1ZEO A;  1X7J A;  1U3R A;  2QA8 A;  2OVH A;  3W0Y A;  3DCT A;  1T63 A;  3FEI A;  4Q50 A;  4JAZ A;  5LWP A;  5L7H A;  4DQM A;  5APH A;  4FN9 A;  4G1Z A;  2AXA A;  2I0G A;  4RMC A;  3DZY D;  4OKT A;  2AO6 A;  3TKM A;  3QT0 A;  2VV3 A;  2YLQ A;  3X36 A;  1R1K D;  4OH6 A;  3VHV A;  4A4W A;  3V9T A;  1OVL B;  1FCY A;  5DZ0 A;  5IXK A;  1X7R A;  2QA8 B;  2PIT A;  3AZ1 A;  4MG6 A;  4OJB A;  5DXK A;  5HJS A;  2FVJ A;  5AAV A;  2Q7L A;  3BEJ A;  1BSX A;  3PCU A;  4IA1 A;  5GT4 A;  1PRG A;  4IA2 A;  3PBA A;  1PZL A;  1XDK A;  2VV0 A;  3OSI A;  3VJI A;  3IPS A;  3WT5 A;  4WHG A;  5GIE A;  1Y9R A;  3CDP A;  1ZDU A;  3EYB A;  1ILG A;  4PPP A;  1HG4 A;  1T74 A;  1RDT D;  5DVC A;  5E15 A;  4OZT E;  4OJ4 A;  3RY9 A;  3VJT A;  1XIU A;  1XQC A;  2B23 A;  5EIT A;  3VSO A;  3WMH A;  1T5Z A;  3ZRB A;  2O4R A;  4CI5 A;  3E00 A;  4IVW A;  2AMB A;  3ADV A;  3VT5 A;  5C4O A;  5KR9 A;  4O8F A;  3ZQT A;  5G3J A;  1XDK B;  4FHH A;  2POB A;  2Q6R A;  5G46 A;  3CTB A;  4EMA A;  4XAO A;  3N00 A;  4L96 A;  1S0Z A;  4E2J A;  4IUI A;  5KCT A;  3DR1 A;  1A52 A;  4G2I A;  2Q5P A;  5DKE A;  3FAL A;  2GPP A;  3L0L A;  1XP9 A;  2P1T A;  5E0W A;  3ET0 A;  2ZFX A;  1DKF A;  4PP3 A;  3F7D A;  5L7E A;  1SJ0 A;  3R5N A;  3V3E A;  3IPU A;  4IU7 A;  5FQS A;  4S0S A;  3CS8 A;  5K13 A;  2QXM A;  3GYU A;  2W8Y A;  3B5R A;  1E3K A;  3FAL B;  3OS8 C;  1R1K A;  2QTU A;  3VT3 A;  1YYE A;  3OLL A;  2HBH A;  1T7T A;  1DKF B;  3GWS X;  4OEA A;  1PK5 A;  3FC6 B;  4IV4 A;  3HVL A;  2AA2 A;  2ZK4 A;  5E7V A;  1M13 A;  3OS8 A;  3W5R A;  1KKQ A;  5AK2 A;  2ZK0 A;  3P0U A;  4JYI A;  3NSP A;  3X1H A;  4XHD A;  1FD0 A;  4RWV A;  5HZC A;  5KYA A;  2P54 A;  2AMA A;  3G0W A;  3KFC A;  2ZXZ A;  4ZNV A;  4DOR A;  2F4B A;  2R6W A;  1RDT A;  2VV2 A;  2VSR A;  5C4U A;  4PLE A;  3WFF A;  1RKH A;  3A2H A;  3GN8 A;  4KZJ A;  4UDD A;  1G50 A;  2JF9 A;  1XZX X;  5G42 A;  1XP6 A;  5DWG A;  2NPA A;  5DL4 A;  5DMF A;  4UDB A;  2PKL A;  2YJA B;  1NYX A;  5DRJ A;  1H9U A;  4XUH A;  3AN4 A;  3ET3 A;  3WT7 A;  5KCU A;  5KYJ A;  5AVL A;  3OAP A;  4MG7 A;  5KRC A;  2R40 D;  5DTV A;  2Q59 A;  4IQR A;  1UOM A;  5A86 A;  3VJS A;  3WFG A;  3OOF A;  5E19 A;  3VHW A;  5KRA A;  3L3Z A;  5DKS A;  3L0J A;  1OSV A;  2ZXM A;  3LBD A;  3WTQ A;  2IOK A;  3FUG A;  5KRL A;  3S9S A;  1S9P A;  4RAK A;  5HCV A;  1XQ3 A;  4P6X A;  4QL8 A;  3K8S A;  4APU A;  2Q59 B;  2B50 A;  2GIU A;  3LMP A;  3P8X A;  1T7R A;  1NQ2 A;  5DXM A;  5EJV A;  5AYG A;  5FQR A;  4WLB A;  1FM9 A;  1T7M A;  1TFC A;  2GTK A;  3E94 A;  3W0G A;  4DK8 A;  2GPO A;  1N83 A;  2H77 A;  3PEQ A;  3VT7 A;  2P7Z A;  1HJ1 A;  2ZK3 A;  4RUJ A;  4MGB A;  5DXQ A;  3DCU A;  1P93 A;  3D90 A;  3DT3 A;  4OKW A;  1X7E A;  2Z4B A;  5AWK A;  4LNW A;  5HJP A;  4KZM A;  4PRG A;  5EGV A;  1RKG A;  4IW6 A;  4Y29 A;  1NAV A;  4P6W A;  4L98 A;  5DYD A;  3WGP A;  3FLI A;  2PIW A;  4E4K A;  2BAW A;  5DZ1 A;  2ZXN A;  3HC6 A;  4KZI A;  4MGB B;  3ET2 A;  3RLJ A;  2G0H A;  2QNV A;  2ZNQ A;  3B68 A;  3OMM A;  3NOA A;  3W0H A;  2Q1H A;  1ZUC A;  1PQ9 A;  3WT6 A;  2QGT A;  1N46 A;  2ZK6 A;  3IPQ A;  2PIX A;  4X1G A;  5HJP B;  2YLP A;  5IAW A;  4OZR U;  1SR7 A;  3ADU A;  3RVF A;  4WVD A;  3ZR7 A;  4M8E A;  3MNP A;  5KRO A;  1UHL A;  4J5W C;  5AZV A;  3D57 A;  3R8D A;  2HCD A;  4UDA A;  4LSJ A;  3H52 A;  4PPS A;  3UUD A;  5DWE A;  2QPY A;  4J24 A;  2P7G A;  1Z5X U;  1PCG A;  3MNO A;  1GWR A;  2O4J A;  2PNU A;  3UP3 A;  3FXV A;  4QE6 A;  3W5P A;  3FUR A;  4J5W A;  2PIV A;  1S19 A;  4J26 A;  4XI3 A;  5DXG A;  4JYH A;  3VT9 A;  2PIU A;  3R8I A;  3KBA A;  5JY3 A;  1UHL B;  4QE8 A;  4YMQ A;  3BC5 A;  3AFR A;  1X7B A;  3UUD B;  3PO9 A;  3UVV A;  1XJ7 A;  2ZLC A;  4N5G A;  1NQ7 A;  1IE9 A;  3A9E A;  4R6S A;  4ZOM A;  4BCR A;  1M7W A;  4WQP A;  4M8H A;  4ZNU A;  3IA6 A;  3V3Q A;  4OEZ A;  3VTB A;  1PDU A;  5E0X A;  3TY0 A;  3OZ0 A;  4IA7 A;  5HYR A;  3UVV B;  4N73 A;  3Q95 A;  1T73 A;  1Z95 A;  3ADT A;  4OIU A;  4PLD A;  5KRF A;  2AX9 A;  4YPQ A;  2ZBS A;  2P1U A;  1FM6 D;  2VST A;  3GYT A;  2QXS A;  1X76 A;  3ILZ A;  2PRG A;  5EI1 A;  5DYB A;  4IVY A;  5G44 A;  5AAU A;  1YY4 A;  2BJ4 A;  3K6P A;  2J7X A;  2P15 A;  4QM0 A;  1IE8 A;  3KPZ A;  3VT4 A;  5DXE A;  3DY6 A;  3VT8 A;  3Q95 B;  4ONI A;  3OLF A;  5G5W A;  1XLS E;  3PRG A;  4IWF A;  4OEY A;  4RMD A;  4Q0A C;  5APK A;  5DRM A;  3UUA A;  5G45 A;  4OZR E;  4OFU A;  4ITF A;  3OOK A;  4OKX A;  2HFP A;  3AUR A;  3BQD A;  2PIP L;  3MNE A;  4MGA A;  2ZK5 A;  2Q70 A;  4OC7 A;  2BJ4 B;  4WHF A;  1K74 D;  1QKU A;  1I37 A;  5L7G A;  4S15 A;  3R29 A;  3KMG A;  1FM9 D;  4K6I A;  1GWQ A;  4R2U A;  1Z5X E;  1G2N A;  3HOD A;  4NB6 A;  4MG5 A;  4OH5 A;  5F9B A;  2ZK1 A;  5EHJ A;  2J4A A;  1I38 A;  2Q7K A;  2ZMJ A;  4LNX A;  4PWL A;  5DIG A;  5E1C A;  4RZG A;  2HWQ A;  1P8D A;  1LBD A;  4RZF A;  3UUA B;  1X78 A;  5FQT A;  3GD2 A;  5GID A;  2XKW A;  3OMQ A;  5DIE A;  4MGA B;  4YT1 A;  5KRH A;  1PQC A;  2ZMH A;  3ET1 A;  1Y0S A;  3OZJ A;  3ERT A;  3K22 A;  2QA6 A;  2ZL9 A;  4REE A;  5AAV B;  2ZNP A;  3D6D A;  4PVU A;  4G1Y A;  3VJH A;  4QK4 A;  5DUE A;  2AX8 A;  2ZLA A;  2HAR A;  1E3G A;  4RME A;  4PP6 A;  1EXA A;  2HB8 A;  3W5T A;  5I4V A;  1NAX A;  2ZKC A;  3OGT A;  5KD9 A;  3OSA A;  4NUF A;  3ADS A;  5KCC A;  1FM6 A;  1Y0X X;  2H79 A;  5DK9 A;  4OKB A;  5DSH A;  4NIE A;  3GBK A;  3U9Q A;  4JL4 A;  3VRV A;  5DV6 A;  4IW8 A;  3VTD A;  2QZO A;  4RZE A;  4ZJR A;  1XP1 A;  2ZNN A;  1LV2 A;  1XPC A;  1XV9 A;  3G8I A;  3PLZ A;  3A3Z X;  1FCX A;  1I7G A;  4MG7 B;  4QJR A;  5ETH A;  5GIC A;  5KCE A;  4HEE X;  4JYG A;  5FQP A;  3VRU A;  3L0E A;  3DZY A;  1K74 A;  2Q1V A;  1YIM A;  4WPF A;  1NQ0 A;  3RUT A;  2O9I A;  2AWH A;  2Q6J A;  4NY9 A;  4PF3 A;  3KWY A;  2QZO B;  3OKI A;  3VN2 A;  3TKC A;  1ZAF A;  5B5B A;  2XYX A;  2FAI A;  4DM6 A;  4X1F A;  1XV9 B;  4POH A;  1QKM A;  3KDU A;  2Q3Y A;  4IS8 A;  4S0T A;  3L1B A;  3AUN A;  2OAX A;  3HLV A;  4OFR A;  3OMO A;  5DWL A;  3X1I A;  2AAX A;  1NDE A;  1XNN A;  1YA3 A;  4DOS A;  2A3I A;  5DKG A;  4G1D A;  2P4Y A;  4IWC A;  2OZ7 A;  1R20 D;  1NRL A;  1RJK A;  1R5K A;  4R06 A;  1M2Z A;  1XOW A;  2AX7 A;  5DX3 A;  1XNX A;  5DZH A;  1YMT A;  1U3S A;  1L2J A;  2VV1 A;  1R6G A;  3L3X A;  5ACC A;  5L11 A;  3VRT A;  3CDS A;  5KCW A;  5M96 A;  4MDD A;  2NW4 A;  1YOW A;  2JJ3 A;  4G2H A;  5DUH A;  5DVV A;  3CWD A;  1UPW A;  3AZ2 A;  1YUC A;  4REF A;  4UDC A;  2QE4 A;  4F9M A;  5DX3 B;  2HAM A;  4ZO1 X;  1XLS A;  2PIN A;  4MGD A;  2Q8S A;  3VTC A;  2OVM A;  2AB2 A;  2QW4 A;  4G20 A;  2VV1 B;  1I7I A;  4IV2 A;  4OLM A;  2ZAS A;  4XTA A;  1U3Q A;  4DK7 A;  2ZY0 A;  2QH6 A;  2IOG A;  2ZMI A;  3KDT A;  3O1D A;  4Q13 A;  3RLL A;  3L03 A;  4ZNW A;  3OMP A;  5JI0 D;  4CSJ A;  1PQ6 A;  3UUC A;  2GL8 A;  2GWX A;  5DXR A;  2QGW A;  1MVC A;  4OK1 A;  5DLR A;  5DZ3 A;  4MGD B;  2POG A;  1N4H A;  3KMZ A;  1XAP A;  4ZNT A;  2Q7I A;  3V9Y A;  4OJ9 A;  3W0J A;  1ILH A;  5DP0 A;  4MG9 A;  3SP6 A;  5B41 A;  1XVP A;  1NHZ A;  4LBD A;  3V9V A;  1OVL A;  3OSW A;  4S14 A;  5DXP A;  4JGV A;  4N1Y A;  4EM9 A;  2OUZ A;  2Q6S A;  1YP0 A;  3FS1 A;  1TXI A;  1ZKY A;  3FEJ A;  2VV4 A;  4XUM A;  3OLS A;  5E14 A;  3K23 A;  1K7L A;  4ZN7 A;  3OKH A;  4POJ A;  2HB7 A;  5JJM A;  1R20 A;  2G0G A;  3HM1 A;  3UU7 A;  4CI4 A;  5C4T A;  2Z4J A;  3B0T A;  3CS4 A;  4K7A A;  4MG9 B;  1DB1 A;  1ZGY A;  1T7F A;  2P1V A;  4RFW A;  1XVP B;  1G1U A;  1YJE A;  2Q60 A;  3GWX A;  3IMY A;  2YLO A;  4N8R A;  1GS4 A;  4B7W A;  3A9E B;  3V49 A;  3ERD A;  5CJ6 A;  2VV4 B;  1KNU A;  3CS6 A;  3HO0 A;  2GPV A;  4LTW A;  5DI7 A;  4HLW A;  5JJM B;  3UU7 B;  2LBD A;  4XLD A;  2HWR A;  1MV9 A;  3GZ9 A;  4OIV A;  4RUO X;  2YFE A;  1KV6 A;  2V0V A;  3P88 A;  1XB7 A;  2J14 A;  3AZ3 A;  3WJ4 A;  4OHA A;  3RUU A;  2B1Z A;  3B65 A;  2PJL A;  2OM9 A;  2Q5S A;  5LGA A;  4OED A;  3X31 A;  5DVS A;  4ZJW A;  3UP0 A;  3B0R A;  1OSH A;  2PIO A;  2ZVT A;  5DKB A;  1T76 A;  3P89 A;  5KRI A;  3VRW A;  2I4Z A;  4J5X C;  4ZI1 A;  2GPU A;  5AVI A;  4TV1 A;  1T65 A;  3TX7 B;  3W0I A;  2AA7 A;  3R5M A;  4MG8 A;  2P7A A;  3VSP A;  2FSZ A;  3H0A D;  2ZK2 A;  4J5X A;  3NSQ A;  5G43 A;  2NXX A;  1ZH7 A;  1SKX A;  2AA6 A;  3B0Q A;  1FBY A;  3FC6 A;  3A40 X;  1ERR A;  4TV1 B;  5DWI A;  5KRM A;  5FQV A;  4YNK A;  1SQN A;  1L2I A;  3A2I A;  3R8A A;  4MG8 B;  4ZNS A;  5DV3 A;  5C4S A;  3AN3 A;  4DM8 A;  3A2J A;  3AX8 A;  3V4A A;  2JFA A;  2R6Y A;  3G8O A;  4K4J A;  2XYJ A;  2GP7 A;  5DY8 A;  3F5C A;  1QKN A;  3ADW A;  4OIL A;  5SYZ A;  2NV7 A;  3AUQ A;  3SZ1 A;  2AYR A;  1K4W A;  2B1V A;  5AWJ A;  5IZ0 A;  1ERE A;  5KCF A;  2Q5G A;  4RE8 A;  5KRK A;  2I4J A;  1UPV A;  3A78 A;  2HAS A;  3WWR A;  4ZN9 A;  1QKT A;  2ABI A;  3VT6 A;  3ZRA A;  3JZC A;  2JFA B;  2YHD A;  5APJ A;  3CQV A;  4XT9 A;  5DUG A;  3F5C B;  2J7Y A;  1U9E A;  2OCF A;  2QSE A;  3SP9 A;  3B3K A;  5ICK A;  1VJB A;  2YAT A;  3IXP D;  1RK3 A;  3W5Q A;  1YOK A;  4RUP A;  3KYT A;  1T79 A;  4PP5 A;  4OGH A;  1G5Y A;  3B1M A;  3KMR A;  1S9Q A;  3DZU D;  3HZF A;  4ITE A;  5EC9 A;  3VI8 A;  2QAB A;  4FHI A;  3VHU A;  3H0A A;  1FCZ A;  2ATH A;  4IA3 A;  4MGC A;  4PXM A;  1A28 A;  1OT7 A;  2QR9 A;  3B67 A;  2AX6 A;  1NQ1 A;  3HC5 A;  4OAR A;  1EXX A;  3T03 A;  5HYK A;  3B0W A;  3D24 A;  5DU5 A;  1MZN A;  2NXX E;  4G21 A;  1ZDT A;  2XHS A;  2ACL A;  3W0C A;  2V7C A;  3M7R A;  4A2J A;  4NQA B;  2PIQ A;  2HC4 A;  5KCD A;  2ZNO A;  3R2A A;  5DV8 A;  1GWX A;  1Q4X A;  4A4V A;  5DXB A;  3HQ5 A; 
#chains in the Genus database with same CATH homology
 1YIN A;  4FGY A;  4ZO1 B;  3G9E A;  2G44 A;  2IHQ A;  3CJW A;  5DID A;  2YJD A;  4OZT U;  3E7C A;  2ACL B;  5DZI A;  5H1E A;  2Q61 A;  3B66 A;  3CLD A;  2EWP A;  2YLY A;  3JZB A;  1WM0 X;  5DXB B;  1NUO A;  2AM9 A;  2XYW A;  4TUZ A;  4ZNH A;  4E4Q A;  2HVC A;  4DMA A;  5AZT A;  3E00 D;  2AA5 A;  1S0X A;  2E2R A;  5DMC A;  2Q7J A;  2G5O A;  3ADX A;  2I0J A;  3IXP A;  3WJ5 A;  3D5F A;  3OS9 A;  2REW A;  3OMK A;  2PIR A;  2QMV A;  5KRJ A;  5DWJ A;  2R40 A;  3O1E A;  3W0A A;  3DZU A;  2I4P A;  4TUZ B;  4FNE A;  1ZEO A;  1X7J A;  1U3R A;  2QA8 A;  2OVH A;  3W0Y A;  3DCT A;  1T63 A;  3FEI A;  4Q50 A;  4JAZ A;  5LWP A;  5L7H A;  4DQM A;  5APH A;  4FN9 A;  4G1Z A;  2AXA A;  2I0G A;  4RMC A;  3DZY D;  4OKT A;  2AO6 A;  3TKM A;  3QT0 A;  2VV3 A;  2YLQ A;  3X36 A;  1R1K D;  4OH6 A;  3VHV A;  4A4W A;  3V9T A;  1OVL B;  1FCY A;  5DZ0 A;  5IXK A;  1X7R A;  2QA8 B;  2PIT A;  3AZ1 A;  4MG6 A;  4OJB A;  5DXK A;  5HJS A;  2FVJ A;  5AAV A;  2Q7L A;  3BEJ A;  1BSX A;  3PCU A;  4IA1 A;  5GT4 A;  1PRG A;  4IA2 A;  3PBA A;  1PZL A;  1XDK A;  2VV0 A;  3OSI A;  3VJI A;  3IPS A;  3WT5 A;  4WHG A;  5GIE A;  1Y9R A;  3CDP A;  1ZDU A;  3EYB A;  1ILG A;  4PPP A;  1HG4 A;  1T74 A;  1RDT D;  5DVC A;  5E15 A;  4OZT E;  4OJ4 A;  3RY9 A;  3VJT A;  1XIU A;  1XQC A;  2B23 A;  5EIT A;  3VSO A;  3WMH A;  1T5Z A;  3ZRB A;  2O4R A;  4CI5 A;  3E00 A;  4IVW A;  2AMB A;  3ADV A;  3VT5 A;  5C4O A;  5KR9 A;  4O8F A;  3ZQT A;  5G3J A;  1XDK B;  4FHH A;  2POB A;  2Q6R A;  5G46 A;  3CTB A;  4EMA A;  4XAO A;  3N00 A;  4L96 A;  1S0Z A;  4E2J A;  4IUI A;  5KCT A;  3DR1 A;  1A52 A;  4G2I A;  2Q5P A;  5DKE A;  3FAL A;  2GPP A;  3L0L A;  1XP9 A;  2P1T A;  5E0W A;  3ET0 A;  2ZFX A;  1DKF A;  4PP3 A;  3F7D A;  5L7E A;  1SJ0 A;  3R5N A;  3V3E A;  3IPU A;  4IU7 A;  5FQS A;  4S0S A;  3CS8 A;  5K13 A;  2QXM A;  3GYU A;  2W8Y A;  3B5R A;  1E3K A;  3FAL B;  3OS8 C;  1R1K A;  2QTU A;  3VT3 A;  1YYE A;  3OLL A;  2HBH A;  1T7T A;  1DKF B;  3GWS X;  4OEA A;  1PK5 A;  3FC6 B;  4IV4 A;  3HVL A;  2AA2 A;  2ZK4 A;  5E7V A;  1M13 A;  3OS8 A;  3W5R A;  1KKQ A;  5AK2 A;  2ZK0 A;  3P0U A;  4JYI A;  3NSP A;  3X1H A;  4XHD A;  1FD0 A;  4RWV A;  5HZC A;  5KYA A;  2P54 A;  2AMA A;  3G0W A;  3KFC A;  2ZXZ A;  4ZNV A;  4DOR A;  2F4B A;  2R6W A;  1RDT A;  2VV2 A;  2VSR A;  5C4U A;  4PLE A;  3WFF A;  1RKH A;  3A2H A;  3GN8 A;  4KZJ A;  4UDD A;  1G50 A;  2JF9 A;  1XZX X;  5G42 A;  1XP6 A;  5DWG A;  2NPA A;  5DL4 A;  5DMF A;  4UDB A;  2PKL A;  2YJA B;  1NYX A;  5DRJ A;  1H9U A;  4XUH A;  3AN4 A;  3ET3 A;  3WT7 A;  5KCU A;  5KYJ A;  5AVL A;  3OAP A;  4MG7 A;  5KRC A;  2R40 D;  5DTV A;  2Q59 A;  4IQR A;  1UOM A;  5A86 A;  3VJS A;  3WFG A;  3OOF A;  5E19 A;  3VHW A;  5KRA A;  3L3Z A;  5DKS A;  3L0J A;  1OSV A;  2ZXM A;  3LBD A;  3WTQ A;  2IOK A;  3FUG A;  5KRL A;  3S9S A;  1S9P A;  4RAK A;  5HCV A;  1XQ3 A;  4P6X A;  4QL8 A;  3K8S A;  4APU A;  2Q59 B;  2B50 A;  2GIU A;  3LMP A;  3P8X A;  1T7R A;  1NQ2 A;  5DXM A;  5EJV A;  5AYG A;  5FQR A;  4WLB A;  1FM9 A;  1T7M A;  1TFC A;  2GTK A;  3E94 A;  3W0G A;  4DK8 A;  2GPO A;  1N83 A;  2H77 A;  3PEQ A;  3VT7 A;  2P7Z A;  1HJ1 A;  2ZK3 A;  4RUJ A;  4MGB A;  5DXQ A;  3DCU A;  1P93 A;  3D90 A;  3DT3 A;  4OKW A;  1X7E A;  2Z4B A;  5AWK A;  4LNW A;  5HJP A;  4KZM A;  4PRG A;  5EGV A;  1RKG A;  4IW6 A;  4Y29 A;  1NAV A;  4P6W A;  4L98 A;  5DYD A;  3WGP A;  3FLI A;  2PIW A;  4E4K A;  2BAW A;  5DZ1 A;  2ZXN A;  3HC6 A;  4KZI A;  4MGB B;  3ET2 A;  3RLJ A;  2G0H A;  2QNV A;  2ZNQ A;  3B68 A;  3OMM A;  3NOA A;  3W0H A;  2Q1H A;  1ZUC A;  1PQ9 A;  3WT6 A;  2QGT A;  1N46 A;  2ZK6 A;  3IPQ A;  2PIX A;  4X1G A;  5HJP B;  2YLP A;  5IAW A;  4OZR U;  1SR7 A;  3ADU A;  3RVF A;  4WVD A;  3ZR7 A;  4M8E A;  3MNP A;  5KRO A;  1UHL A;  4J5W C;  5AZV A;  3D57 A;  3R8D A;  2HCD A;  4UDA A;  4LSJ A;  3H52 A;  4PPS A;  3UUD A;  5DWE A;  2QPY A;  4J24 A;  2P7G A;  1Z5X U;  1PCG A;  3MNO A;  1GWR A;  2O4J A;  2PNU A;  3UP3 A;  3FXV A;  4QE6 A;  3W5P A;  3FUR A;  4J5W A;  2PIV A;  1S19 A;  4J26 A;  4XI3 A;  5DXG A;  4JYH A;  3VT9 A;  2PIU A;  3R8I A;  3KBA A;  5JY3 A;  1UHL B;  4QE8 A;  4YMQ A;  3BC5 A;  3AFR A;  1X7B A;  3UUD B;  3PO9 A;  3UVV A;  1XJ7 A;  2ZLC A;  4N5G A;  1NQ7 A;  1IE9 A;  3A9E A;  4R6S A;  4ZOM A;  4BCR A;  1M7W A;  4WQP A;  4M8H A;  4ZNU A;  3IA6 A;  3V3Q A;  4OEZ A;  3VTB A;  1PDU A;  5E0X A;  3TY0 A;  3OZ0 A;  4IA7 A;  5HYR A;  3UVV B;  4N73 A;  3Q95 A;  1T73 A;  1Z95 A;  3ADT A;  4OIU A;  4PLD A;  5KRF A;  2AX9 A;  4YPQ A;  2ZBS A;  2P1U A;  1FM6 D;  2VST A;  3GYT A;  2QXS A;  1X76 A;  3ILZ A;  2PRG A;  5EI1 A;  5DYB A;  4IVY A;  5G44 A;  5AAU A;  1YY4 A;  2BJ4 A;  3K6P A;  2J7X A;  2P15 A;  4QM0 A;  1IE8 A;  3KPZ A;  3VT4 A;  5DXE A;  3DY6 A;  3VT8 A;  3Q95 B;  4ONI A;  3OLF A;  5G5W A;  1XLS E;  3PRG A;  4IWF A;  4OEY A;  4RMD A;  4Q0A C;  5APK A;  5DRM A;  3UUA A;  5G45 A;  4OZR E;  4OFU A;  4ITF A;  3OOK A;  4OKX A;  2HFP A;  3AUR A;  3BQD A;  2PIP L;  3MNE A;  4MGA A;  2ZK5 A;  2Q70 A;  4OC7 A;  2BJ4 B;  4WHF A;  1K74 D;  1QKU A;  1I37 A;  5L7G A;  4S15 A;  3R29 A;  3KMG A;  1FM9 D;  4K6I A;  1GWQ A;  4R2U A;  1Z5X E;  1G2N A;  3HOD A;  4NB6 A;  4MG5 A;  4OH5 A;  5F9B A;  2ZK1 A;  5EHJ A;  2J4A A;  1I38 A;  2Q7K A;  2ZMJ A;  4LNX A;  4PWL A;  5DIG A;  5E1C A;  4RZG A;  2HWQ A;  1P8D A;  1LBD A;  4RZF A;  3UUA B;  1X78 A;  5FQT A;  3GD2 A;  5GID A;  2XKW A;  3OMQ A;  5DIE A;  4MGA B;  4YT1 A;  5KRH A;  1PQC A;  2ZMH A;  3ET1 A;  1Y0S A;  3OZJ A;  3ERT A;  3K22 A;  2QA6 A;  2ZL9 A;  4REE A;  5AAV B;  2ZNP A;  3D6D A;  4PVU A;  4G1Y A;  3VJH A;  4QK4 A;  5DUE A;  2AX8 A;  2ZLA A;  2HAR A;  1E3G A;  4RME A;  4PP6 A;  1EXA A;  2HB8 A;  3W5T A;  5I4V A;  1NAX A;  2ZKC A;  3OGT A;  5KD9 A;  3OSA A;  4NUF A;  3ADS A;  5KCC A;  1FM6 A;  1Y0X X;  2H79 A;  5DK9 A;  4OKB A;  5DSH A;  4NIE A;  3GBK A;  3U9Q A;  4JL4 A;  3VRV A;  5DV6 A;  4IW8 A;  3VTD A;  2QZO A;  4RZE A;  4ZJR A;  1XP1 A;  2ZNN A;  1LV2 A;  1XPC A;  1XV9 A;  3G8I A;  3PLZ A;  3A3Z X;  1FCX A;  1I7G A;  4MG7 B;  4QJR A;  5ETH A;  5GIC A;  5KCE A;  4HEE X;  4JYG A;  5FQP A;  3VRU A;  3L0E A;  3DZY A;  1K74 A;  2Q1V A;  1YIM A;  4WPF A;  1NQ0 A;  3RUT A;  2O9I A;  2AWH A;  2Q6J A;  4NY9 A;  4PF3 A;  3KWY A;  2QZO B;  3OKI A;  3VN2 A;  3TKC A;  1ZAF A;  5B5B A;  2XYX A;  2FAI A;  4DM6 A;  4X1F A;  1XV9 B;  4POH A;  1QKM A;  3KDU A;  2Q3Y A;  4IS8 A;  4S0T A;  3L1B A;  3AUN A;  2OAX A;  3HLV A;  4OFR A;  3OMO A;  5DWL A;  3X1I A;  2AAX A;  1NDE A;  1XNN A;  1YA3 A;  4DOS A;  2A3I A;  5DKG A;  4G1D A;  2P4Y A;  4IWC A;  2OZ7 A;  1R20 D;  1NRL A;  1RJK A;  1R5K A;  4R06 A;  1M2Z A;  1XOW A;  2AX7 A;  5DX3 A;  1XNX A;  5DZH A;  1YMT A;  1U3S A;  1L2J A;  2VV1 A;  1R6G A;  3L3X A;  5ACC A;  5L11 A;  3VRT A;  3CDS A;  5KCW A;  5M96 A;  4MDD A;  2NW4 A;  1YOW A;  2JJ3 A;  4G2H A;  5DUH A;  5DVV A;  3CWD A;  1UPW A;  3AZ2 A;  1YUC A;  4REF A;  4UDC A;  2QE4 A;  4F9M A;  5DX3 B;  2HAM A;  4ZO1 X;  1XLS A;  2PIN A;  4MGD A;  2Q8S A;  3VTC A;  2OVM A;  2AB2 A;  2QW4 A;  4G20 A;  2VV1 B;  1I7I A;  4IV2 A;  4OLM A;  2ZAS A;  4XTA A;  1U3Q A;  4DK7 A;  2ZY0 A;  2QH6 A;  2IOG A;  2ZMI A;  3KDT A;  3O1D A;  4Q13 A;  3RLL A;  3L03 A;  4ZNW A;  3OMP A;  5JI0 D;  4CSJ A;  1PQ6 A;  3UUC A;  2GL8 A;  2GWX A;  5DXR A;  2QGW A;  1MVC A;  4OK1 A;  5DLR A;  5DZ3 A;  4MGD B;  2POG A;  1N4H A;  3KMZ A;  1XAP A;  4ZNT A;  2Q7I A;  3V9Y A;  4OJ9 A;  3W0J A;  1ILH A;  5DP0 A;  4MG9 A;  3SP6 A;  5B41 A;  1XVP A;  1NHZ A;  4LBD A;  3V9V A;  1OVL A;  3OSW A;  4S14 A;  5DXP A;  4JGV A;  4N1Y A;  4EM9 A;  2OUZ A;  2Q6S A;  1YP0 A;  3FS1 A;  1TXI A;  1ZKY A;  3FEJ A;  2VV4 A;  4XUM A;  3OLS A;  5E14 A;  3K23 A;  1K7L A;  4ZN7 A;  3OKH A;  4POJ A;  2HB7 A;  5JJM A;  1R20 A;  2G0G A;  3HM1 A;  3UU7 A;  4CI4 A;  5C4T A;  2Z4J A;  3B0T A;  3CS4 A;  4K7A A;  4MG9 B;  1DB1 A;  1ZGY A;  1T7F A;  2P1V A;  4RFW A;  1XVP B;  1G1U A;  1YJE A;  2Q60 A;  3GWX A;  3IMY A;  2YLO A;  4N8R A;  1GS4 A;  4B7W A;  3A9E B;  3V49 A;  3ERD A;  5CJ6 A;  2VV4 B;  1KNU A;  3CS6 A;  3HO0 A;  2GPV A;  4LTW A;  5DI7 A;  4HLW A;  5JJM B;  3UU7 B;  2LBD A;  4XLD A;  2HWR A;  1MV9 A;  3GZ9 A;  4OIV A;  4RUO X;  2YFE A;  1KV6 A;  2V0V A;  3P88 A;  1XB7 A;  2J14 A;  3AZ3 A;  3WJ4 A;  4OHA A;  3RUU A;  2B1Z A;  3B65 A;  2PJL A;  2OM9 A;  2Q5S A;  5LGA A;  4OED A;  3X31 A;  5DVS A;  4ZJW A;  3UP0 A;  3B0R A;  1OSH A;  2PIO A;  2ZVT A;  5DKB A;  1T76 A;  3P89 A;  5KRI A;  3VRW A;  2I4Z A;  4J5X C;  4ZI1 A;  2GPU A;  5AVI A;  4TV1 A;  1T65 A;  3TX7 B;  3W0I A;  2AA7 A;  3R5M A;  4MG8 A;  2P7A A;  3VSP A;  2FSZ A;  3H0A D;  2ZK2 A;  4J5X A;  3NSQ A;  5G43 A;  2NXX A;  1ZH7 A;  1SKX A;  2AA6 A;  3B0Q A;  1FBY A;  3FC6 A;  3A40 X;  1ERR A;  4TV1 B;  5DWI A;  5KRM A;  5FQV A;  4YNK A;  1SQN A;  1L2I A;  3A2I A;  3R8A A;  4MG8 B;  4ZNS A;  5DV3 A;  5C4S A;  3AN3 A;  4DM8 A;  3A2J A;  3AX8 A;  3V4A A;  2JFA A;  2R6Y A;  3G8O A;  4K4J A;  2XYJ A;  2GP7 A;  5DY8 A;  3F5C A;  1QKN A;  3ADW A;  4OIL A;  5SYZ A;  2NV7 A;  3AUQ A;  3SZ1 A;  2AYR A;  1K4W A;  2B1V A;  5AWJ A;  5IZ0 A;  1ERE A;  5KCF A;  2Q5G A;  4RE8 A;  5KRK A;  2I4J A;  1UPV A;  3A78 A;  2HAS A;  3WWR A;  4ZN9 A;  1QKT A;  2ABI A;  3VT6 A;  3ZRA A;  3JZC A;  2JFA B;  2YHD A;  5APJ A;  3CQV A;  4XT9 A;  5DUG A;  3F5C B;  2J7Y A;  1U9E A;  2OCF A;  2QSE A;  3SP9 A;  3B3K A;  5ICK A;  1VJB A;  2YAT A;  3IXP D;  1RK3 A;  3W5Q A;  1YOK A;  4RUP A;  3KYT A;  1T79 A;  4PP5 A;  4OGH A;  1G5Y A;  3B1M A;  3KMR A;  1S9Q A;  3DZU D;  3HZF A;  4ITE A;  5EC9 A;  3VI8 A;  2QAB A;  4FHI A;  3VHU A;  3H0A A;  1FCZ A;  2ATH A;  4IA3 A;  4MGC A;  4PXM A;  1A28 A;  1OT7 A;  2QR9 A;  3B67 A;  2AX6 A;  1NQ1 A;  3HC5 A;  4OAR A;  1EXX A;  3T03 A;  5HYK A;  3B0W A;  3D24 A;  5DU5 A;  1MZN A;  2NXX E;  4G21 A;  1ZDT A;  2XHS A;  2ACL A;  3W0C A;  2V7C A;  3M7R A;  4A2J A;  4NQA B;  2PIQ A;  2HC4 A;  5KCD A;  2ZNO A;  3R2A A;  5DV8 A;  1GWX A;  1Q4X A;  4A4V A;  5DXB A;  3HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...