4WQPA

Crystal structure of rorc in complex with a benzyl sulfonamide inverse agonist
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
234
structure length
234
Chain Sequence
ASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Minor Structural Change to Tertiary Sulfonamide RORc Ligands Led to Opposite Mechanisms of Action.
pubmed doi rcsb
molecule keywords Nuclear receptor ROR-gamma
molecule tags Transcription
source organism Homo sapiens
total genus 89
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4wqpA00
2Q6RA 1U9EA 3ADSA 3L03A 3DCUA 1FM6A 5G44A 1X78A 3F5CB 1N46A 1SR7A 2ABIA 4FGYA 4OZRU 2ZASA 4RAKA 4DORA 2Q1VA 4MDDA 4WHFA 2POBA 2B50A 1R6GA 3OMKA 4J26A 4HLWA 4NY9A 5DMCA 1QKTA 2P15A 2VSTA 1X7RA 5DZ1A 5KD9A 1X7JA 1NQ2A 3D90A 1T76A 4RUOX 3TKMA 3BQDA 1RK3A 4FHHA 5APKA 1P93A 4G2HA 3V3QA 4BCRA 2ZNPA 4PP6A 3MNEA 1Y0SA 1MV9A 4PP5A 1T7MA 1N4HA 4OKWA 3RUTA 5C4TA 5FQVA 4MG9B 4XAOA 5DXBA 1XB7A 2O4RA 3CS8A 4ZNWA 5HYKA 1ILGA 5EGVA 4ZNTA 2H79A 2AM9A 3DZUA 3D24A 4DM6A 2XYJA 1RDTA 4X1GA 3ET3A 5HJPB 1ZAFA 1ERRA 3VTCA 2P1UA 4E4KA 4MGBA 5E7VA 4J5WC 3OOKA 3GD2A 3X1IA 4L96A 2OCFA 4MGAB 3K8SA 4XT9A 2GPVA 4ZN7A 2Z4JA 3G9EA 1R20A 1ZEOA 2HAMA 3OLFA 1YYEA 3IPUA 2AB2A 1KV6A 3FXVA 4P6WA 1K74D 2QZOA 3A2JA 3A9EA 4K6IA 3OZ0A 4R2UA 4ZNHA 5ETHA 5IZ0A 5DSHA 1PRGA 3FC6A 5DVSA 3VSOA 4IA1A 3K23A 4M8EA 1NHZA 4PPPA 5AWKA 2R40A 4DM8A 4IWFA 4RWVA 2OZ7A 1X7EA 4FHIA 2ZK4A 3A2IA 4EMAA 2VV1B 5AK2A 4QE6A 4OKTA 4LBDA 4OK1A 3R8AA 3CJWA 1TXIA 4OZRE 3OLLA 1QKMA 4QK4A 1T5ZA 4E2JA 3R5MA 3FALB 4K7AA 1E3KA 4MG6A 5KRJA 2POGA 5DIDA 5KCWA 3VT9A 3HLVA 4IW8A 3W0JA 3UP0A 1U3RA 3L0EA 1EREA 3R8DA 4J5XC 3R2AA 5HCVA 2PIUA 3ZRAA 5KYAA 2NXXA 1ILHA 3VI8A 2QSEA 3Q95B 4OJBA 3P8XA 4B7WA 1XNNA 2QA8B 4WVDA 3DY6A 2QXMA 3H52A 4REFA 3TY0A 2I0JA 1T63A 2P4YA 4PPSA 4R06A 1S9PA 3KMRA 4NIEA 4WHGA 2I4JA 3K6PA 3OMQA 4WLBA 3VT7A 1E3GA 2YJAB 4OJ4A 1XQCA 3WT6A 4LTWA 1G1UA 3VTDA 3A40X 5GIDA 1YIMA 1RKGA 2GTKA 2HVCA 4KZJA 2PNUA 4E4QA 1R5KA 1Y9RA 5DYDA 3CWDA 2ZNNA 4RZFA 1N83A 4DK8A 5DX3B 4OKBA 3FURA 4S0TA 4ZO1B 4TUZB 3VT5A 2AMBA 1PQCA 5H1EA 2G5OA 2ZK2A 2AXAA 4OARA 3P0UA 4KZIA 3LBDA 4PLEA 5DUEA 1GWRA 4LNXA 5HYRA 3CS4A 2ZLAA 1XQ3A 3ERTA 1DKFB 1HG4A 3IPQA 1DB1A 4G21A 5APHA 2VV3A 5DXPA 2GL8A 5DV8A 2AA2A 4A4WA 3E00D 5EI1A 4IS8A 5K13A 2Q1HA 2IHQA 2AAXA 2IOGA 3A3ZX 2QPYA 4FN9A 1XIUA 2ATHA 3UUDB 3RVFA 3L0JA 5I4VA 4XUHA 5DKGA 5EITA 1K74A 2J4AA 2YLPA 3VJHA 4IA2A 2Q7IA 4NQAB 1FCXA 1QKNA 5JJMA 1UPVA 4OIUA 2FAIA 2NV7A 2P7GA 4OHAA 3IPSA 3WGPA 5G43A 4A2JA 3W0YA 2YFEA 5B5BA 1RJKA 5IXKA 4IV4A 4R6SA 5KYJA 2XYWA 3ERDA 2HCDA 2Q7KA 2QA6A 4IA7A 3SP9A 2JF9A 2E2RA 5AAVB 2JFAB 2PIOA 1PQ6A 1K7LA 2QGWA 5C4SA 3B0RA 4IVWA 4REEA 1OVLB 3AUQA 3OSAA 3G8IA 4XHDA 5DKBA 2R6WA 1S19A 5AVLA 5AWJA 3WT5A 1A28A 3KFCA 2ZVTA 3EYBA 2P1VA 4XUMA 3TKCA 3V3EA 3WT7A 3P88A 4IU7A 4OEZA 3VRUA 1I37A 2PIQA 3CDSA 3CDPA 3UU7B 3V9YA 5E0WA 5DTVA 3R8IA 3F5CA 4PVUA 3U9QA 2VV4B 3QT0A 1YA3A 1Z95A 5HZCA 4UDAA 1YINA 3VT8A 4OJ9A 3ET2A 4YNKA 2J7XA 4APUA 3UVVB 1PZLA 3A2HA 1YP0A 3AX8A 2FVJA 3W5PA 1NQ1A 3GYUA 1U3SA 5DUGA 3VHUA 2PITA 4QM0A 3H0AD 1XAPA 5DV6A 1Z5XU 4CI5A 4G2IA 3ADVA 3KYTA 1QKUA 2ZK3A 1Q4XA 4RE8A 2AO6A 1T74A 2PJLA 2PIRA 2Q70A 5DXRA 3PLZA 5LGAA 2QTUA 4MG9A 2REWA 2AA5A 3W5RA 1NYXA 3JZBA 4OC7A 2ZXNA 3L0LA 1NRLA 2XHSA 2YJDA 4OEYA 2GPPA 1YMTA 1T7TA 2EWPA 4RZEA 2HWQA 3E00A 5HJPA 5DXEA 2GIUA 5DWEA 5C4OA 2PRGA 5FQTA 2QR9A 4DK7A 2HARA 1G2NA 1NQ7A 4MGDB 2B23A 2PINA 2PIWA 5L7HA 1M7WA 4MGAA 2AWHA 4IQRA 3GWXA 1T7FA 3OS8A 4IV2A 3W0IA 3JZCA 2V7CA 1OSHA 2H77A 3CLDA 3AN4A 3KDTA 3L1BA 5KRAA 3SP6A 2HWRA 4TV1B 2AYRA 5DP0A 2G0GA 3OLSA 3E94A 4J24A 4M8HA 4OGHA 3T03A 1VJBA 3X1HA 3ADWA 4X1FA 5GICA 2P7AA 5KRCA 4KZMA 4OH6A 3BC5A 2W8YA 5DV3A 3RLJA 5KROA 3PO9A 3D57A 1L2IA 3OMPA 4N8RA 5E19A 4QL8A 1P8DA 3B68A 2QE4A 2Q5SA 2VV1A 5HJSA 3B66A 4PLDA 3B0TA 5ICKA 3VRTA 2Q7LA 3KMGA 5KCEA 5DYBA 2QABA 3FEJA 3O1DA 3FALA 1XNXA 3NSQA 1YJEA 1ZGYA 4XI3A 5DXGA 3B0WA 4YT1A 1SKXA 2ZL9A 2LBDA 4G20A 4IWCA 4RMCA 5KRMA 3NOAA 3Q95A 4IA3A 5DUHA 2QA8A 2P54A 5DKSA 3H0AA 4MG8B 5G42A 2BJ4B 1Z5XE 2Q60A 3KBAA 2Q6SA 4RFWA 2AA6A 4K4JA 3KDUA 1LV2A 3B67A 4UDCA 4ZOMA 3G8OA 5KCDA 4LSJA 3S9SA 1FCZA 4POHA 2ZMJA 1XV9B 2ZK5A 3A78A 5DU5A 3X31A 4A4VA 3W0CA 2Q59B 2ZMIA 1XDKB 3VRVA 5DX3A 3DT3A 3N00A 2HFPA 4IW6A 3VHVA 5B41A 2GWXA 3VT4A 1SQNA 1MZNA 2OAXA 2QH6A 3KMZA 1FM9D 4TUZA 1KKQA 1XP1A 3R5NA 3M7RA 3PBAA 3UUAB 5AVIA 5EHJA 1Y0XX 3G0WA 3CS6A 4ZNSA 3E7CA 1DKFA 4IVYA 4G1DA 1FCYA 4MG7B 2HASA 2B1VA 3OSIA 3CQVA 2ZNQA 1U3QA 4ZJRA 4EM9A 5FQSA 5KRIA 4S14A 2ZXZA 2ZK1A 3FUGA 3GBKA 4OZTU 3UUDA 3DCTA 5DWLA 3OOFA 3VT6A 3FLIA 3WWRA 2Q61A 4RZGA 2Q7JA 5LWPA 3AN3A 4PP3A 2QGTA 5APJA 1PCGA 2YLYA 3ADUA 4JL4A 3OKHA 2NW4A 4PWLA 5FQRA 1I7GA 3RUUA 1T79A 1LBDA 5DZ3A 1S0ZA 4Q13A 1S0XA 1UHLB 3AUNA 5DIGA 5DVCA 3OMOA 4P6XA 5AAVA 2JFAA 4XTAA 1T7RA 3B65A 3GZ9A 1XVPB 1HJ1A 4PF3A 4Q50A 5DVVA 3VT3A 1OVLA 5KCTA 2ACLB 3HQ5A 3W0HA 4NB6A 3VJSA 2F4BA 2ZBSA 5DWGA 5DXMA 2O4JA 1ZDUA 2OVMA 4JAZA 3UU7A 1XZXX 1MVCA 1OSVA 4N73A 2Z4BA 2ZLCA 3OZJA 5DZHA 3DZYD 2VV4A 2HC4A 3VHWA 3BEJA 5E14A 2BAWA 1PQ9A 4WPFA 3UVVA 3HODA 5KCFA 3IXPD 3VN2A 1BSXA 3MNOA 5JI0D 5EJVA 3O1EA 2XYXA 4OEAA 5FQPA 3KWYA 5E15A 5DZIA 3KPZA 4DOSA 4MG5A 5E0XA 4ZNVA 1EXAA 2Q6JA 3V49A 3W0AA 5KCCA 2R6YA 5L11A 2NPAA 3ILZA 4ONIA 2GPOA 1FM9A 3AFRA 5DY8A 3HC5A 4S15A 2GP7A 3WFGA 4UDBA 2OVHA 2AX7A 5EC9A 1YOWA 3V9TA 4ZNUA 1FD0A 2I4PA 3IA6A 5DK9A 5G45A 4OZTE 4MGDA 3WJ4A 5G46A 3DR1A 2OM9A 5DRMA 1R1KD 5DLRA 1ZUCA 3OMMA 2P1TA 2AMAA 5DL4A 5SYZA 1T65A 2YLQA 2ZXMA 3OS8C 2G0HA 4OFRA 3B5RA 3HZFA 5L7EA 4JYIA 5AZTA 3L3ZA 4MGCA 2GPUA 5DXBB 4YMQA 3WJ5A 4O8FA 4TV1A 4OIVA 4OKXA 2QMVA 4ZO1X 4JGVA 3IMYA 4PXMA 1XP6A 3PCUA 3OS9A 3GWSX 4IUIA 2PIPL 4MGBB 5KRHA 4J5WA 2AA7A 5C4UA 2PIXA 1G5YA 1XLSA 3LMPA 3PRGA 2Q3YA 2J14A 5KCUA 5KRFA 3PEQA 5IAWA 4ZJWA 2B1ZA 2ZY0A 5DXKA 3MNPA 1NUOA 3ZR7A 1NAXA 1ZH7A 3AZ3A 1ZKYA 5DKEA 2HBHA 5DRJA 4HEEX 2YHDA 2PIVA 2QZOB 3A9EB 4N5GA 5AAUA 3DZYA 4LNWA 3FC6B 3TX7B 2HB7A 1S9QA 5AYGA 2IOKA 3AZ1A 1TFCA 3P89A 3IXPA 4PRGA 5DZ0A 1XLSE 4Y29A 5M96A 1YOKA 2G44A 1GWQA 1I38A 4OFUA 4QE8A 1KNUA 2AX9A 4MG8A 1FBYA 2QNVA 2BJ4A 3UP3A 5DWIA 3W5TA 4G1ZA 1UOMA 2ZFXA 3AZ2A 4ITFA 4RUJA 3UUCA 3ZRBA 3WTQA 3WMHA 3HVLA 1FM6D 4ITEA 3OGTA 1G50A 1XV9A 4DMAA 1L2JA 1A52A 2VSRA 2YATA 2Q59A 2ZMHA 1XDKA 3HO0A 4J5XA 4N1YA 5AZVA 4ZN9A 2ZK6A 3D6DA 5G3JA 4RMEA 2J7YA 1PK5A 4OH5A 5GIEA 1XJ7A 3SZ1A 3L3XA 5DXQA 1EXXA 3UUAA 2XKWA 3AURA 3VTBA 1R1KA 3VRWA 3RY9A 4DQMA 4MG7A 2I0GA 2V0VA 3CTBA 4ZI1A 5CJ6A 1M13A 4RUPA 4OILA 2A3IA 2QW4A 2ZK0A 4JYHA 3W0GA 4L98A 1GWXA 4UDDA 3ET1A 2Q5PA 2PKLA 5L7GA 3HC6A 4OEDA 5GT4A 1M2ZA 3V9VA 1XP9A 1PDUA 4YPQA 3OKIA 3WFFA 4CSJA 2QXSA 4XLDA 2Q5GA 3OSWA 2AX8A 2NXXE 3GYTA 4FNEA 3W5QA 2HB8A 3OAPA 1OT7A 5G5WA 2ZNOA 4OLMA 5DMFA 3VJTA 1GS4A 1NQ0A 3ADXA 3GN8A 5A86A 3VSPA 1UHLA 4WQPA 4CI4A 5KRKA 1X7BA 3DZUD 5E1CA 2P7ZA 1RDTD 2VV0A 2OUZA 3FEIA 3B1MA 1XOWA 3FS1A 4Q0AC 1WM0X 1K4WA 1X76A 2AX6A 3F7DA 2I4ZA 1XVPA 3D5FA 3K22A 4G1YA 1H9UA 4QJRA 2ACLA 4RMDA 3RLLA 3X36A 4S0SA 4F9MA 1IE8A 3ZQTA 5DWJA 3ET0A 5JJMB 3ADTA 1SJ0A 4POJA 2O9IA 1R20D 1YY4A 2YLOA 1T73A 4NUFA 1NDEA 3VJIA 1IE9A 1XPCA 5DIEA 5DI7A 3R29A 3HM1A 5F9BA 3B0QA 5ACCA 1NAVA 5JY3A 1ZDTA 1YUCA 2JJ3A 5KRLA 2R40D 1I7IA 5KR9A 2VV2A 1UPWA 3V4AA 3NSPA 2ZKCA 2FSZA 3B3KA 1RKHA 2Q8SA 4JYGA
chains in the Genus database with same CATH superfamily
2Q6RA 1U9EA 3ADSA 3L03A 3DCUA 1FM6A 5G44A 1X78A 3F5CB 1N46A 1SR7A 2ABIA 4FGYA 4OZRU 2ZASA 4RAKA 4DORA 2Q1VA 4MDDA 4WHFA 2POBA 2B50A 1R6GA 3OMKA 4J26A 4HLWA 4NY9A 5DMCA 1QKTA 2P15A 2VSTA 1X7RA 5DZ1A 5KD9A 1X7JA 1NQ2A 3D90A 1T76A 4RUOX 3TKMA 3BQDA 1RK3A 4FHHA 5APKA 1P93A 4G2HA 3V3QA 4BCRA 2ZNPA 4PP6A 3MNEA 1Y0SA 1MV9A 4PP5A 1T7MA 1N4HA 4OKWA 3RUTA 5C4TA 5FQVA 4MG9B 4XAOA 5DXBA 1XB7A 2O4RA 3CS8A 4ZNWA 5HYKA 1ILGA 5EGVA 4ZNTA 2H79A 2AM9A 3DZUA 3D24A 4DM6A 2XYJA 1RDTA 4X1GA 3ET3A 5HJPB 1ZAFA 1ERRA 3VTCA 2P1UA 4E4KA 4MGBA 5E7VA 4J5WC 3OOKA 3GD2A 3X1IA 4L96A 2OCFA 4MGAB 3K8SA 4XT9A 2GPVA 4ZN7A 2Z4JA 3G9EA 1R20A 1ZEOA 2HAMA 3OLFA 1YYEA 3IPUA 2AB2A 1KV6A 3FXVA 4P6WA 1K74D 2QZOA 3A2JA 3A9EA 4K6IA 3OZ0A 4R2UA 4ZNHA 5ETHA 5IZ0A 5DSHA 1PRGA 3FC6A 5DVSA 3VSOA 4IA1A 3K23A 4M8EA 1NHZA 4PPPA 5AWKA 2R40A 4DM8A 4IWFA 4RWVA 2OZ7A 1X7EA 4FHIA 2ZK4A 3A2IA 4EMAA 2VV1B 5AK2A 4QE6A 4OKTA 4LBDA 4OK1A 3R8AA 3CJWA 1TXIA 4OZRE 3OLLA 1QKMA 4QK4A 1T5ZA 4E2JA 3R5MA 3FALB 4K7AA 1E3KA 4MG6A 5KRJA 2POGA 5DIDA 5KCWA 3VT9A 3HLVA 4IW8A 3W0JA 3UP0A 1U3RA 3L0EA 1EREA 3R8DA 4J5XC 3R2AA 5HCVA 2PIUA 3ZRAA 5KYAA 2NXXA 1ILHA 3VI8A 2QSEA 3Q95B 4OJBA 3P8XA 4B7WA 1XNNA 2QA8B 4WVDA 3DY6A 2QXMA 3H52A 4REFA 3TY0A 2I0JA 1T63A 2P4YA 4PPSA 4R06A 1S9PA 3KMRA 4NIEA 4WHGA 2I4JA 3K6PA 3OMQA 4WLBA 3VT7A 1E3GA 2YJAB 4OJ4A 1XQCA 3WT6A 4LTWA 1G1UA 3VTDA 3A40X 5GIDA 1YIMA 1RKGA 2GTKA 2HVCA 4KZJA 2PNUA 4E4QA 1R5KA 1Y9RA 5DYDA 3CWDA 2ZNNA 4RZFA 1N83A 4DK8A 5DX3B 4OKBA 3FURA 4S0TA 4ZO1B 4TUZB 3VT5A 2AMBA 1PQCA 5H1EA 2G5OA 2ZK2A 2AXAA 4OARA 3P0UA 4KZIA 3LBDA 4PLEA 5DUEA 1GWRA 4LNXA 5HYRA 3CS4A 2ZLAA 1XQ3A 3ERTA 1DKFB 1HG4A 3IPQA 1DB1A 4G21A 5APHA 2VV3A 5DXPA 2GL8A 5DV8A 2AA2A 4A4WA 3E00D 5EI1A 4IS8A 5K13A 2Q1HA 2IHQA 2AAXA 2IOGA 3A3ZX 2QPYA 4FN9A 1XIUA 2ATHA 3UUDB 3RVFA 3L0JA 5I4VA 4XUHA 5DKGA 5EITA 1K74A 2J4AA 2YLPA 3VJHA 4IA2A 2Q7IA 4NQAB 1FCXA 1QKNA 5JJMA 1UPVA 4OIUA 2FAIA 2NV7A 2P7GA 4OHAA 3IPSA 3WGPA 5G43A 4A2JA 3W0YA 2YFEA 5B5BA 1RJKA 5IXKA 4IV4A 4R6SA 5KYJA 2XYWA 3ERDA 2HCDA 2Q7KA 2QA6A 4IA7A 3SP9A 2JF9A 2E2RA 5AAVB 2JFAB 2PIOA 1PQ6A 1K7LA 2QGWA 5C4SA 3B0RA 4IVWA 4REEA 1OVLB 3AUQA 3OSAA 3G8IA 4XHDA 5DKBA 2R6WA 1S19A 5AVLA 5AWJA 3WT5A 1A28A 3KFCA 2ZVTA 3EYBA 2P1VA 4XUMA 3TKCA 3V3EA 3WT7A 3P88A 4IU7A 4OEZA 3VRUA 1I37A 2PIQA 3CDSA 3CDPA 3UU7B 3V9YA 5E0WA 5DTVA 3R8IA 3F5CA 4PVUA 3U9QA 2VV4B 3QT0A 1YA3A 1Z95A 5HZCA 4UDAA 1YINA 3VT8A 4OJ9A 3ET2A 4YNKA 2J7XA 4APUA 3UVVB 1PZLA 3A2HA 1YP0A 3AX8A 2FVJA 3W5PA 1NQ1A 3GYUA 1U3SA 5DUGA 3VHUA 2PITA 4QM0A 3H0AD 1XAPA 5DV6A 1Z5XU 4CI5A 4G2IA 3ADVA 3KYTA 1QKUA 2ZK3A 1Q4XA 4RE8A 2AO6A 1T74A 2PJLA 2PIRA 2Q70A 5DXRA 3PLZA 5LGAA 2QTUA 4MG9A 2REWA 2AA5A 3W5RA 1NYXA 3JZBA 4OC7A 2ZXNA 3L0LA 1NRLA 2XHSA 2YJDA 4OEYA 2GPPA 1YMTA 1T7TA 2EWPA 4RZEA 2HWQA 3E00A 5HJPA 5DXEA 2GIUA 5DWEA 5C4OA 2PRGA 5FQTA 2QR9A 4DK7A 2HARA 1G2NA 1NQ7A 4MGDB 2B23A 2PINA 2PIWA 5L7HA 1M7WA 4MGAA 2AWHA 4IQRA 3GWXA 1T7FA 3OS8A 4IV2A 3W0IA 3JZCA 2V7CA 1OSHA 2H77A 3CLDA 3AN4A 3KDTA 3L1BA 5KRAA 3SP6A 2HWRA 4TV1B 2AYRA 5DP0A 2G0GA 3OLSA 3E94A 4J24A 4M8HA 4OGHA 3T03A 1VJBA 3X1HA 3ADWA 4X1FA 5GICA 2P7AA 5KRCA 4KZMA 4OH6A 3BC5A 2W8YA 5DV3A 3RLJA 5KROA 3PO9A 3D57A 1L2IA 3OMPA 4N8RA 5E19A 4QL8A 1P8DA 3B68A 2QE4A 2Q5SA 2VV1A 5HJSA 3B66A 4PLDA 3B0TA 5ICKA 3VRTA 2Q7LA 3KMGA 5KCEA 5DYBA 2QABA 3FEJA 3O1DA 3FALA 1XNXA 3NSQA 1YJEA 1ZGYA 4XI3A 5DXGA 3B0WA 4YT1A 1SKXA 2ZL9A 2LBDA 4G20A 4IWCA 4RMCA 5KRMA 3NOAA 3Q95A 4IA3A 5DUHA 2QA8A 2P54A 5DKSA 3H0AA 4MG8B 5G42A 2BJ4B 1Z5XE 2Q60A 3KBAA 2Q6SA 4RFWA 2AA6A 4K4JA 3KDUA 1LV2A 3B67A 4UDCA 4ZOMA 3G8OA 5KCDA 4LSJA 3S9SA 1FCZA 4POHA 2ZMJA 1XV9B 2ZK5A 3A78A 5DU5A 3X31A 4A4VA 3W0CA 2Q59B 2ZMIA 1XDKB 3VRVA 5DX3A 3DT3A 3N00A 2HFPA 4IW6A 3VHVA 5B41A 2GWXA 3VT4A 1SQNA 1MZNA 2OAXA 2QH6A 3KMZA 1FM9D 4TUZA 1KKQA 1XP1A 3R5NA 3M7RA 3PBAA 3UUAB 5AVIA 5EHJA 1Y0XX 3G0WA 3CS6A 4ZNSA 3E7CA 1DKFA 4IVYA 4G1DA 1FCYA 4MG7B 2HASA 2B1VA 3OSIA 3CQVA 2ZNQA 1U3QA 4ZJRA 4EM9A 5FQSA 5KRIA 4S14A 2ZXZA 2ZK1A 3FUGA 3GBKA 4OZTU 3UUDA 3DCTA 5DWLA 3OOFA 3VT6A 3FLIA 3WWRA 2Q61A 4RZGA 2Q7JA 5LWPA 3AN3A 4PP3A 2QGTA 5APJA 1PCGA 2YLYA 3ADUA 4JL4A 3OKHA 2NW4A 4PWLA 5FQRA 1I7GA 3RUUA 1T79A 1LBDA 5DZ3A 1S0ZA 4Q13A 1S0XA 1UHLB 3AUNA 5DIGA 5DVCA 3OMOA 4P6XA 5AAVA 2JFAA 4XTAA 1T7RA 3B65A 3GZ9A 1XVPB 1HJ1A 4PF3A 4Q50A 5DVVA 3VT3A 1OVLA 5KCTA 2ACLB 3HQ5A 3W0HA 4NB6A 3VJSA 2F4BA 2ZBSA 5DWGA 5DXMA 2O4JA 1ZDUA 2OVMA 4JAZA 3UU7A 1XZXX 1MVCA 1OSVA 4N73A 2Z4BA 2ZLCA 3OZJA 5DZHA 3DZYD 2VV4A 2HC4A 3VHWA 3BEJA 5E14A 2BAWA 1PQ9A 4WPFA 3UVVA 3HODA 5KCFA 3IXPD 3VN2A 1BSXA 3MNOA 5JI0D 5EJVA 3O1EA 2XYXA 4OEAA 5FQPA 3KWYA 5E15A 5DZIA 3KPZA 4DOSA 4MG5A 5E0XA 4ZNVA 1EXAA 2Q6JA 3V49A 3W0AA 5KCCA 2R6YA 5L11A 2NPAA 3ILZA 4ONIA 2GPOA 1FM9A 3AFRA 5DY8A 3HC5A 4S15A 2GP7A 3WFGA 4UDBA 2OVHA 2AX7A 5EC9A 1YOWA 3V9TA 4ZNUA 1FD0A 2I4PA 3IA6A 5DK9A 5G45A 4OZTE 4MGDA 3WJ4A 5G46A 3DR1A 2OM9A 5DRMA 1R1KD 5DLRA 1ZUCA 3OMMA 2P1TA 2AMAA 5DL4A 5SYZA 1T65A 2YLQA 2ZXMA 3OS8C 2G0HA 4OFRA 3B5RA 3HZFA 5L7EA 4JYIA 5AZTA 3L3ZA 4MGCA 2GPUA 5DXBB 4YMQA 3WJ5A 4O8FA 4TV1A 4OIVA 4OKXA 2QMVA 4ZO1X 4JGVA 3IMYA 4PXMA 1XP6A 3PCUA 3OS9A 3GWSX 4IUIA 2PIPL 4MGBB 5KRHA 4J5WA 2AA7A 5C4UA 2PIXA 1G5YA 1XLSA 3LMPA 3PRGA 2Q3YA 2J14A 5KCUA 5KRFA 3PEQA 5IAWA 4ZJWA 2B1ZA 2ZY0A 5DXKA 3MNPA 1NUOA 3ZR7A 1NAXA 1ZH7A 3AZ3A 1ZKYA 5DKEA 2HBHA 5DRJA 4HEEX 2YHDA 2PIVA 2QZOB 3A9EB 4N5GA 5AAUA 3DZYA 4LNWA 3FC6B 3TX7B 2HB7A 1S9QA 5AYGA 2IOKA 3AZ1A 1TFCA 3P89A 3IXPA 4PRGA 5DZ0A 1XLSE 4Y29A 5M96A 1YOKA 2G44A 1GWQA 1I38A 4OFUA 4QE8A 1KNUA 2AX9A 4MG8A 1FBYA 2QNVA 2BJ4A 3UP3A 5DWIA 3W5TA 4G1ZA 1UOMA 2ZFXA 3AZ2A 4ITFA 4RUJA 3UUCA 3ZRBA 3WTQA 3WMHA 3HVLA 1FM6D 4ITEA 3OGTA 1G50A 1XV9A 4DMAA 1L2JA 1A52A 2VSRA 2YATA 2Q59A 2ZMHA 1XDKA 3HO0A 4J5XA 4N1YA 5AZVA 4ZN9A 2ZK6A 3D6DA 5G3JA 4RMEA 2J7YA 1PK5A 4OH5A 5GIEA 1XJ7A 3SZ1A 3L3XA 5DXQA 1EXXA 3UUAA 2XKWA 3AURA 3VTBA 1R1KA 3VRWA 3RY9A 4DQMA 4MG7A 2I0GA 2V0VA 3CTBA 4ZI1A 5CJ6A 1M13A 4RUPA 4OILA 2A3IA 2QW4A 2ZK0A 4JYHA 3W0GA 4L98A 1GWXA 4UDDA 3ET1A 2Q5PA 2PKLA 5L7GA 3HC6A 4OEDA 5GT4A 1M2ZA 3V9VA 1XP9A 1PDUA 4YPQA 3OKIA 3WFFA 4CSJA 2QXSA 4XLDA 2Q5GA 3OSWA 2AX8A 2NXXE 3GYTA 4FNEA 3W5QA 2HB8A 3OAPA 1OT7A 5G5WA 2ZNOA 4OLMA 5DMFA 3VJTA 1GS4A 1NQ0A 3ADXA 3GN8A 5A86A 3VSPA 1UHLA 4WQPA 4CI4A 5KRKA 1X7BA 3DZUD 5E1CA 2P7ZA 1RDTD 2VV0A 2OUZA 3FEIA 3B1MA 1XOWA 3FS1A 4Q0AC 1WM0X 1K4WA 1X76A 2AX6A 3F7DA 2I4ZA 1XVPA 3D5FA 3K22A 4G1YA 1H9UA 4QJRA 2ACLA 4RMDA 3RLLA 3X36A 4S0SA 4F9MA 1IE8A 3ZQTA 5DWJA 3ET0A 5JJMB 3ADTA 1SJ0A 4POJA 2O9IA 1R20D 1YY4A 2YLOA 1T73A 4NUFA 1NDEA 3VJIA 1IE9A 1XPCA 5DIEA 5DI7A 3R29A 3HM1A 5F9BA 3B0QA 5ACCA 1NAVA 5JY3A 1ZDTA 1YUCA 2JJ3A 5KRLA 2R40D 1I7IA 5KR9A 2VV2A 1UPWA 3V4AA 3NSPA 2ZKCA 2FSZA 3B3KA 1RKHA 2Q8SA 4JYGA
chains in the Genus database with same CATH topology
2Q6RA 1U9EA 3ADSA 3L03A 3DCUA 1FM6A 5G44A 1X78A 3F5CB 1N46A 1SR7A 2ABIA 4FGYA 4OZRU 2ZASA 4RAKA 4DORA 2Q1VA 4MDDA 4WHFA 2POBA 2B50A 1R6GA 3OMKA 4J26A 4HLWA 4NY9A 5DMCA 1QKTA 2P15A 2VSTA 1X7RA 5DZ1A 5KD9A 1X7JA 1NQ2A 3D90A 1T76A 4RUOX 3TKMA 3BQDA 1RK3A 4FHHA 5APKA 1P93A 4G2HA 3V3QA 4BCRA 2ZNPA 4PP6A 3MNEA 1Y0SA 1MV9A 4PP5A 1T7MA 1N4HA 4OKWA 3RUTA 5C4TA 5FQVA 4MG9B 4XAOA 5DXBA 1XB7A 2O4RA 3CS8A 4ZNWA 5HYKA 1ILGA 5EGVA 4ZNTA 2H79A 2AM9A 3DZUA 3D24A 4DM6A 2XYJA 1RDTA 4X1GA 3ET3A 5HJPB 1ZAFA 1ERRA 3VTCA 2P1UA 4E4KA 4MGBA 5E7VA 4J5WC 3OOKA 3GD2A 3X1IA 4L96A 2OCFA 4MGAB 3K8SA 4XT9A 2GPVA 4ZN7A 2Z4JA 3G9EA 1R20A 1ZEOA 2HAMA 3OLFA 1YYEA 3IPUA 2AB2A 1KV6A 3FXVA 4P6WA 1K74D 2QZOA 3A2JA 3A9EA 4K6IA 3OZ0A 4R2UA 4ZNHA 5ETHA 5IZ0A 5DSHA 1PRGA 3FC6A 5DVSA 3VSOA 4IA1A 3K23A 4M8EA 1NHZA 4PPPA 5AWKA 2R40A 4DM8A 4IWFA 4RWVA 2OZ7A 1X7EA 4FHIA 2ZK4A 3A2IA 4EMAA 2VV1B 5AK2A 4QE6A 4OKTA 4LBDA 4OK1A 3R8AA 3CJWA 1TXIA 4OZRE 3OLLA 1QKMA 4QK4A 1T5ZA 4E2JA 3R5MA 3FALB 4K7AA 1E3KA 4MG6A 5KRJA 2POGA 5DIDA 5KCWA 3VT9A 3HLVA 4IW8A 3W0JA 3UP0A 1U3RA 3L0EA 1EREA 3R8DA 4J5XC 3R2AA 5HCVA 2PIUA 3ZRAA 5KYAA 2NXXA 1ILHA 3VI8A 2QSEA 3Q95B 4OJBA 3P8XA 4B7WA 1XNNA 2QA8B 4WVDA 3DY6A 2QXMA 3H52A 4REFA 3TY0A 2I0JA 1T63A 2P4YA 4PPSA 4R06A 1S9PA 3KMRA 4NIEA 4WHGA 2I4JA 3K6PA 3OMQA 4WLBA 3VT7A 1E3GA 2YJAB 4OJ4A 1XQCA 3WT6A 4LTWA 1G1UA 3VTDA 3A40X 5GIDA 1YIMA 1RKGA 2GTKA 2HVCA 4KZJA 2PNUA 4E4QA 1R5KA 1Y9RA 5DYDA 3CWDA 2ZNNA 4RZFA 1N83A 4DK8A 5DX3B 4OKBA 3FURA 4S0TA 4ZO1B 4TUZB 3VT5A 2AMBA 1PQCA 5H1EA 2G5OA 2ZK2A 2AXAA 4OARA 3P0UA 4KZIA 3LBDA 4PLEA 5DUEA 1GWRA 4LNXA 5HYRA 3CS4A 2ZLAA 1XQ3A 3ERTA 1DKFB 1HG4A 3IPQA 1DB1A 4G21A 5APHA 2VV3A 5DXPA 2GL8A 5DV8A 2AA2A 4A4WA 3E00D 5EI1A 4IS8A 5K13A 2Q1HA 2IHQA 2AAXA 2IOGA 3A3ZX 2QPYA 4FN9A 1XIUA 2ATHA 3UUDB 3RVFA 3L0JA 5I4VA 4XUHA 5DKGA 5EITA 1K74A 2J4AA 2YLPA 3VJHA 4IA2A 2Q7IA 4NQAB 1FCXA 1QKNA 5JJMA 1UPVA 4OIUA 2FAIA 2NV7A 2P7GA 4OHAA 3IPSA 3WGPA 5G43A 4A2JA 3W0YA 2YFEA 5B5BA 1RJKA 5IXKA 4IV4A 4R6SA 5KYJA 2XYWA 3ERDA 2HCDA 2Q7KA 2QA6A 4IA7A 3SP9A 2JF9A 2E2RA 5AAVB 2JFAB 2PIOA 1PQ6A 1K7LA 2QGWA 5C4SA 3B0RA 4IVWA 4REEA 1OVLB 3AUQA 3OSAA 3G8IA 4XHDA 5DKBA 2R6WA 1S19A 5AVLA 5AWJA 3WT5A 1A28A 3KFCA 2ZVTA 3EYBA 2P1VA 4XUMA 3TKCA 3V3EA 3WT7A 3P88A 4IU7A 4OEZA 3VRUA 1I37A 2PIQA 3CDSA 3CDPA 3UU7B 3V9YA 5E0WA 5DTVA 3R8IA 3F5CA 4PVUA 3U9QA 2VV4B 3QT0A 1YA3A 1Z95A 5HZCA 4UDAA 1YINA 3VT8A 4OJ9A 3ET2A 4YNKA 2J7XA 4APUA 3UVVB 1PZLA 3A2HA 1YP0A 3AX8A 2FVJA 3W5PA 1NQ1A 3GYUA 1U3SA 5DUGA 3VHUA 2PITA 4QM0A 3H0AD 1XAPA 5DV6A 1Z5XU 4CI5A 4G2IA 3ADVA 3KYTA 1QKUA 2ZK3A 1Q4XA 4RE8A 2AO6A 1T74A 2PJLA 2PIRA 2Q70A 5DXRA 3PLZA 5LGAA 2QTUA 4MG9A 2REWA 2AA5A 3W5RA 1NYXA 3JZBA 4OC7A 2ZXNA 3L0LA 1NRLA 2XHSA 2YJDA 4OEYA 2GPPA 1YMTA 1T7TA 2EWPA 4RZEA 2HWQA 3E00A 5HJPA 5DXEA 2GIUA 5DWEA 5C4OA 2PRGA 5FQTA 2QR9A 4DK7A 2HARA 1G2NA 1NQ7A 4MGDB 2B23A 2PINA 2PIWA 5L7HA 1M7WA 4MGAA 2AWHA 4IQRA 3GWXA 1T7FA 3OS8A 4IV2A 3W0IA 3JZCA 2V7CA 1OSHA 2H77A 3CLDA 3AN4A 3KDTA 3L1BA 5KRAA 3SP6A 2HWRA 4TV1B 2AYRA 5DP0A 2G0GA 3OLSA 3E94A 4J24A 4M8HA 4OGHA 3T03A 1VJBA 3X1HA 3ADWA 4X1FA 5GICA 2P7AA 5KRCA 4KZMA 4OH6A 3BC5A 2W8YA 5DV3A 3RLJA 5KROA 3PO9A 3D57A 1L2IA 3OMPA 4N8RA 5E19A 4QL8A 1P8DA 3B68A 2QE4A 2Q5SA 2VV1A 5HJSA 3B66A 4PLDA 3B0TA 5ICKA 3VRTA 2Q7LA 3KMGA 5KCEA 5DYBA 2QABA 3FEJA 3O1DA 3FALA 1XNXA 3NSQA 1YJEA 1ZGYA 4XI3A 5DXGA 3B0WA 4YT1A 1SKXA 2ZL9A 2LBDA 4G20A 4IWCA 4RMCA 5KRMA 3NOAA 3Q95A 4IA3A 5DUHA 2QA8A 2P54A 5DKSA 3H0AA 4MG8B 5G42A 2BJ4B 1Z5XE 2Q60A 3KBAA 2Q6SA 4RFWA 2AA6A 4K4JA 3KDUA 1LV2A 3B67A 4UDCA 4ZOMA 3G8OA 5KCDA 4LSJA 3S9SA 1FCZA 4POHA 2ZMJA 1XV9B 2ZK5A 3A78A 5DU5A 3X31A 4A4VA 3W0CA 2Q59B 2ZMIA 1XDKB 3VRVA 5DX3A 3DT3A 3N00A 2HFPA 4IW6A 3VHVA 5B41A 2GWXA 3VT4A 1SQNA 1MZNA 2OAXA 2QH6A 3KMZA 1FM9D 4TUZA 1KKQA 1XP1A 3R5NA 3M7RA 3PBAA 3UUAB 5AVIA 5EHJA 1Y0XX 3G0WA 3CS6A 4ZNSA 3E7CA 1DKFA 4IVYA 4G1DA 1FCYA 4MG7B 2HASA 2B1VA 3OSIA 3CQVA 2ZNQA 1U3QA 4ZJRA 4EM9A 5FQSA 5KRIA 4S14A 2ZXZA 2ZK1A 3FUGA 3GBKA 4OZTU 3UUDA 3DCTA 5DWLA 3OOFA 3VT6A 3FLIA 3WWRA 2Q61A 4RZGA 2Q7JA 5LWPA 3AN3A 4PP3A 2QGTA 5APJA 1PCGA 2YLYA 3ADUA 4JL4A 3OKHA 2NW4A 4PWLA 5FQRA 1I7GA 3RUUA 1T79A 1LBDA 5DZ3A 1S0ZA 4Q13A 1S0XA 1UHLB 3AUNA 5DIGA 5DVCA 3OMOA 4P6XA 5AAVA 2JFAA 4XTAA 1T7RA 3B65A 3GZ9A 1XVPB 1HJ1A 4PF3A 4Q50A 5DVVA 3VT3A 1OVLA 5KCTA 2ACLB 3HQ5A 3W0HA 4NB6A 3VJSA 2F4BA 2ZBSA 5DWGA 5DXMA 2O4JA 1ZDUA 2OVMA 4JAZA 3UU7A 1XZXX 1MVCA 1OSVA 4N73A 2Z4BA 2ZLCA 3OZJA 5DZHA 3DZYD 2VV4A 2HC4A 3VHWA 3BEJA 5E14A 2BAWA 1PQ9A 4WPFA 3UVVA 3HODA 5KCFA 3IXPD 3VN2A 1BSXA 3MNOA 5JI0D 5EJVA 3O1EA 2XYXA 4OEAA 5FQPA 3KWYA 5E15A 5DZIA 3KPZA 4DOSA 4MG5A 5E0XA 4ZNVA 1EXAA 2Q6JA 3V49A 3W0AA 5KCCA 2R6YA 5L11A 2NPAA 3ILZA 4ONIA 2GPOA 1FM9A 3AFRA 5DY8A 3HC5A 4S15A 2GP7A 3WFGA 4UDBA 2OVHA 2AX7A 5EC9A 1YOWA 3V9TA 4ZNUA 1FD0A 2I4PA 3IA6A 5DK9A 5G45A 4OZTE 4MGDA 3WJ4A 5G46A 3DR1A 2OM9A 5DRMA 1R1KD 5DLRA 1ZUCA 3OMMA 2P1TA 2AMAA 5DL4A 5SYZA 1T65A 2YLQA 2ZXMA 3OS8C 2G0HA 4OFRA 3B5RA 3HZFA 5L7EA 4JYIA 5AZTA 3L3ZA 4MGCA 2GPUA 5DXBB 4YMQA 3WJ5A 4O8FA 4TV1A 4OIVA 4OKXA 2QMVA 4ZO1X 4JGVA 3IMYA 4PXMA 1XP6A 3PCUA 3OS9A 3GWSX 4IUIA 2PIPL 4MGBB 5KRHA 4J5WA 2AA7A 5C4UA 2PIXA 1G5YA 1XLSA 3LMPA 3PRGA 2Q3YA 2J14A 5KCUA 5KRFA 3PEQA 5IAWA 4ZJWA 2B1ZA 2ZY0A 5DXKA 3MNPA 1NUOA 3ZR7A 1NAXA 1ZH7A 3AZ3A 1ZKYA 5DKEA 2HBHA 5DRJA 4HEEX 2YHDA 2PIVA 2QZOB 3A9EB 4N5GA 5AAUA 3DZYA 4LNWA 3FC6B 3TX7B 2HB7A 1S9QA 5AYGA 2IOKA 3AZ1A 1TFCA 3P89A 3IXPA 4PRGA 5DZ0A 1XLSE 4Y29A 5M96A 1YOKA 2G44A 1GWQA 1I38A 4OFUA 4QE8A 1KNUA 2AX9A 4MG8A 1FBYA 2QNVA 2BJ4A 3UP3A 5DWIA 3W5TA 4G1ZA 1UOMA 2ZFXA 3AZ2A 4ITFA 4RUJA 3UUCA 3ZRBA 3WTQA 3WMHA 3HVLA 1FM6D 4ITEA 3OGTA 1G50A 1XV9A 4DMAA 1L2JA 1A52A 2VSRA 2YATA 2Q59A 2ZMHA 1XDKA 3HO0A 4J5XA 4N1YA 5AZVA 4ZN9A 2ZK6A 3D6DA 5G3JA 4RMEA 2J7YA 1PK5A 4OH5A 5GIEA 1XJ7A 3SZ1A 3L3XA 5DXQA 1EXXA 3UUAA 2XKWA 3AURA 3VTBA 1R1KA 3VRWA 3RY9A 4DQMA 4MG7A 2I0GA 2V0VA 3CTBA 4ZI1A 5CJ6A 1M13A 4RUPA 4OILA 2A3IA 2QW4A 2ZK0A 4JYHA 3W0GA 4L98A 1GWXA 4UDDA 3ET1A 2Q5PA 2PKLA 5L7GA 3HC6A 4OEDA 5GT4A 1M2ZA 3V9VA 1XP9A 1PDUA 4YPQA 3OKIA 3WFFA 4CSJA 2QXSA 4XLDA 2Q5GA 3OSWA 2AX8A 2NXXE 3GYTA 4FNEA 3W5QA 2HB8A 3OAPA 1OT7A 5G5WA 2ZNOA 4OLMA 5DMFA 3VJTA 1GS4A 1NQ0A 3ADXA 3GN8A 5A86A 3VSPA 1UHLA 4WQPA 4CI4A 5KRKA 1X7BA 3DZUD 5E1CA 2P7ZA 1RDTD 2VV0A 2OUZA 3FEIA 3B1MA 1XOWA 3FS1A 4Q0AC 1WM0X 1K4WA 1X76A 2AX6A 3F7DA 2I4ZA 1XVPA 3D5FA 3K22A 4G1YA 1H9UA 4QJRA 2ACLA 4RMDA 3RLLA 3X36A 4S0SA 4F9MA 1IE8A 3ZQTA 5DWJA 3ET0A 5JJMB 3ADTA 1SJ0A 4POJA 2O9IA 1R20D 1YY4A 2YLOA 1T73A 4NUFA 1NDEA 3VJIA 1IE9A 1XPCA 5DIEA 5DI7A 3R29A 3HM1A 5F9BA 3B0QA 5ACCA 1NAVA 5JY3A 1ZDTA 1YUCA 2JJ3A 5KRLA 2R40D 1I7IA 5KR9A 2VV2A 1UPWA 3V4AA 3NSPA 2ZKCA 2FSZA 3B3KA 1RKHA 2Q8SA 4JYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q6R A;  1U9E A;  3ADS A;  3L03 A;  3DCU A;  1FM6 A;  5G44 A;  1X78 A;  3F5C B;  1N46 A;  1SR7 A;  2ABI A;  4FGY A;  4OZR U;  2ZAS A;  4RAK A;  4DOR A;  2Q1V A;  4MDD A;  4WHF A;  2POB A;  2B50 A;  1R6G A;  3OMK A;  4J26 A;  4HLW A;  4NY9 A;  5DMC A;  1QKT A;  2P15 A;  2VST A;  1X7R A;  5DZ1 A;  5KD9 A;  1X7J A;  1NQ2 A;  3D90 A;  1T76 A;  4RUO X;  3TKM A;  3BQD A;  1RK3 A;  4FHH A;  5APK A;  1P93 A;  4G2H A;  3V3Q A;  4BCR A;  2ZNP A;  4PP6 A;  3MNE A;  1Y0S A;  1MV9 A;  4PP5 A;  1T7M A;  1N4H A;  4OKW A;  3RUT A;  5C4T A;  5FQV A;  4MG9 B;  4XAO A;  5DXB A;  1XB7 A;  2O4R A;  3CS8 A;  4ZNW A;  5HYK A;  1ILG A;  5EGV A;  4ZNT A;  2H79 A;  2AM9 A;  3DZU A;  3D24 A;  4DM6 A;  2XYJ A;  1RDT A;  4X1G A;  3ET3 A;  5HJP B;  1ZAF A;  1ERR A;  3VTC A;  2P1U A;  4E4K A;  4MGB A;  5E7V A;  4J5W C;  3OOK A;  3GD2 A;  3X1I A;  4L96 A;  2OCF A;  4MGA B;  3K8S A;  4XT9 A;  2GPV A;  4ZN7 A;  2Z4J A;  3G9E A;  1R20 A;  1ZEO A;  2HAM A;  3OLF A;  1YYE A;  3IPU A;  2AB2 A;  1KV6 A;  3FXV A;  4P6W A;  1K74 D;  2QZO A;  3A2J A;  3A9E A;  4K6I A;  3OZ0 A;  4R2U A;  4ZNH A;  5ETH A;  5IZ0 A;  5DSH A;  1PRG A;  3FC6 A;  5DVS A;  3VSO A;  4IA1 A;  3K23 A;  4M8E A;  1NHZ A;  4PPP A;  5AWK A;  2R40 A;  4DM8 A;  4IWF A;  4RWV A;  2OZ7 A;  1X7E A;  4FHI A;  2ZK4 A;  3A2I A;  4EMA A;  2VV1 B;  5AK2 A;  4QE6 A;  4OKT A;  4LBD A;  4OK1 A;  3R8A A;  3CJW A;  1TXI A;  4OZR E;  3OLL A;  1QKM A;  4QK4 A;  1T5Z A;  4E2J A;  3R5M A;  3FAL B;  4K7A A;  1E3K A;  4MG6 A;  5KRJ A;  2POG A;  5DID A;  5KCW A;  3VT9 A;  3HLV A;  4IW8 A;  3W0J A;  3UP0 A;  1U3R A;  3L0E A;  1ERE A;  3R8D A;  4J5X C;  3R2A A;  5HCV A;  2PIU A;  3ZRA A;  5KYA A;  2NXX A;  1ILH A;  3VI8 A;  2QSE A;  3Q95 B;  4OJB A;  3P8X A;  4B7W A;  1XNN A;  2QA8 B;  4WVD A;  3DY6 A;  2QXM A;  3H52 A;  4REF A;  3TY0 A;  2I0J A;  1T63 A;  2P4Y A;  4PPS A;  4R06 A;  1S9P A;  3KMR A;  4NIE A;  4WHG A;  2I4J A;  3K6P A;  3OMQ A;  4WLB A;  3VT7 A;  1E3G A;  2YJA B;  4OJ4 A;  1XQC A;  3WT6 A;  4LTW A;  1G1U A;  3VTD A;  3A40 X;  5GID A;  1YIM A;  1RKG A;  2GTK A;  2HVC A;  4KZJ A;  2PNU A;  4E4Q A;  1R5K A;  1Y9R A;  5DYD A;  3CWD A;  2ZNN A;  4RZF A;  1N83 A;  4DK8 A;  5DX3 B;  4OKB A;  3FUR A;  4S0T A;  4ZO1 B;  4TUZ B;  3VT5 A;  2AMB A;  1PQC A;  5H1E A;  2G5O A;  2ZK2 A;  2AXA A;  4OAR A;  3P0U A;  4KZI A;  3LBD A;  4PLE A;  5DUE A;  1GWR A;  4LNX A;  5HYR A;  3CS4 A;  2ZLA A;  1XQ3 A;  3ERT A;  1DKF B;  1HG4 A;  3IPQ A;  1DB1 A;  4G21 A;  5APH A;  2VV3 A;  5DXP A;  2GL8 A;  5DV8 A;  2AA2 A;  4A4W A;  3E00 D;  5EI1 A;  4IS8 A;  5K13 A;  2Q1H A;  2IHQ A;  2AAX A;  2IOG A;  3A3Z X;  2QPY A;  4FN9 A;  1XIU A;  2ATH A;  3UUD B;  3RVF A;  3L0J A;  5I4V A;  4XUH A;  5DKG A;  5EIT A;  1K74 A;  2J4A A;  2YLP A;  3VJH A;  4IA2 A;  2Q7I A;  4NQA B;  1FCX A;  1QKN A;  5JJM A;  1UPV A;  4OIU A;  2FAI A;  2NV7 A;  2P7G A;  4OHA A;  3IPS A;  3WGP A;  5G43 A;  4A2J A;  3W0Y A;  2YFE A;  5B5B A;  1RJK A;  5IXK A;  4IV4 A;  4R6S A;  5KYJ A;  2XYW A;  3ERD A;  2HCD A;  2Q7K A;  2QA6 A;  4IA7 A;  3SP9 A;  2JF9 A;  2E2R A;  5AAV B;  2JFA B;  2PIO A;  1PQ6 A;  1K7L A;  2QGW A;  5C4S A;  3B0R A;  4IVW A;  4REE A;  1OVL B;  3AUQ A;  3OSA A;  3G8I A;  4XHD A;  5DKB A;  2R6W A;  1S19 A;  5AVL A;  5AWJ A;  3WT5 A;  1A28 A;  3KFC A;  2ZVT A;  3EYB A;  2P1V A;  4XUM A;  3TKC A;  3V3E A;  3WT7 A;  3P88 A;  4IU7 A;  4OEZ A;  3VRU A;  1I37 A;  2PIQ A;  3CDS A;  3CDP A;  3UU7 B;  3V9Y A;  5E0W A;  5DTV A;  3R8I A;  3F5C A;  4PVU A;  3U9Q A;  2VV4 B;  3QT0 A;  1YA3 A;  1Z95 A;  5HZC A;  4UDA A;  1YIN A;  3VT8 A;  4OJ9 A;  3ET2 A;  4YNK A;  2J7X A;  4APU A;  3UVV B;  1PZL A;  3A2H A;  1YP0 A;  3AX8 A;  2FVJ A;  3W5P A;  1NQ1 A;  3GYU A;  1U3S A;  5DUG A;  3VHU A;  2PIT A;  4QM0 A;  3H0A D;  1XAP A;  5DV6 A;  1Z5X U;  4CI5 A;  4G2I A;  3ADV A;  3KYT A;  1QKU A;  2ZK3 A;  1Q4X A;  4RE8 A;  2AO6 A;  1T74 A;  2PJL A;  2PIR A;  2Q70 A;  5DXR A;  3PLZ A;  5LGA A;  2QTU A;  4MG9 A;  2REW A;  2AA5 A;  3W5R A;  1NYX A;  3JZB A;  4OC7 A;  2ZXN A;  3L0L A;  1NRL A;  2XHS A;  2YJD A;  4OEY A;  2GPP A;  1YMT A;  1T7T A;  2EWP A;  4RZE A;  2HWQ A;  3E00 A;  5HJP A;  5DXE A;  2GIU A;  5DWE A;  5C4O A;  2PRG A;  5FQT A;  2QR9 A;  4DK7 A;  2HAR A;  1G2N A;  1NQ7 A;  4MGD B;  2B23 A;  2PIN A;  2PIW A;  5L7H A;  1M7W A;  4MGA A;  2AWH A;  4IQR A;  3GWX A;  1T7F A;  3OS8 A;  4IV2 A;  3W0I A;  3JZC A;  2V7C A;  1OSH A;  2H77 A;  3CLD A;  3AN4 A;  3KDT A;  3L1B A;  5KRA A;  3SP6 A;  2HWR A;  4TV1 B;  2AYR A;  5DP0 A;  2G0G A;  3OLS A;  3E94 A;  4J24 A;  4M8H A;  4OGH A;  3T03 A;  1VJB A;  3X1H A;  3ADW A;  4X1F A;  5GIC A;  2P7A A;  5KRC A;  4KZM A;  4OH6 A;  3BC5 A;  2W8Y A;  5DV3 A;  3RLJ A;  5KRO A;  3PO9 A;  3D57 A;  1L2I A;  3OMP A;  4N8R A;  5E19 A;  4QL8 A;  1P8D A;  3B68 A;  2QE4 A;  2Q5S A;  2VV1 A;  5HJS A;  3B66 A;  4PLD A;  3B0T A;  5ICK A;  3VRT A;  2Q7L A;  3KMG A;  5KCE A;  5DYB A;  2QAB A;  3FEJ A;  3O1D A;  3FAL A;  1XNX A;  3NSQ A;  1YJE A;  1ZGY A;  4XI3 A;  5DXG A;  3B0W A;  4YT1 A;  1SKX A;  2ZL9 A;  2LBD A;  4G20 A;  4IWC A;  4RMC A;  5KRM A;  3NOA A;  3Q95 A;  4IA3 A;  5DUH A;  2QA8 A;  2P54 A;  5DKS A;  3H0A A;  4MG8 B;  5G42 A;  2BJ4 B;  1Z5X E;  2Q60 A;  3KBA A;  2Q6S A;  4RFW A;  2AA6 A;  4K4J A;  3KDU A;  1LV2 A;  3B67 A;  4UDC A;  4ZOM A;  3G8O A;  5KCD A;  4LSJ A;  3S9S A;  1FCZ A;  4POH A;  2ZMJ A;  1XV9 B;  2ZK5 A;  3A78 A;  5DU5 A;  3X31 A;  4A4V A;  3W0C A;  2Q59 B;  2ZMI A;  1XDK B;  3VRV A;  5DX3 A;  3DT3 A;  3N00 A;  2HFP A;  4IW6 A;  3VHV A;  5B41 A;  2GWX A;  3VT4 A;  1SQN A;  1MZN A;  2OAX A;  2QH6 A;  3KMZ A;  1FM9 D;  4TUZ A;  1KKQ A;  1XP1 A;  3R5N A;  3M7R A;  3PBA A;  3UUA B;  5AVI A;  5EHJ A;  1Y0X X;  3G0W A;  3CS6 A;  4ZNS A;  3E7C A;  1DKF A;  4IVY A;  4G1D A;  1FCY A;  4MG7 B;  2HAS A;  2B1V A;  3OSI A;  3CQV A;  2ZNQ A;  1U3Q A;  4ZJR A;  4EM9 A;  5FQS A;  5KRI A;  4S14 A;  2ZXZ A;  2ZK1 A;  3FUG A;  3GBK A;  4OZT U;  3UUD A;  3DCT A;  5DWL A;  3OOF A;  3VT6 A;  3FLI A;  3WWR A;  2Q61 A;  4RZG A;  2Q7J A;  5LWP A;  3AN3 A;  4PP3 A;  2QGT A;  5APJ A;  1PCG A;  2YLY A;  3ADU A;  4JL4 A;  3OKH A;  2NW4 A;  4PWL A;  5FQR A;  1I7G A;  3RUU A;  1T79 A;  1LBD A;  5DZ3 A;  1S0Z A;  4Q13 A;  1S0X A;  1UHL B;  3AUN A;  5DIG A;  5DVC A;  3OMO A;  4P6X A;  5AAV A;  2JFA A;  4XTA A;  1T7R A;  3B65 A;  3GZ9 A;  1XVP B;  1HJ1 A;  4PF3 A;  4Q50 A;  5DVV A;  3VT3 A;  1OVL A;  5KCT A;  2ACL B;  3HQ5 A;  3W0H A;  4NB6 A;  3VJS A;  2F4B A;  2ZBS A;  5DWG A;  5DXM A;  2O4J A;  1ZDU A;  2OVM A;  4JAZ A;  3UU7 A;  1XZX X;  1MVC A;  1OSV A;  4N73 A;  2Z4B A;  2ZLC A;  3OZJ A;  5DZH A;  3DZY D;  2VV4 A;  2HC4 A;  3VHW A;  3BEJ A;  5E14 A;  2BAW A;  1PQ9 A;  4WPF A;  3UVV A;  3HOD A;  5KCF A;  3IXP D;  3VN2 A;  1BSX A;  3MNO A;  5JI0 D;  5EJV A;  3O1E A;  2XYX A;  4OEA A;  5FQP A;  3KWY A;  5E15 A;  5DZI A;  3KPZ A;  4DOS A;  4MG5 A;  5E0X A;  4ZNV A;  1EXA A;  2Q6J A;  3V49 A;  3W0A A;  5KCC A;  2R6Y A;  5L11 A;  2NPA A;  3ILZ A;  4ONI A;  2GPO A;  1FM9 A;  3AFR A;  5DY8 A;  3HC5 A;  4S15 A;  2GP7 A;  3WFG A;  4UDB A;  2OVH A;  2AX7 A;  5EC9 A;  1YOW A;  3V9T A;  4ZNU A;  1FD0 A;  2I4P A;  3IA6 A;  5DK9 A;  5G45 A;  4OZT E;  4MGD A;  3WJ4 A;  5G46 A;  3DR1 A;  2OM9 A;  5DRM A;  1R1K D;  5DLR A;  1ZUC A;  3OMM A;  2P1T A;  2AMA A;  5DL4 A;  5SYZ A;  1T65 A;  2YLQ A;  2ZXM A;  3OS8 C;  2G0H A;  4OFR A;  3B5R A;  3HZF A;  5L7E A;  4JYI A;  5AZT A;  3L3Z A;  4MGC A;  2GPU A;  5DXB B;  4YMQ A;  3WJ5 A;  4O8F A;  4TV1 A;  4OIV A;  4OKX A;  2QMV A;  4ZO1 X;  4JGV A;  3IMY A;  4PXM A;  1XP6 A;  3PCU A;  3OS9 A;  3GWS X;  4IUI A;  2PIP L;  4MGB B;  5KRH A;  4J5W A;  2AA7 A;  5C4U A;  2PIX A;  1G5Y A;  1XLS A;  3LMP A;  3PRG A;  2Q3Y A;  2J14 A;  5KCU A;  5KRF A;  3PEQ A;  5IAW A;  4ZJW A;  2B1Z A;  2ZY0 A;  5DXK A;  3MNP A;  1NUO A;  3ZR7 A;  1NAX A;  1ZH7 A;  3AZ3 A;  1ZKY A;  5DKE A;  2HBH A;  5DRJ A;  4HEE X;  2YHD A;  2PIV A;  2QZO B;  3A9E B;  4N5G A;  5AAU A;  3DZY A;  4LNW A;  3FC6 B;  3TX7 B;  2HB7 A;  1S9Q A;  5AYG A;  2IOK A;  3AZ1 A;  1TFC A;  3P89 A;  3IXP A;  4PRG A;  5DZ0 A;  1XLS E;  4Y29 A;  5M96 A;  1YOK A;  2G44 A;  1GWQ A;  1I38 A;  4OFU A;  4QE8 A;  1KNU A;  2AX9 A;  4MG8 A;  1FBY A;  2QNV A;  2BJ4 A;  3UP3 A;  5DWI A;  3W5T A;  4G1Z A;  1UOM A;  2ZFX A;  3AZ2 A;  4ITF A;  4RUJ A;  3UUC A;  3ZRB A;  3WTQ A;  3WMH A;  3HVL A;  1FM6 D;  4ITE A;  3OGT A;  1G50 A;  1XV9 A;  4DMA A;  1L2J A;  1A52 A;  2VSR A;  2YAT A;  2Q59 A;  2ZMH A;  1XDK A;  3HO0 A;  4J5X A;  4N1Y A;  5AZV A;  4ZN9 A;  2ZK6 A;  3D6D A;  5G3J A;  4RME A;  2J7Y A;  1PK5 A;  4OH5 A;  5GIE A;  1XJ7 A;  3SZ1 A;  3L3X A;  5DXQ A;  1EXX A;  3UUA A;  2XKW A;  3AUR A;  3VTB A;  1R1K A;  3VRW A;  3RY9 A;  4DQM A;  4MG7 A;  2I0G A;  2V0V A;  3CTB A;  4ZI1 A;  5CJ6 A;  1M13 A;  4RUP A;  4OIL A;  2A3I A;  2QW4 A;  2ZK0 A;  4JYH A;  3W0G A;  4L98 A;  1GWX A;  4UDD A;  3ET1 A;  2Q5P A;  2PKL A;  5L7G A;  3HC6 A;  4OED A;  5GT4 A;  1M2Z A;  3V9V A;  1XP9 A;  1PDU A;  4YPQ A;  3OKI A;  3WFF A;  4CSJ A;  2QXS A;  4XLD A;  2Q5G A;  3OSW A;  2AX8 A;  2NXX E;  3GYT A;  4FNE A;  3W5Q A;  2HB8 A;  3OAP A;  1OT7 A;  5G5W A;  2ZNO A;  4OLM A;  5DMF A;  3VJT A;  1GS4 A;  1NQ0 A;  3ADX A;  3GN8 A;  5A86 A;  3VSP A;  1UHL A;  4WQP A;  4CI4 A;  5KRK A;  1X7B A;  3DZU D;  5E1C A;  2P7Z A;  1RDT D;  2VV0 A;  2OUZ A;  3FEI A;  3B1M A;  1XOW A;  3FS1 A;  4Q0A C;  1WM0 X;  1K4W A;  1X76 A;  2AX6 A;  3F7D A;  2I4Z A;  1XVP A;  3D5F A;  3K22 A;  4G1Y A;  1H9U A;  4QJR A;  2ACL A;  4RMD A;  3RLL A;  3X36 A;  4S0S A;  4F9M A;  1IE8 A;  3ZQT A;  5DWJ A;  3ET0 A;  5JJM B;  3ADT A;  1SJ0 A;  4POJ A;  2O9I A;  1R20 D;  1YY4 A;  2YLO A;  1T73 A;  4NUF A;  1NDE A;  3VJI A;  1IE9 A;  1XPC A;  5DIE A;  5DI7 A;  3R29 A;  3HM1 A;  5F9B A;  3B0Q A;  5ACC A;  1NAV A;  5JY3 A;  1ZDT A;  1YUC A;  2JJ3 A;  5KRL A;  2R40 D;  1I7I A;  5KR9 A;  2VV2 A;  1UPW A;  3V4A A;  3NSP A;  2ZKC A;  2FSZ A;  3B3K A;  1RKH A;  2Q8S A;  4JYG A; 
#chains in the Genus database with same CATH topology
 2Q6R A;  1U9E A;  3ADS A;  3L03 A;  3DCU A;  1FM6 A;  5G44 A;  1X78 A;  3F5C B;  1N46 A;  1SR7 A;  2ABI A;  4FGY A;  4OZR U;  2ZAS A;  4RAK A;  4DOR A;  2Q1V A;  4MDD A;  4WHF A;  2POB A;  2B50 A;  1R6G A;  3OMK A;  4J26 A;  4HLW A;  4NY9 A;  5DMC A;  1QKT A;  2P15 A;  2VST A;  1X7R A;  5DZ1 A;  5KD9 A;  1X7J A;  1NQ2 A;  3D90 A;  1T76 A;  4RUO X;  3TKM A;  3BQD A;  1RK3 A;  4FHH A;  5APK A;  1P93 A;  4G2H A;  3V3Q A;  4BCR A;  2ZNP A;  4PP6 A;  3MNE A;  1Y0S A;  1MV9 A;  4PP5 A;  1T7M A;  1N4H A;  4OKW A;  3RUT A;  5C4T A;  5FQV A;  4MG9 B;  4XAO A;  5DXB A;  1XB7 A;  2O4R A;  3CS8 A;  4ZNW A;  5HYK A;  1ILG A;  5EGV A;  4ZNT A;  2H79 A;  2AM9 A;  3DZU A;  3D24 A;  4DM6 A;  2XYJ A;  1RDT A;  4X1G A;  3ET3 A;  5HJP B;  1ZAF A;  1ERR A;  3VTC A;  2P1U A;  4E4K A;  4MGB A;  5E7V A;  4J5W C;  3OOK A;  3GD2 A;  3X1I A;  4L96 A;  2OCF A;  4MGA B;  3K8S A;  4XT9 A;  2GPV A;  4ZN7 A;  2Z4J A;  3G9E A;  1R20 A;  1ZEO A;  2HAM A;  3OLF A;  1YYE A;  3IPU A;  2AB2 A;  1KV6 A;  3FXV A;  4P6W A;  1K74 D;  2QZO A;  3A2J A;  3A9E A;  4K6I A;  3OZ0 A;  4R2U A;  4ZNH A;  5ETH A;  5IZ0 A;  5DSH A;  1PRG A;  3FC6 A;  5DVS A;  3VSO A;  4IA1 A;  3K23 A;  4M8E A;  1NHZ A;  4PPP A;  5AWK A;  2R40 A;  4DM8 A;  4IWF A;  4RWV A;  2OZ7 A;  1X7E A;  4FHI A;  2ZK4 A;  3A2I A;  4EMA A;  2VV1 B;  5AK2 A;  4QE6 A;  4OKT A;  4LBD A;  4OK1 A;  3R8A A;  3CJW A;  1TXI A;  4OZR E;  3OLL A;  1QKM A;  4QK4 A;  1T5Z A;  4E2J A;  3R5M A;  3FAL B;  4K7A A;  1E3K A;  4MG6 A;  5KRJ A;  2POG A;  5DID A;  5KCW A;  3VT9 A;  3HLV A;  4IW8 A;  3W0J A;  3UP0 A;  1U3R A;  3L0E A;  1ERE A;  3R8D A;  4J5X C;  3R2A A;  5HCV A;  2PIU A;  3ZRA A;  5KYA A;  2NXX A;  1ILH A;  3VI8 A;  2QSE A;  3Q95 B;  4OJB A;  3P8X A;  4B7W A;  1XNN A;  2QA8 B;  4WVD A;  3DY6 A;  2QXM A;  3H52 A;  4REF A;  3TY0 A;  2I0J A;  1T63 A;  2P4Y A;  4PPS A;  4R06 A;  1S9P A;  3KMR A;  4NIE A;  4WHG A;  2I4J A;  3K6P A;  3OMQ A;  4WLB A;  3VT7 A;  1E3G A;  2YJA B;  4OJ4 A;  1XQC A;  3WT6 A;  4LTW A;  1G1U A;  3VTD A;  3A40 X;  5GID A;  1YIM A;  1RKG A;  2GTK A;  2HVC A;  4KZJ A;  2PNU A;  4E4Q A;  1R5K A;  1Y9R A;  5DYD A;  3CWD A;  2ZNN A;  4RZF A;  1N83 A;  4DK8 A;  5DX3 B;  4OKB A;  3FUR A;  4S0T A;  4ZO1 B;  4TUZ B;  3VT5 A;  2AMB A;  1PQC A;  5H1E A;  2G5O A;  2ZK2 A;  2AXA A;  4OAR A;  3P0U A;  4KZI A;  3LBD A;  4PLE A;  5DUE A;  1GWR A;  4LNX A;  5HYR A;  3CS4 A;  2ZLA A;  1XQ3 A;  3ERT A;  1DKF B;  1HG4 A;  3IPQ A;  1DB1 A;  4G21 A;  5APH A;  2VV3 A;  5DXP A;  2GL8 A;  5DV8 A;  2AA2 A;  4A4W A;  3E00 D;  5EI1 A;  4IS8 A;  5K13 A;  2Q1H A;  2IHQ A;  2AAX A;  2IOG A;  3A3Z X;  2QPY A;  4FN9 A;  1XIU A;  2ATH A;  3UUD B;  3RVF A;  3L0J A;  5I4V A;  4XUH A;  5DKG A;  5EIT A;  1K74 A;  2J4A A;  2YLP A;  3VJH A;  4IA2 A;  2Q7I A;  4NQA B;  1FCX A;  1QKN A;  5JJM A;  1UPV A;  4OIU A;  2FAI A;  2NV7 A;  2P7G A;  4OHA A;  3IPS A;  3WGP A;  5G43 A;  4A2J A;  3W0Y A;  2YFE A;  5B5B A;  1RJK A;  5IXK A;  4IV4 A;  4R6S A;  5KYJ A;  2XYW A;  3ERD A;  2HCD A;  2Q7K A;  2QA6 A;  4IA7 A;  3SP9 A;  2JF9 A;  2E2R A;  5AAV B;  2JFA B;  2PIO A;  1PQ6 A;  1K7L A;  2QGW A;  5C4S A;  3B0R A;  4IVW A;  4REE A;  1OVL B;  3AUQ A;  3OSA A;  3G8I A;  4XHD A;  5DKB A;  2R6W A;  1S19 A;  5AVL A;  5AWJ A;  3WT5 A;  1A28 A;  3KFC A;  2ZVT A;  3EYB A;  2P1V A;  4XUM A;  3TKC A;  3V3E A;  3WT7 A;  3P88 A;  4IU7 A;  4OEZ A;  3VRU A;  1I37 A;  2PIQ A;  3CDS A;  3CDP A;  3UU7 B;  3V9Y A;  5E0W A;  5DTV A;  3R8I A;  3F5C A;  4PVU A;  3U9Q A;  2VV4 B;  3QT0 A;  1YA3 A;  1Z95 A;  5HZC A;  4UDA A;  1YIN A;  3VT8 A;  4OJ9 A;  3ET2 A;  4YNK A;  2J7X A;  4APU A;  3UVV B;  1PZL A;  3A2H A;  1YP0 A;  3AX8 A;  2FVJ A;  3W5P A;  1NQ1 A;  3GYU A;  1U3S A;  5DUG A;  3VHU A;  2PIT A;  4QM0 A;  3H0A D;  1XAP A;  5DV6 A;  1Z5X U;  4CI5 A;  4G2I A;  3ADV A;  3KYT A;  1QKU A;  2ZK3 A;  1Q4X A;  4RE8 A;  2AO6 A;  1T74 A;  2PJL A;  2PIR A;  2Q70 A;  5DXR A;  3PLZ A;  5LGA A;  2QTU A;  4MG9 A;  2REW A;  2AA5 A;  3W5R A;  1NYX A;  3JZB A;  4OC7 A;  2ZXN A;  3L0L A;  1NRL A;  2XHS A;  2YJD A;  4OEY A;  2GPP A;  1YMT A;  1T7T A;  2EWP A;  4RZE A;  2HWQ A;  3E00 A;  5HJP A;  5DXE A;  2GIU A;  5DWE A;  5C4O A;  2PRG A;  5FQT A;  2QR9 A;  4DK7 A;  2HAR A;  1G2N A;  1NQ7 A;  4MGD B;  2B23 A;  2PIN A;  2PIW A;  5L7H A;  1M7W A;  4MGA A;  2AWH A;  4IQR A;  3GWX A;  1T7F A;  3OS8 A;  4IV2 A;  3W0I A;  3JZC A;  2V7C A;  1OSH A;  2H77 A;  3CLD A;  3AN4 A;  3KDT A;  3L1B A;  5KRA A;  3SP6 A;  2HWR A;  4TV1 B;  2AYR A;  5DP0 A;  2G0G A;  3OLS A;  3E94 A;  4J24 A;  4M8H A;  4OGH A;  3T03 A;  1VJB A;  3X1H A;  3ADW A;  4X1F A;  5GIC A;  2P7A A;  5KRC A;  4KZM A;  4OH6 A;  3BC5 A;  2W8Y A;  5DV3 A;  3RLJ A;  5KRO A;  3PO9 A;  3D57 A;  1L2I A;  3OMP A;  4N8R A;  5E19 A;  4QL8 A;  1P8D A;  3B68 A;  2QE4 A;  2Q5S A;  2VV1 A;  5HJS A;  3B66 A;  4PLD A;  3B0T A;  5ICK A;  3VRT A;  2Q7L A;  3KMG A;  5KCE A;  5DYB A;  2QAB A;  3FEJ A;  3O1D A;  3FAL A;  1XNX A;  3NSQ A;  1YJE A;  1ZGY A;  4XI3 A;  5DXG A;  3B0W A;  4YT1 A;  1SKX A;  2ZL9 A;  2LBD A;  4G20 A;  4IWC A;  4RMC A;  5KRM A;  3NOA A;  3Q95 A;  4IA3 A;  5DUH A;  2QA8 A;  2P54 A;  5DKS A;  3H0A A;  4MG8 B;  5G42 A;  2BJ4 B;  1Z5X E;  2Q60 A;  3KBA A;  2Q6S A;  4RFW A;  2AA6 A;  4K4J A;  3KDU A;  1LV2 A;  3B67 A;  4UDC A;  4ZOM A;  3G8O A;  5KCD A;  4LSJ A;  3S9S A;  1FCZ A;  4POH A;  2ZMJ A;  1XV9 B;  2ZK5 A;  3A78 A;  5DU5 A;  3X31 A;  4A4V A;  3W0C A;  2Q59 B;  2ZMI A;  1XDK B;  3VRV A;  5DX3 A;  3DT3 A;  3N00 A;  2HFP A;  4IW6 A;  3VHV A;  5B41 A;  2GWX A;  3VT4 A;  1SQN A;  1MZN A;  2OAX A;  2QH6 A;  3KMZ A;  1FM9 D;  4TUZ A;  1KKQ A;  1XP1 A;  3R5N A;  3M7R A;  3PBA A;  3UUA B;  5AVI A;  5EHJ A;  1Y0X X;  3G0W A;  3CS6 A;  4ZNS A;  3E7C A;  1DKF A;  4IVY A;  4G1D A;  1FCY A;  4MG7 B;  2HAS A;  2B1V A;  3OSI A;  3CQV A;  2ZNQ A;  1U3Q A;  4ZJR A;  4EM9 A;  5FQS A;  5KRI A;  4S14 A;  2ZXZ A;  2ZK1 A;  3FUG A;  3GBK A;  4OZT U;  3UUD A;  3DCT A;  5DWL A;  3OOF A;  3VT6 A;  3FLI A;  3WWR A;  2Q61 A;  4RZG A;  2Q7J A;  5LWP A;  3AN3 A;  4PP3 A;  2QGT A;  5APJ A;  1PCG A;  2YLY A;  3ADU A;  4JL4 A;  3OKH A;  2NW4 A;  4PWL A;  5FQR A;  1I7G A;  3RUU A;  1T79 A;  1LBD A;  5DZ3 A;  1S0Z A;  4Q13 A;  1S0X A;  1UHL B;  3AUN A;  5DIG A;  5DVC A;  3OMO A;  4P6X A;  5AAV A;  2JFA A;  4XTA A;  1T7R A;  3B65 A;  3GZ9 A;  1XVP B;  1HJ1 A;  4PF3 A;  4Q50 A;  5DVV A;  3VT3 A;  1OVL A;  5KCT A;  2ACL B;  3HQ5 A;  3W0H A;  4NB6 A;  3VJS A;  2F4B A;  2ZBS A;  5DWG A;  5DXM A;  2O4J A;  1ZDU A;  2OVM A;  4JAZ A;  3UU7 A;  1XZX X;  1MVC A;  1OSV A;  4N73 A;  2Z4B A;  2ZLC A;  3OZJ A;  5DZH A;  3DZY D;  2VV4 A;  2HC4 A;  3VHW A;  3BEJ A;  5E14 A;  2BAW A;  1PQ9 A;  4WPF A;  3UVV A;  3HOD A;  5KCF A;  3IXP D;  3VN2 A;  1BSX A;  3MNO A;  5JI0 D;  5EJV A;  3O1E A;  2XYX A;  4OEA A;  5FQP A;  3KWY A;  5E15 A;  5DZI A;  3KPZ A;  4DOS A;  4MG5 A;  5E0X A;  4ZNV A;  1EXA A;  2Q6J A;  3V49 A;  3W0A A;  5KCC A;  2R6Y A;  5L11 A;  2NPA A;  3ILZ A;  4ONI A;  2GPO A;  1FM9 A;  3AFR A;  5DY8 A;  3HC5 A;  4S15 A;  2GP7 A;  3WFG A;  4UDB A;  2OVH A;  2AX7 A;  5EC9 A;  1YOW A;  3V9T A;  4ZNU A;  1FD0 A;  2I4P A;  3IA6 A;  5DK9 A;  5G45 A;  4OZT E;  4MGD A;  3WJ4 A;  5G46 A;  3DR1 A;  2OM9 A;  5DRM A;  1R1K D;  5DLR A;  1ZUC A;  3OMM A;  2P1T A;  2AMA A;  5DL4 A;  5SYZ A;  1T65 A;  2YLQ A;  2ZXM A;  3OS8 C;  2G0H A;  4OFR A;  3B5R A;  3HZF A;  5L7E A;  4JYI A;  5AZT A;  3L3Z A;  4MGC A;  2GPU A;  5DXB B;  4YMQ A;  3WJ5 A;  4O8F A;  4TV1 A;  4OIV A;  4OKX A;  2QMV A;  4ZO1 X;  4JGV A;  3IMY A;  4PXM A;  1XP6 A;  3PCU A;  3OS9 A;  3GWS X;  4IUI A;  2PIP L;  4MGB B;  5KRH A;  4J5W A;  2AA7 A;  5C4U A;  2PIX A;  1G5Y A;  1XLS A;  3LMP A;  3PRG A;  2Q3Y A;  2J14 A;  5KCU A;  5KRF A;  3PEQ A;  5IAW A;  4ZJW A;  2B1Z A;  2ZY0 A;  5DXK A;  3MNP A;  1NUO A;  3ZR7 A;  1NAX A;  1ZH7 A;  3AZ3 A;  1ZKY A;  5DKE A;  2HBH A;  5DRJ A;  4HEE X;  2YHD A;  2PIV A;  2QZO B;  3A9E B;  4N5G A;  5AAU A;  3DZY A;  4LNW A;  3FC6 B;  3TX7 B;  2HB7 A;  1S9Q A;  5AYG A;  2IOK A;  3AZ1 A;  1TFC A;  3P89 A;  3IXP A;  4PRG A;  5DZ0 A;  1XLS E;  4Y29 A;  5M96 A;  1YOK A;  2G44 A;  1GWQ A;  1I38 A;  4OFU A;  4QE8 A;  1KNU A;  2AX9 A;  4MG8 A;  1FBY A;  2QNV A;  2BJ4 A;  3UP3 A;  5DWI A;  3W5T A;  4G1Z A;  1UOM A;  2ZFX A;  3AZ2 A;  4ITF A;  4RUJ A;  3UUC A;  3ZRB A;  3WTQ A;  3WMH A;  3HVL A;  1FM6 D;  4ITE A;  3OGT A;  1G50 A;  1XV9 A;  4DMA A;  1L2J A;  1A52 A;  2VSR A;  2YAT A;  2Q59 A;  2ZMH A;  1XDK A;  3HO0 A;  4J5X A;  4N1Y A;  5AZV A;  4ZN9 A;  2ZK6 A;  3D6D A;  5G3J A;  4RME A;  2J7Y A;  1PK5 A;  4OH5 A;  5GIE A;  1XJ7 A;  3SZ1 A;  3L3X A;  5DXQ A;  1EXX A;  3UUA A;  2XKW A;  3AUR A;  3VTB A;  1R1K A;  3VRW A;  3RY9 A;  4DQM A;  4MG7 A;  2I0G A;  2V0V A;  3CTB A;  4ZI1 A;  5CJ6 A;  1M13 A;  4RUP A;  4OIL A;  2A3I A;  2QW4 A;  2ZK0 A;  4JYH A;  3W0G A;  4L98 A;  1GWX A;  4UDD A;  3ET1 A;  2Q5P A;  2PKL A;  5L7G A;  3HC6 A;  4OED A;  5GT4 A;  1M2Z A;  3V9V A;  1XP9 A;  1PDU A;  4YPQ A;  3OKI A;  3WFF A;  4CSJ A;  2QXS A;  4XLD A;  2Q5G A;  3OSW A;  2AX8 A;  2NXX E;  3GYT A;  4FNE A;  3W5Q A;  2HB8 A;  3OAP A;  1OT7 A;  5G5W A;  2ZNO A;  4OLM A;  5DMF A;  3VJT A;  1GS4 A;  1NQ0 A;  3ADX A;  3GN8 A;  5A86 A;  3VSP A;  1UHL A;  4WQP A;  4CI4 A;  5KRK A;  1X7B A;  3DZU D;  5E1C A;  2P7Z A;  1RDT D;  2VV0 A;  2OUZ A;  3FEI A;  3B1M A;  1XOW A;  3FS1 A;  4Q0A C;  1WM0 X;  1K4W A;  1X76 A;  2AX6 A;  3F7D A;  2I4Z A;  1XVP A;  3D5F A;  3K22 A;  4G1Y A;  1H9U A;  4QJR A;  2ACL A;  4RMD A;  3RLL A;  3X36 A;  4S0S A;  4F9M A;  1IE8 A;  3ZQT A;  5DWJ A;  3ET0 A;  5JJM B;  3ADT A;  1SJ0 A;  4POJ A;  2O9I A;  1R20 D;  1YY4 A;  2YLO A;  1T73 A;  4NUF A;  1NDE A;  3VJI A;  1IE9 A;  1XPC A;  5DIE A;  5DI7 A;  3R29 A;  3HM1 A;  5F9B A;  3B0Q A;  5ACC A;  1NAV A;  5JY3 A;  1ZDT A;  1YUC A;  2JJ3 A;  5KRL A;  2R40 D;  1I7I A;  5KR9 A;  2VV2 A;  1UPW A;  3V4A A;  3NSP A;  2ZKC A;  2FSZ A;  3B3K A;  1RKH A;  2Q8S A;  4JYG A; 
#chains in the Genus database with same CATH homology
 2Q6R A;  1U9E A;  3ADS A;  3L03 A;  3DCU A;  1FM6 A;  5G44 A;  1X78 A;  3F5C B;  1N46 A;  1SR7 A;  2ABI A;  4FGY A;  4OZR U;  2ZAS A;  4RAK A;  4DOR A;  2Q1V A;  4MDD A;  4WHF A;  2POB A;  2B50 A;  1R6G A;  3OMK A;  4J26 A;  4HLW A;  4NY9 A;  5DMC A;  1QKT A;  2P15 A;  2VST A;  1X7R A;  5DZ1 A;  5KD9 A;  1X7J A;  1NQ2 A;  3D90 A;  1T76 A;  4RUO X;  3TKM A;  3BQD A;  1RK3 A;  4FHH A;  5APK A;  1P93 A;  4G2H A;  3V3Q A;  4BCR A;  2ZNP A;  4PP6 A;  3MNE A;  1Y0S A;  1MV9 A;  4PP5 A;  1T7M A;  1N4H A;  4OKW A;  3RUT A;  5C4T A;  5FQV A;  4MG9 B;  4XAO A;  5DXB A;  1XB7 A;  2O4R A;  3CS8 A;  4ZNW A;  5HYK A;  1ILG A;  5EGV A;  4ZNT A;  2H79 A;  2AM9 A;  3DZU A;  3D24 A;  4DM6 A;  2XYJ A;  1RDT A;  4X1G A;  3ET3 A;  5HJP B;  1ZAF A;  1ERR A;  3VTC A;  2P1U A;  4E4K A;  4MGB A;  5E7V A;  4J5W C;  3OOK A;  3GD2 A;  3X1I A;  4L96 A;  2OCF A;  4MGA B;  3K8S A;  4XT9 A;  2GPV A;  4ZN7 A;  2Z4J A;  3G9E A;  1R20 A;  1ZEO A;  2HAM A;  3OLF A;  1YYE A;  3IPU A;  2AB2 A;  1KV6 A;  3FXV A;  4P6W A;  1K74 D;  2QZO A;  3A2J A;  3A9E A;  4K6I A;  3OZ0 A;  4R2U A;  4ZNH A;  5ETH A;  5IZ0 A;  5DSH A;  1PRG A;  3FC6 A;  5DVS A;  3VSO A;  4IA1 A;  3K23 A;  4M8E A;  1NHZ A;  4PPP A;  5AWK A;  2R40 A;  4DM8 A;  4IWF A;  4RWV A;  2OZ7 A;  1X7E A;  4FHI A;  2ZK4 A;  3A2I A;  4EMA A;  2VV1 B;  5AK2 A;  4QE6 A;  4OKT A;  4LBD A;  4OK1 A;  3R8A A;  3CJW A;  1TXI A;  4OZR E;  3OLL A;  1QKM A;  4QK4 A;  1T5Z A;  4E2J A;  3R5M A;  3FAL B;  4K7A A;  1E3K A;  4MG6 A;  5KRJ A;  2POG A;  5DID A;  5KCW A;  3VT9 A;  3HLV A;  4IW8 A;  3W0J A;  3UP0 A;  1U3R A;  3L0E A;  1ERE A;  3R8D A;  4J5X C;  3R2A A;  5HCV A;  2PIU A;  3ZRA A;  5KYA A;  2NXX A;  1ILH A;  3VI8 A;  2QSE A;  3Q95 B;  4OJB A;  3P8X A;  4B7W A;  1XNN A;  2QA8 B;  4WVD A;  3DY6 A;  2QXM A;  3H52 A;  4REF A;  3TY0 A;  2I0J A;  1T63 A;  2P4Y A;  4PPS A;  4R06 A;  1S9P A;  3KMR A;  4NIE A;  4WHG A;  2I4J A;  3K6P A;  3OMQ A;  4WLB A;  3VT7 A;  1E3G A;  2YJA B;  4OJ4 A;  1XQC A;  3WT6 A;  4LTW A;  1G1U A;  3VTD A;  3A40 X;  5GID A;  1YIM A;  1RKG A;  2GTK A;  2HVC A;  4KZJ A;  2PNU A;  4E4Q A;  1R5K A;  1Y9R A;  5DYD A;  3CWD A;  2ZNN A;  4RZF A;  1N83 A;  4DK8 A;  5DX3 B;  4OKB A;  3FUR A;  4S0T A;  4ZO1 B;  4TUZ B;  3VT5 A;  2AMB A;  1PQC A;  5H1E A;  2G5O A;  2ZK2 A;  2AXA A;  4OAR A;  3P0U A;  4KZI A;  3LBD A;  4PLE A;  5DUE A;  1GWR A;  4LNX A;  5HYR A;  3CS4 A;  2ZLA A;  1XQ3 A;  3ERT A;  1DKF B;  1HG4 A;  3IPQ A;  1DB1 A;  4G21 A;  5APH A;  2VV3 A;  5DXP A;  2GL8 A;  5DV8 A;  2AA2 A;  4A4W A;  3E00 D;  5EI1 A;  4IS8 A;  5K13 A;  2Q1H A;  2IHQ A;  2AAX A;  2IOG A;  3A3Z X;  2QPY A;  4FN9 A;  1XIU A;  2ATH A;  3UUD B;  3RVF A;  3L0J A;  5I4V A;  4XUH A;  5DKG A;  5EIT A;  1K74 A;  2J4A A;  2YLP A;  3VJH A;  4IA2 A;  2Q7I A;  4NQA B;  1FCX A;  1QKN A;  5JJM A;  1UPV A;  4OIU A;  2FAI A;  2NV7 A;  2P7G A;  4OHA A;  3IPS A;  3WGP A;  5G43 A;  4A2J A;  3W0Y A;  2YFE A;  5B5B A;  1RJK A;  5IXK A;  4IV4 A;  4R6S A;  5KYJ A;  2XYW A;  3ERD A;  2HCD A;  2Q7K A;  2QA6 A;  4IA7 A;  3SP9 A;  2JF9 A;  2E2R A;  5AAV B;  2JFA B;  2PIO A;  1PQ6 A;  1K7L A;  2QGW A;  5C4S A;  3B0R A;  4IVW A;  4REE A;  1OVL B;  3AUQ A;  3OSA A;  3G8I A;  4XHD A;  5DKB A;  2R6W A;  1S19 A;  5AVL A;  5AWJ A;  3WT5 A;  1A28 A;  3KFC A;  2ZVT A;  3EYB A;  2P1V A;  4XUM A;  3TKC A;  3V3E A;  3WT7 A;  3P88 A;  4IU7 A;  4OEZ A;  3VRU A;  1I37 A;  2PIQ A;  3CDS A;  3CDP A;  3UU7 B;  3V9Y A;  5E0W A;  5DTV A;  3R8I A;  3F5C A;  4PVU A;  3U9Q A;  2VV4 B;  3QT0 A;  1YA3 A;  1Z95 A;  5HZC A;  4UDA A;  1YIN A;  3VT8 A;  4OJ9 A;  3ET2 A;  4YNK A;  2J7X A;  4APU A;  3UVV B;  1PZL A;  3A2H A;  1YP0 A;  3AX8 A;  2FVJ A;  3W5P A;  1NQ1 A;  3GYU A;  1U3S A;  5DUG A;  3VHU A;  2PIT A;  4QM0 A;  3H0A D;  1XAP A;  5DV6 A;  1Z5X U;  4CI5 A;  4G2I A;  3ADV A;  3KYT A;  1QKU A;  2ZK3 A;  1Q4X A;  4RE8 A;  2AO6 A;  1T74 A;  2PJL A;  2PIR A;  2Q70 A;  5DXR A;  3PLZ A;  5LGA A;  2QTU A;  4MG9 A;  2REW A;  2AA5 A;  3W5R A;  1NYX A;  3JZB A;  4OC7 A;  2ZXN A;  3L0L A;  1NRL A;  2XHS A;  2YJD A;  4OEY A;  2GPP A;  1YMT A;  1T7T A;  2EWP A;  4RZE A;  2HWQ A;  3E00 A;  5HJP A;  5DXE A;  2GIU A;  5DWE A;  5C4O A;  2PRG A;  5FQT A;  2QR9 A;  4DK7 A;  2HAR A;  1G2N A;  1NQ7 A;  4MGD B;  2B23 A;  2PIN A;  2PIW A;  5L7H A;  1M7W A;  4MGA A;  2AWH A;  4IQR A;  3GWX A;  1T7F A;  3OS8 A;  4IV2 A;  3W0I A;  3JZC A;  2V7C A;  1OSH A;  2H77 A;  3CLD A;  3AN4 A;  3KDT A;  3L1B A;  5KRA A;  3SP6 A;  2HWR A;  4TV1 B;  2AYR A;  5DP0 A;  2G0G A;  3OLS A;  3E94 A;  4J24 A;  4M8H A;  4OGH A;  3T03 A;  1VJB A;  3X1H A;  3ADW A;  4X1F A;  5GIC A;  2P7A A;  5KRC A;  4KZM A;  4OH6 A;  3BC5 A;  2W8Y A;  5DV3 A;  3RLJ A;  5KRO A;  3PO9 A;  3D57 A;  1L2I A;  3OMP A;  4N8R A;  5E19 A;  4QL8 A;  1P8D A;  3B68 A;  2QE4 A;  2Q5S A;  2VV1 A;  5HJS A;  3B66 A;  4PLD A;  3B0T A;  5ICK A;  3VRT A;  2Q7L A;  3KMG A;  5KCE A;  5DYB A;  2QAB A;  3FEJ A;  3O1D A;  3FAL A;  1XNX A;  3NSQ A;  1YJE A;  1ZGY A;  4XI3 A;  5DXG A;  3B0W A;  4YT1 A;  1SKX A;  2ZL9 A;  2LBD A;  4G20 A;  4IWC A;  4RMC A;  5KRM A;  3NOA A;  3Q95 A;  4IA3 A;  5DUH A;  2QA8 A;  2P54 A;  5DKS A;  3H0A A;  4MG8 B;  5G42 A;  2BJ4 B;  1Z5X E;  2Q60 A;  3KBA A;  2Q6S A;  4RFW A;  2AA6 A;  4K4J A;  3KDU A;  1LV2 A;  3B67 A;  4UDC A;  4ZOM A;  3G8O A;  5KCD A;  4LSJ A;  3S9S A;  1FCZ A;  4POH A;  2ZMJ A;  1XV9 B;  2ZK5 A;  3A78 A;  5DU5 A;  3X31 A;  4A4V A;  3W0C A;  2Q59 B;  2ZMI A;  1XDK B;  3VRV A;  5DX3 A;  3DT3 A;  3N00 A;  2HFP A;  4IW6 A;  3VHV A;  5B41 A;  2GWX A;  3VT4 A;  1SQN A;  1MZN A;  2OAX A;  2QH6 A;  3KMZ A;  1FM9 D;  4TUZ A;  1KKQ A;  1XP1 A;  3R5N A;  3M7R A;  3PBA A;  3UUA B;  5AVI A;  5EHJ A;  1Y0X X;  3G0W A;  3CS6 A;  4ZNS A;  3E7C A;  1DKF A;  4IVY A;  4G1D A;  1FCY A;  4MG7 B;  2HAS A;  2B1V A;  3OSI A;  3CQV A;  2ZNQ A;  1U3Q A;  4ZJR A;  4EM9 A;  5FQS A;  5KRI A;  4S14 A;  2ZXZ A;  2ZK1 A;  3FUG A;  3GBK A;  4OZT U;  3UUD A;  3DCT A;  5DWL A;  3OOF A;  3VT6 A;  3FLI A;  3WWR A;  2Q61 A;  4RZG A;  2Q7J A;  5LWP A;  3AN3 A;  4PP3 A;  2QGT A;  5APJ A;  1PCG A;  2YLY A;  3ADU A;  4JL4 A;  3OKH A;  2NW4 A;  4PWL A;  5FQR A;  1I7G A;  3RUU A;  1T79 A;  1LBD A;  5DZ3 A;  1S0Z A;  4Q13 A;  1S0X A;  1UHL B;  3AUN A;  5DIG A;  5DVC A;  3OMO A;  4P6X A;  5AAV A;  2JFA A;  4XTA A;  1T7R A;  3B65 A;  3GZ9 A;  1XVP B;  1HJ1 A;  4PF3 A;  4Q50 A;  5DVV A;  3VT3 A;  1OVL A;  5KCT A;  2ACL B;  3HQ5 A;  3W0H A;  4NB6 A;  3VJS A;  2F4B A;  2ZBS A;  5DWG A;  5DXM A;  2O4J A;  1ZDU A;  2OVM A;  4JAZ A;  3UU7 A;  1XZX X;  1MVC A;  1OSV A;  4N73 A;  2Z4B A;  2ZLC A;  3OZJ A;  5DZH A;  3DZY D;  2VV4 A;  2HC4 A;  3VHW A;  3BEJ A;  5E14 A;  2BAW A;  1PQ9 A;  4WPF A;  3UVV A;  3HOD A;  5KCF A;  3IXP D;  3VN2 A;  1BSX A;  3MNO A;  5JI0 D;  5EJV A;  3O1E A;  2XYX A;  4OEA A;  5FQP A;  3KWY A;  5E15 A;  5DZI A;  3KPZ A;  4DOS A;  4MG5 A;  5E0X A;  4ZNV A;  1EXA A;  2Q6J A;  3V49 A;  3W0A A;  5KCC A;  2R6Y A;  5L11 A;  2NPA A;  3ILZ A;  4ONI A;  2GPO A;  1FM9 A;  3AFR A;  5DY8 A;  3HC5 A;  4S15 A;  2GP7 A;  3WFG A;  4UDB A;  2OVH A;  2AX7 A;  5EC9 A;  1YOW A;  3V9T A;  4ZNU A;  1FD0 A;  2I4P A;  3IA6 A;  5DK9 A;  5G45 A;  4OZT E;  4MGD A;  3WJ4 A;  5G46 A;  3DR1 A;  2OM9 A;  5DRM A;  1R1K D;  5DLR A;  1ZUC A;  3OMM A;  2P1T A;  2AMA A;  5DL4 A;  5SYZ A;  1T65 A;  2YLQ A;  2ZXM A;  3OS8 C;  2G0H A;  4OFR A;  3B5R A;  3HZF A;  5L7E A;  4JYI A;  5AZT A;  3L3Z A;  4MGC A;  2GPU A;  5DXB B;  4YMQ A;  3WJ5 A;  4O8F A;  4TV1 A;  4OIV A;  4OKX A;  2QMV A;  4ZO1 X;  4JGV A;  3IMY A;  4PXM A;  1XP6 A;  3PCU A;  3OS9 A;  3GWS X;  4IUI A;  2PIP L;  4MGB B;  5KRH A;  4J5W A;  2AA7 A;  5C4U A;  2PIX A;  1G5Y A;  1XLS A;  3LMP A;  3PRG A;  2Q3Y A;  2J14 A;  5KCU A;  5KRF A;  3PEQ A;  5IAW A;  4ZJW A;  2B1Z A;  2ZY0 A;  5DXK A;  3MNP A;  1NUO A;  3ZR7 A;  1NAX A;  1ZH7 A;  3AZ3 A;  1ZKY A;  5DKE A;  2HBH A;  5DRJ A;  4HEE X;  2YHD A;  2PIV A;  2QZO B;  3A9E B;  4N5G A;  5AAU A;  3DZY A;  4LNW A;  3FC6 B;  3TX7 B;  2HB7 A;  1S9Q A;  5AYG A;  2IOK A;  3AZ1 A;  1TFC A;  3P89 A;  3IXP A;  4PRG A;  5DZ0 A;  1XLS E;  4Y29 A;  5M96 A;  1YOK A;  2G44 A;  1GWQ A;  1I38 A;  4OFU A;  4QE8 A;  1KNU A;  2AX9 A;  4MG8 A;  1FBY A;  2QNV A;  2BJ4 A;  3UP3 A;  5DWI A;  3W5T A;  4G1Z A;  1UOM A;  2ZFX A;  3AZ2 A;  4ITF A;  4RUJ A;  3UUC A;  3ZRB A;  3WTQ A;  3WMH A;  3HVL A;  1FM6 D;  4ITE A;  3OGT A;  1G50 A;  1XV9 A;  4DMA A;  1L2J A;  1A52 A;  2VSR A;  2YAT A;  2Q59 A;  2ZMH A;  1XDK A;  3HO0 A;  4J5X A;  4N1Y A;  5AZV A;  4ZN9 A;  2ZK6 A;  3D6D A;  5G3J A;  4RME A;  2J7Y A;  1PK5 A;  4OH5 A;  5GIE A;  1XJ7 A;  3SZ1 A;  3L3X A;  5DXQ A;  1EXX A;  3UUA A;  2XKW A;  3AUR A;  3VTB A;  1R1K A;  3VRW A;  3RY9 A;  4DQM A;  4MG7 A;  2I0G A;  2V0V A;  3CTB A;  4ZI1 A;  5CJ6 A;  1M13 A;  4RUP A;  4OIL A;  2A3I A;  2QW4 A;  2ZK0 A;  4JYH A;  3W0G A;  4L98 A;  1GWX A;  4UDD A;  3ET1 A;  2Q5P A;  2PKL A;  5L7G A;  3HC6 A;  4OED A;  5GT4 A;  1M2Z A;  3V9V A;  1XP9 A;  1PDU A;  4YPQ A;  3OKI A;  3WFF A;  4CSJ A;  2QXS A;  4XLD A;  2Q5G A;  3OSW A;  2AX8 A;  2NXX E;  3GYT A;  4FNE A;  3W5Q A;  2HB8 A;  3OAP A;  1OT7 A;  5G5W A;  2ZNO A;  4OLM A;  5DMF A;  3VJT A;  1GS4 A;  1NQ0 A;  3ADX A;  3GN8 A;  5A86 A;  3VSP A;  1UHL A;  4WQP A;  4CI4 A;  5KRK A;  1X7B A;  3DZU D;  5E1C A;  2P7Z A;  1RDT D;  2VV0 A;  2OUZ A;  3FEI A;  3B1M A;  1XOW A;  3FS1 A;  4Q0A C;  1WM0 X;  1K4W A;  1X76 A;  2AX6 A;  3F7D A;  2I4Z A;  1XVP A;  3D5F A;  3K22 A;  4G1Y A;  1H9U A;  4QJR A;  2ACL A;  4RMD A;  3RLL A;  3X36 A;  4S0S A;  4F9M A;  1IE8 A;  3ZQT A;  5DWJ A;  3ET0 A;  5JJM B;  3ADT A;  1SJ0 A;  4POJ A;  2O9I A;  1R20 D;  1YY4 A;  2YLO A;  1T73 A;  4NUF A;  1NDE A;  3VJI A;  1IE9 A;  1XPC A;  5DIE A;  5DI7 A;  3R29 A;  3HM1 A;  5F9B A;  3B0Q A;  5ACC A;  1NAV A;  5JY3 A;  1ZDT A;  1YUC A;  2JJ3 A;  5KRL A;  2R40 D;  1I7I A;  5KR9 A;  2VV2 A;  1UPW A;  3V4A A;  3NSP A;  2ZKC A;  2FSZ A;  3B3K A;  1RKH A;  2Q8S A;  4JYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...