2Q5SA

Crystal structure of ppargamma bound to partial agonist ntzdpa
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
256
Chain Sequence
SADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Partial Agonists Activate PPARgamma Using a Helix 12 Independent Mechanism
pubmed doi rcsb
molecule keywords Peroxisome Proliferator-Activated Receptor gamma
molecule tags Ligand binding protein
source organism Homo sapiens
total genus 96
structure length 256
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2q5sA00
3B67A 3CJWA 4JYIA 4Q0AC 2ZMIA 3A3ZX 5DVVA 3H0AD 5AYGA 2NPAA 2BJ4B 4OJ4A 3GD2A 3WJ5A 1LBDA 1LV2A 3K23A 2Z4JA 2H79A 2QXMA 1XOWA 3KDTA 3KYTA 3OGTA 4K7AA 4N5GA 5G46A 5EITA 4ZNUA 4APUA 3CS4A 4WHGA 3UP0A 4JL4A 3JZBA 4OARA 5EJVA 4MGCA 4OKWA 3WGPA 5DLRA 3IPQA 4LNXA 3E00D 3CS8A 4A2JA 3OOKA 4L96A 1EREA 3DT3A 1DKFB 4M8HA 4MGBA 2QGWA 4IVWA 4CSJA 1R1KA 2POBA 5APJA 3ZR7A 4PP5A 3UVVA 3FS1A 1RK3A 5M96A 4OJ9A 4JAZA 2G0HA 5JY3A 2FAIA 3UVVB 3FEIA 2QTUA 4TUZA 1XDKA 4RFWA 3MNEA 3KWYA 1R6GA 2Q7JA 2PINA 1YP0A 5FQVA 4QE8A 4IA3A 4WPFA 1XDKB 3PEQA 4J5WC 1YA3A 4L98A 2HFPA 2R40A 1XVPA 4OC7A 5C4SA 4OH5A 3VTBA 2HVCA 2AX9A 1L2IA 1PRGA 4PWLA 3W5PA 2VV1A 5DZ1A 4OIVA 1S9PA 1XJ7A 2XYJA 4MDDA 4POJA 2Q6JA 1PQ9A 2G0GA 2VV1B 1FM6D 1X7BA 2Q5PA 3CTBA 4KZJA 3B0TA 4LBDA 2ZK0A 3W0JA 4ZNTA 1TXIA 4S14A 4FHIA 5AVLA 1G1UA 1RDTA 3SZ1A 3DZUD 3X1IA 1WM0X 2ZNNA 3KBAA 4MG6A 5KCUA 1G5YA 4FHHA 1SQNA 4IVYA 5DXEA 3R5NA 5DVSA 1NQ7A 1KV6A 4REEA 3VT6A 4IW8A 1R5KA 3FUGA 5F9BA 3WMHA 3W0CA 5KCCA 2ZKCA 5KRMA 4PPPA 2E2RA 4Q50A 4HEEX 3UU7B 2Q6SA 2V0VA 3KMRA 5C4TA 3H0AA 3OLSA 4OH6A 1GWQA 3CWDA 4FGYA 2ZNQA 2AB2A 3IPSA 3VSPA 5DWLA 2PJLA 1N46A 3P0UA 5APKA 4MG9A 5A86A 1EXXA 1PQCA 2JFAB 1XNXA 3D90A 4MG9B 4ZNWA 5E14A 4TV1B 3A2IA 2GP7A 3DZUA 4NB6A 1ERRA 4OKBA 2R6YA 3D57A 5HJPA 2HBHA 3U9QA 5L7EA 3E00A 3RY9A 1U3SA 4S15A 2HARA 5HJPB 3W0YA 4G1DA 1XIUA 2GIUA 4P6XA 1X7EA 1K74D 3VRTA 4DK7A 1XP6A 5H1EA 5IZ0A 3ADXA 2NXXE 2GPPA 3T03A 5DXBA 5KYAA 4DM6A 3VRUA 4EM9A 5DUEA 3L3XA 4XUMA 1BSXA 5B41A 5EI1A 3ET1A 4G2IA 2HWQA 2YLOA 4QJRA 2AO6A 2P1UA 3F5CB 1KNUA 3OSIA 1HG4A 5ICKA 1Y0SA 5L7HA 5DXMA 1NYXA 2QA6A 5E0XA 3OZ0A 3GYUA 3OZJA 5C4UA 4MG7A 4IU7A 1K7LA 3PBAA 1NQ0A 5E0WA 3WT7A 3CQVA 5KRJA 2ZMHA 5G3JA 1MV9A 4MG7B 3HM1A 4XHDA 4F9MA 1PK5A 3DZYA 1YY4A 3GN8A 3RLJA 1PQ6A 5DUHA 1YOKA 5AAVB 2AMAA 3K8SA 5KRKA 1YJEA 2ZVTA 3VI8A 5HJSA 1ZKYA 1ZUCA 3B0QA 3CS6A 4NQAB 2I4PA 2NXXA 1RJKA 3ERTA 3HODA 1XPCA 1YIMA 2OAXA 3FURA 3HO0A 3KMGA 5DZ3A 3OMKA 5DWJA 1NAVA 3O1EA 3Q95A 3AFRA 5GT4A 2QNVA 4RUPA 1GWRA 2HAMA 3DY6A 5C4OA 1H9UA 2OM9A 3Q95B 1GWXA 2B23A 5DSHA 3W0HA 2PITA 4OZTU 4CI4A 4PVUA 3DCTA 1DB1A 3PCUA 2J14A 4O8FA 4ZO1B 2QH6A 5KYJA 3ERDA 1X76A 2AXAA 1IE9A 1R20A 2HCDA 3FC6A 3IMYA 5KRIA 1XAPA 2GPUA 3K6PA 2QGTA 5AVIA 4IA7A 3W5QA 3L3ZA 4MGAA 4RUOX 2VSRA 4RWVA 2YLYA 2R6WA 5G45A 4OIUA 3VJSA 3B68A 2ZL9A 5APHA 2QA8A 3KFCA 1SJ0A 5E15A 2P7GA 3OLFA 5DV8A 2QXSA 1L2JA 3VN2A 3UUDA 3VJHA 3OKIA 3W5RA 4A4VA 5KCTA 2I4ZA 2PIVA 2VV0A 3OAPA 4IV4A 4IW6A 4Q13A 3ZRBA 4QE6A 4K6IA 5FQTA 1NDEA 2Q7IA 1T63A 4RMDA 3QT0A 5DUGA 1FM9A 3GZ9A 4ZN9A 4R06A 1K74A 4OFRA 4MGBB 1Y9RA 1X7JA 2I0JA 4K4JA 2ABIA 4PF3A 1E3GA 1P93A 1YUCA 3VHWA 4Y29A 2J7XA 3AURA 5KROA 2ZXZA 2B50A 3AZ1A 4KZMA 1XNNA 1U3QA 2AX8A 2ZK5A 1T79A 2AX7A 3AN4A 2GPVA 3FEJA 4TUZB 2PIPL 4QL8A 3HVLA 5LWPA 4WHFA 3KMZA 1Z5XE 2O9IA 3IXPA 4ZO1X 5DKGA 3VTDA 2QPYA 3AN3A 3KPZA 3RVFA 5KRCA 1XVPB 5KRHA 5LGAA 1XLSE 3FLIA 4LNWA 2Q7LA 4OLMA 1PZLA 1QKUA 5JI0D 1ZDTA 3O1DA 3K22A 4G21A 5DMFA 4OK1A 1OVLA 2B1ZA 3PO9A 5E19A 3OS9A 5KCWA 4RE8A 3VHVA 2LBDA 1T7RA 4UDAA 2Q1HA 1OVLB 1G2NA 1QKTA 1ILHA 2GPOA 2AAXA 1M7WA 2I0GA 2HB8A 5DXKA 4WVDA 1I37A 5EHJA 2ZK6A 3VT8A 3W0GA 3ADWA 1XB7A 3WWRA 2GTKA 3WT6A 2ZBSA 3AUNA 3CLDA 2PIQA 3V4AA 2QABA 4R6SA 5DRMA 2YFEA 3X31A 1MVCA 4JGVA 5GIDA 3OS8C 1QKNA 2QMVA 5EC9A 3MNPA 2ZXNA 4OZRE 4POHA 2IOGA 2PNUA 4REFA 4RUJA 5KRLA 2Q70A 3R5MA 4UDBA 2ATHA 2ZMJA 4FN9A 3BC5A 2G44A 3R8IA 3OKHA 3VHUA 3FALA 1Z95A 4IS8A 3ILZA 1FCZA 2ZNOA 4IWCA 1EXAA 1A28A 5DX3A 5GICA 2XKWA 4DORA 3FALB 2BAWA 5AWKA 1I7GA 3OOFA 3SP6A 5DX3B 2ACLA 3HZFA 3ET2A 3P88A 4OKXA 2PIXA 3R29A 5DZIA 5DTVA 2YJDA 2AYRA 3AZ3A 3TKMA 3WJ4A 4DM8A 4ZI1A 4ZN7A 5DXRA 1U3RA 1YYEA 2QR9A 4CI5A 5ETHA 2ZK3A 5DP0A 2AX6A 3WFGA 5KR9A 1UOMA 4J5WA 1PCGA 2Q3YA 4J5XC 2OVMA 5DWEA 1ZEOA 5DXBB 2P54A 4ITFA 4ZJWA 5DVCA 5DIEA 5K13A 5KD9A 1XP1A 5AK2A 4N8RA 5B5BA 4M8EA 3A2JA 2OZ7A 2YLQA 2HASA 3KDUA 1UPVA 3ADSA 4OHAA 2Q59A 2QE4A 3GYTA 4XTAA 5DZ0A 3WTQA 1XQ3A 4G20A 3A2HA 2GL8A 4WLBA 4XT9A 5DYDA 4MGDA 5DXGA 3OMPA 1Y0XX 1NQ1A 3L0JA 3TKCA 3VJTA 4MGDB 1NAXA 2Q61A 1UPWA 1RKHA 5G43A 3OLLA 1N4HA 2PIWA 1ZDUA 1FM6A 5G5WA 4JYHA 2JF9A 3G8IA 1A52A 5DK9A 1T76A 4RZGA 3DR1A 2Q60A 1ZGYA 2VV3A 4PXMA 4RZEA 4IA2A 4MG8A 4G2HA 1NRLA 3V49A 2POGA 3F7DA 2P1VA 1X78A 5EGVA 3W0AA 3D5FA 4MG8B 2R40D 4BCRA 3OS8A 4NY9A 4B7WA 4E4KA 3V9TA 3TY0A 3ET3A 2ZK2A 4EMAA 2HWRA 5DYBA 3OMOA 4RMCA 4FNEA 3RLLA 4ZJRA 2AA6A 5G42A 3FC6B 1RDTD 1S0XA 3L1BA 3OSWA 1M13A 4ONIA 4PRGA 1NHZA 3ZQTA 3NOAA 3V9VA 1PDUA 4MGAB 3B1MA 5DWIA 5IAWA 2B1VA 3LBDA 4QM0A 4ZNHA 3B65A 4YPQA 1XV9A 2HC4A 1I38A 2QA8B 2Q6RA 3VRWA 1XV9B 3B66A 3BEJA 4IWFA 1E3KA 4ITEA 4J5XA 2PIUA 2IHQA 2Q7KA 4NUFA 3UUDB 5KCDA 5DRJA 3B5RA 4QK4A 1I7IA 4E2JA 4X1GA 1IE8A 3CDSA 4MG5A 2BJ4A 2FSZA 3R2AA 5AZTA 3X1HA 5AAUA 2PIOA 1FCXA 3V3QA 1YOWA 2P7AA 3B3KA 5AWJA 2IOKA 4PLDA 1NUOA 1XZXX 5DV6A 3VT3A 3DCUA 5HCVA 5KRAA 3HQ5A 3VSOA 3FXVA 5G44A 2ZLCA 3VTCA 3GWXA 1T65A 4PP3A 3EYBA 4DOSA 1FBYA 1DKFA 2H77A 5HYRA 5DXPA 5E1CA 3UUAA 1KKQA 4N1YA 4OEYA 1T7TA 5CJ6A 5DI7A 2NV7A 1T7MA 3L0EA 3UUAB 1YMTA 2XYWA 2Q5GA 2YHDA 1QKMA 2P1TA 4P6WA 4XI3A 5E7VA 2QZOA 5FQPA 4N73A 2G5OA 2XHSA 3BQDA 3G0WA 1NQ2A 3V9YA 3G8OA 4XUHA 2QZOB 3AZ2A 2AM9A 1S19A 3NSPA 5FQSA 1FCYA 3NSQA 2AA5A 1OSHA 3HC5A 3WT5A 2I4JA 2F4BA 3OSAA 1ZAFA 3OMQA 2AWHA 5KRFA 3DZYD 2XYXA 4XAOA 5DL4A 3RUTA 3W0IA 3P89A 4R2UA 3A40X 1S9QA 3PLZA 2QSEA 2Z4BA 4UDDA 1XLSA 2YJAB 2ZFXA 3ADVA 2P7ZA 3VT9A 1OSVA 2REWA 1SR7A 2ZNPA 3IPUA 3R8AA 3UUCA 5KCEA 2NW4A 3ZRAA 1SKXA 3A78A 4PPSA 2QW4A 4RMEA 4YT1A 2JJ3A 4OZTE 3D6DA 3VJIA 4DK8A 1ZH7A 2GWXA 2P4YA 4RZFA 2PRGA 1T7FA 2ZXMA 2VV2A 4OKTA 3R8DA 3UU7A 2PIRA 4J24A 4PP6A 2A3IA 5DY8A 2HB7A 2PKLA 2Q8SA 4JYGA 4ZOMA 2EWPA 4UDCA 2ACLB 5I4VA 3H52A 1R20D 1RKGA 4YMQA 2O4JA 5HYKA 1S0ZA 5DIDA 3L0LA 4NIEA 3M7RA 1T74A 2V7CA 2J7YA 3HC6A 4J26A 4KZIA 4OGHA 5DXQA 2JFAA 1K4WA 4TV1A 4A4WA 2O4RA 4IQRA 2W8YA 4S0SA 3IA6A 5DKBA 5GIEA 1GS4A 3HLVA 1XQCA 3MNOA 4HLWA 4OILA 5KCFA 1P8DA 2ZK1A 2AMBA 2FVJA 5FQRA 5DWGA 3AUQA 5DKEA 3ADTA 4X1FA 5DKSA 1ILGA 3V3EA 1M2ZA 2Q59B 5IXKA 1UHLA 1T5ZA 1VJBA 4OEAA 5SYZA 5HZCA 1FM9D 3E7CA 3W5TA 4E4QA 5L7GA 3PRGA 1MZNA 1UHLB 1N83A 1R1KD 1Z5XU 5DMCA 3SP9A 1G50A 3UP3A 3VT4A 3X36A 2OCFA 3D24A 3JZCA 1Q4XA 3ET0A 3F5CA 3LMPA 5ACCA 3S9SA 3VT5A 3RUUA 2OVHA 3N00A 4LSJA 4ZNSA 1X7RA 2OUZA 2ZASA 4DQMA 1YINA 2ZK4A 4IV2A 4ZNVA 2AA2A 3A9EA 3L03A 4S0TA 2AA7A 3IXPD 3CDPA 5DZHA 3A9EB 3ADUA 3P8XA 4LTWA 3WFFA 2YLPA 3OMMA 5AAVA 3VRVA 2VSTA 3TX7B 4RAKA 5DIGA 4G1ZA 2J4AA 3VT7A 2ZY0A 1HJ1A 4DMAA 2YATA 3B0WA 4OJBA 1XP9A 4OFUA 2VV4A 2Q5SA 4WQPA 5L11A 2P15A 4PLEA 3GBKA 4IA1A 3G9EA 5AZVA 4G1YA 2VV4B 1FD0A 4OZRU 2ZLAA 3E94A 5JJMA 5DU5A 4OEDA 1TFCA 4OEZA 2Q1VA 4IUIA 4XLDA 4YNKA 5DV3A 3GWSX 1U9EA 5JJMB 3AX8A 1T73A 3B0RA 1OT7A
chains in the Genus database with same CATH superfamily
3B67A 3CJWA 4JYIA 4Q0AC 2ZMIA 3A3ZX 5DVVA 3H0AD 5AYGA 2NPAA 2BJ4B 4OJ4A 3GD2A 3WJ5A 1LBDA 1LV2A 3K23A 2Z4JA 2H79A 2QXMA 1XOWA 3KDTA 3KYTA 3OGTA 4K7AA 4N5GA 5G46A 5EITA 4ZNUA 4APUA 3CS4A 4WHGA 3UP0A 4JL4A 3JZBA 4OARA 5EJVA 4MGCA 4OKWA 3WGPA 5DLRA 3IPQA 4LNXA 3E00D 3CS8A 4A2JA 3OOKA 4L96A 1EREA 3DT3A 1DKFB 4M8HA 4MGBA 2QGWA 4IVWA 4CSJA 1R1KA 2POBA 5APJA 3ZR7A 4PP5A 3UVVA 3FS1A 1RK3A 5M96A 4OJ9A 4JAZA 2G0HA 5JY3A 2FAIA 3UVVB 3FEIA 2QTUA 4TUZA 1XDKA 4RFWA 3MNEA 3KWYA 1R6GA 2Q7JA 2PINA 1YP0A 5FQVA 4QE8A 4IA3A 4WPFA 1XDKB 3PEQA 4J5WC 1YA3A 4L98A 2HFPA 2R40A 1XVPA 4OC7A 5C4SA 4OH5A 3VTBA 2HVCA 2AX9A 1L2IA 1PRGA 4PWLA 3W5PA 2VV1A 5DZ1A 4OIVA 1S9PA 1XJ7A 2XYJA 4MDDA 4POJA 2Q6JA 1PQ9A 2G0GA 2VV1B 1FM6D 1X7BA 2Q5PA 3CTBA 4KZJA 3B0TA 4LBDA 2ZK0A 3W0JA 4ZNTA 1TXIA 4S14A 4FHIA 5AVLA 1G1UA 1RDTA 3SZ1A 3DZUD 3X1IA 1WM0X 2ZNNA 3KBAA 4MG6A 5KCUA 1G5YA 4FHHA 1SQNA 4IVYA 5DXEA 3R5NA 5DVSA 1NQ7A 1KV6A 4REEA 3VT6A 4IW8A 1R5KA 3FUGA 5F9BA 3WMHA 3W0CA 5KCCA 2ZKCA 5KRMA 4PPPA 2E2RA 4Q50A 4HEEX 3UU7B 2Q6SA 2V0VA 3KMRA 5C4TA 3H0AA 3OLSA 4OH6A 1GWQA 3CWDA 4FGYA 2ZNQA 2AB2A 3IPSA 3VSPA 5DWLA 2PJLA 1N46A 3P0UA 5APKA 4MG9A 5A86A 1EXXA 1PQCA 2JFAB 1XNXA 3D90A 4MG9B 4ZNWA 5E14A 4TV1B 3A2IA 2GP7A 3DZUA 4NB6A 1ERRA 4OKBA 2R6YA 3D57A 5HJPA 2HBHA 3U9QA 5L7EA 3E00A 3RY9A 1U3SA 4S15A 2HARA 5HJPB 3W0YA 4G1DA 1XIUA 2GIUA 4P6XA 1X7EA 1K74D 3VRTA 4DK7A 1XP6A 5H1EA 5IZ0A 3ADXA 2NXXE 2GPPA 3T03A 5DXBA 5KYAA 4DM6A 3VRUA 4EM9A 5DUEA 3L3XA 4XUMA 1BSXA 5B41A 5EI1A 3ET1A 4G2IA 2HWQA 2YLOA 4QJRA 2AO6A 2P1UA 3F5CB 1KNUA 3OSIA 1HG4A 5ICKA 1Y0SA 5L7HA 5DXMA 1NYXA 2QA6A 5E0XA 3OZ0A 3GYUA 3OZJA 5C4UA 4MG7A 4IU7A 1K7LA 3PBAA 1NQ0A 5E0WA 3WT7A 3CQVA 5KRJA 2ZMHA 5G3JA 1MV9A 4MG7B 3HM1A 4XHDA 4F9MA 1PK5A 3DZYA 1YY4A 3GN8A 3RLJA 1PQ6A 5DUHA 1YOKA 5AAVB 2AMAA 3K8SA 5KRKA 1YJEA 2ZVTA 3VI8A 5HJSA 1ZKYA 1ZUCA 3B0QA 3CS6A 4NQAB 2I4PA 2NXXA 1RJKA 3ERTA 3HODA 1XPCA 1YIMA 2OAXA 3FURA 3HO0A 3KMGA 5DZ3A 3OMKA 5DWJA 1NAVA 3O1EA 3Q95A 3AFRA 5GT4A 2QNVA 4RUPA 1GWRA 2HAMA 3DY6A 5C4OA 1H9UA 2OM9A 3Q95B 1GWXA 2B23A 5DSHA 3W0HA 2PITA 4OZTU 4CI4A 4PVUA 3DCTA 1DB1A 3PCUA 2J14A 4O8FA 4ZO1B 2QH6A 5KYJA 3ERDA 1X76A 2AXAA 1IE9A 1R20A 2HCDA 3FC6A 3IMYA 5KRIA 1XAPA 2GPUA 3K6PA 2QGTA 5AVIA 4IA7A 3W5QA 3L3ZA 4MGAA 4RUOX 2VSRA 4RWVA 2YLYA 2R6WA 5G45A 4OIUA 3VJSA 3B68A 2ZL9A 5APHA 2QA8A 3KFCA 1SJ0A 5E15A 2P7GA 3OLFA 5DV8A 2QXSA 1L2JA 3VN2A 3UUDA 3VJHA 3OKIA 3W5RA 4A4VA 5KCTA 2I4ZA 2PIVA 2VV0A 3OAPA 4IV4A 4IW6A 4Q13A 3ZRBA 4QE6A 4K6IA 5FQTA 1NDEA 2Q7IA 1T63A 4RMDA 3QT0A 5DUGA 1FM9A 3GZ9A 4ZN9A 4R06A 1K74A 4OFRA 4MGBB 1Y9RA 1X7JA 2I0JA 4K4JA 2ABIA 4PF3A 1E3GA 1P93A 1YUCA 3VHWA 4Y29A 2J7XA 3AURA 5KROA 2ZXZA 2B50A 3AZ1A 4KZMA 1XNNA 1U3QA 2AX8A 2ZK5A 1T79A 2AX7A 3AN4A 2GPVA 3FEJA 4TUZB 2PIPL 4QL8A 3HVLA 5LWPA 4WHFA 3KMZA 1Z5XE 2O9IA 3IXPA 4ZO1X 5DKGA 3VTDA 2QPYA 3AN3A 3KPZA 3RVFA 5KRCA 1XVPB 5KRHA 5LGAA 1XLSE 3FLIA 4LNWA 2Q7LA 4OLMA 1PZLA 1QKUA 5JI0D 1ZDTA 3O1DA 3K22A 4G21A 5DMFA 4OK1A 1OVLA 2B1ZA 3PO9A 5E19A 3OS9A 5KCWA 4RE8A 3VHVA 2LBDA 1T7RA 4UDAA 2Q1HA 1OVLB 1G2NA 1QKTA 1ILHA 2GPOA 2AAXA 1M7WA 2I0GA 2HB8A 5DXKA 4WVDA 1I37A 5EHJA 2ZK6A 3VT8A 3W0GA 3ADWA 1XB7A 3WWRA 2GTKA 3WT6A 2ZBSA 3AUNA 3CLDA 2PIQA 3V4AA 2QABA 4R6SA 5DRMA 2YFEA 3X31A 1MVCA 4JGVA 5GIDA 3OS8C 1QKNA 2QMVA 5EC9A 3MNPA 2ZXNA 4OZRE 4POHA 2IOGA 2PNUA 4REFA 4RUJA 5KRLA 2Q70A 3R5MA 4UDBA 2ATHA 2ZMJA 4FN9A 3BC5A 2G44A 3R8IA 3OKHA 3VHUA 3FALA 1Z95A 4IS8A 3ILZA 1FCZA 2ZNOA 4IWCA 1EXAA 1A28A 5DX3A 5GICA 2XKWA 4DORA 3FALB 2BAWA 5AWKA 1I7GA 3OOFA 3SP6A 5DX3B 2ACLA 3HZFA 3ET2A 3P88A 4OKXA 2PIXA 3R29A 5DZIA 5DTVA 2YJDA 2AYRA 3AZ3A 3TKMA 3WJ4A 4DM8A 4ZI1A 4ZN7A 5DXRA 1U3RA 1YYEA 2QR9A 4CI5A 5ETHA 2ZK3A 5DP0A 2AX6A 3WFGA 5KR9A 1UOMA 4J5WA 1PCGA 2Q3YA 4J5XC 2OVMA 5DWEA 1ZEOA 5DXBB 2P54A 4ITFA 4ZJWA 5DVCA 5DIEA 5K13A 5KD9A 1XP1A 5AK2A 4N8RA 5B5BA 4M8EA 3A2JA 2OZ7A 2YLQA 2HASA 3KDUA 1UPVA 3ADSA 4OHAA 2Q59A 2QE4A 3GYTA 4XTAA 5DZ0A 3WTQA 1XQ3A 4G20A 3A2HA 2GL8A 4WLBA 4XT9A 5DYDA 4MGDA 5DXGA 3OMPA 1Y0XX 1NQ1A 3L0JA 3TKCA 3VJTA 4MGDB 1NAXA 2Q61A 1UPWA 1RKHA 5G43A 3OLLA 1N4HA 2PIWA 1ZDUA 1FM6A 5G5WA 4JYHA 2JF9A 3G8IA 1A52A 5DK9A 1T76A 4RZGA 3DR1A 2Q60A 1ZGYA 2VV3A 4PXMA 4RZEA 4IA2A 4MG8A 4G2HA 1NRLA 3V49A 2POGA 3F7DA 2P1VA 1X78A 5EGVA 3W0AA 3D5FA 4MG8B 2R40D 4BCRA 3OS8A 4NY9A 4B7WA 4E4KA 3V9TA 3TY0A 3ET3A 2ZK2A 4EMAA 2HWRA 5DYBA 3OMOA 4RMCA 4FNEA 3RLLA 4ZJRA 2AA6A 5G42A 3FC6B 1RDTD 1S0XA 3L1BA 3OSWA 1M13A 4ONIA 4PRGA 1NHZA 3ZQTA 3NOAA 3V9VA 1PDUA 4MGAB 3B1MA 5DWIA 5IAWA 2B1VA 3LBDA 4QM0A 4ZNHA 3B65A 4YPQA 1XV9A 2HC4A 1I38A 2QA8B 2Q6RA 3VRWA 1XV9B 3B66A 3BEJA 4IWFA 1E3KA 4ITEA 4J5XA 2PIUA 2IHQA 2Q7KA 4NUFA 3UUDB 5KCDA 5DRJA 3B5RA 4QK4A 1I7IA 4E2JA 4X1GA 1IE8A 3CDSA 4MG5A 2BJ4A 2FSZA 3R2AA 5AZTA 3X1HA 5AAUA 2PIOA 1FCXA 3V3QA 1YOWA 2P7AA 3B3KA 5AWJA 2IOKA 4PLDA 1NUOA 1XZXX 5DV6A 3VT3A 3DCUA 5HCVA 5KRAA 3HQ5A 3VSOA 3FXVA 5G44A 2ZLCA 3VTCA 3GWXA 1T65A 4PP3A 3EYBA 4DOSA 1FBYA 1DKFA 2H77A 5HYRA 5DXPA 5E1CA 3UUAA 1KKQA 4N1YA 4OEYA 1T7TA 5CJ6A 5DI7A 2NV7A 1T7MA 3L0EA 3UUAB 1YMTA 2XYWA 2Q5GA 2YHDA 1QKMA 2P1TA 4P6WA 4XI3A 5E7VA 2QZOA 5FQPA 4N73A 2G5OA 2XHSA 3BQDA 3G0WA 1NQ2A 3V9YA 3G8OA 4XUHA 2QZOB 3AZ2A 2AM9A 1S19A 3NSPA 5FQSA 1FCYA 3NSQA 2AA5A 1OSHA 3HC5A 3WT5A 2I4JA 2F4BA 3OSAA 1ZAFA 3OMQA 2AWHA 5KRFA 3DZYD 2XYXA 4XAOA 5DL4A 3RUTA 3W0IA 3P89A 4R2UA 3A40X 1S9QA 3PLZA 2QSEA 2Z4BA 4UDDA 1XLSA 2YJAB 2ZFXA 3ADVA 2P7ZA 3VT9A 1OSVA 2REWA 1SR7A 2ZNPA 3IPUA 3R8AA 3UUCA 5KCEA 2NW4A 3ZRAA 1SKXA 3A78A 4PPSA 2QW4A 4RMEA 4YT1A 2JJ3A 4OZTE 3D6DA 3VJIA 4DK8A 1ZH7A 2GWXA 2P4YA 4RZFA 2PRGA 1T7FA 2ZXMA 2VV2A 4OKTA 3R8DA 3UU7A 2PIRA 4J24A 4PP6A 2A3IA 5DY8A 2HB7A 2PKLA 2Q8SA 4JYGA 4ZOMA 2EWPA 4UDCA 2ACLB 5I4VA 3H52A 1R20D 1RKGA 4YMQA 2O4JA 5HYKA 1S0ZA 5DIDA 3L0LA 4NIEA 3M7RA 1T74A 2V7CA 2J7YA 3HC6A 4J26A 4KZIA 4OGHA 5DXQA 2JFAA 1K4WA 4TV1A 4A4WA 2O4RA 4IQRA 2W8YA 4S0SA 3IA6A 5DKBA 5GIEA 1GS4A 3HLVA 1XQCA 3MNOA 4HLWA 4OILA 5KCFA 1P8DA 2ZK1A 2AMBA 2FVJA 5FQRA 5DWGA 3AUQA 5DKEA 3ADTA 4X1FA 5DKSA 1ILGA 3V3EA 1M2ZA 2Q59B 5IXKA 1UHLA 1T5ZA 1VJBA 4OEAA 5SYZA 5HZCA 1FM9D 3E7CA 3W5TA 4E4QA 5L7GA 3PRGA 1MZNA 1UHLB 1N83A 1R1KD 1Z5XU 5DMCA 3SP9A 1G50A 3UP3A 3VT4A 3X36A 2OCFA 3D24A 3JZCA 1Q4XA 3ET0A 3F5CA 3LMPA 5ACCA 3S9SA 3VT5A 3RUUA 2OVHA 3N00A 4LSJA 4ZNSA 1X7RA 2OUZA 2ZASA 4DQMA 1YINA 2ZK4A 4IV2A 4ZNVA 2AA2A 3A9EA 3L03A 4S0TA 2AA7A 3IXPD 3CDPA 5DZHA 3A9EB 3ADUA 3P8XA 4LTWA 3WFFA 2YLPA 3OMMA 5AAVA 3VRVA 2VSTA 3TX7B 4RAKA 5DIGA 4G1ZA 2J4AA 3VT7A 2ZY0A 1HJ1A 4DMAA 2YATA 3B0WA 4OJBA 1XP9A 4OFUA 2VV4A 2Q5SA 4WQPA 5L11A 2P15A 4PLEA 3GBKA 4IA1A 3G9EA 5AZVA 4G1YA 2VV4B 1FD0A 4OZRU 2ZLAA 3E94A 5JJMA 5DU5A 4OEDA 1TFCA 4OEZA 2Q1VA 4IUIA 4XLDA 4YNKA 5DV3A 3GWSX 1U9EA 5JJMB 3AX8A 1T73A 3B0RA 1OT7A
chains in the Genus database with same CATH topology
3B67A 3CJWA 4JYIA 4Q0AC 2ZMIA 3A3ZX 5DVVA 3H0AD 5AYGA 2NPAA 2BJ4B 4OJ4A 3GD2A 3WJ5A 1LBDA 1LV2A 3K23A 2Z4JA 2H79A 2QXMA 1XOWA 3KDTA 3KYTA 3OGTA 4K7AA 4N5GA 5G46A 5EITA 4ZNUA 4APUA 3CS4A 4WHGA 3UP0A 4JL4A 3JZBA 4OARA 5EJVA 4MGCA 4OKWA 3WGPA 5DLRA 3IPQA 4LNXA 3E00D 3CS8A 4A2JA 3OOKA 4L96A 1EREA 3DT3A 1DKFB 4M8HA 4MGBA 2QGWA 4IVWA 4CSJA 1R1KA 2POBA 5APJA 3ZR7A 4PP5A 3UVVA 3FS1A 1RK3A 5M96A 4OJ9A 4JAZA 2G0HA 5JY3A 2FAIA 3UVVB 3FEIA 2QTUA 4TUZA 1XDKA 4RFWA 3MNEA 3KWYA 1R6GA 2Q7JA 2PINA 1YP0A 5FQVA 4QE8A 4IA3A 4WPFA 1XDKB 3PEQA 4J5WC 1YA3A 4L98A 2HFPA 2R40A 1XVPA 4OC7A 5C4SA 4OH5A 3VTBA 2HVCA 2AX9A 1L2IA 1PRGA 4PWLA 3W5PA 2VV1A 5DZ1A 4OIVA 1S9PA 1XJ7A 2XYJA 4MDDA 4POJA 2Q6JA 1PQ9A 2G0GA 2VV1B 1FM6D 1X7BA 2Q5PA 3CTBA 4KZJA 3B0TA 4LBDA 2ZK0A 3W0JA 4ZNTA 1TXIA 4S14A 4FHIA 5AVLA 1G1UA 1RDTA 3SZ1A 3DZUD 3X1IA 1WM0X 2ZNNA 3KBAA 4MG6A 5KCUA 1G5YA 4FHHA 1SQNA 4IVYA 5DXEA 3R5NA 5DVSA 1NQ7A 1KV6A 4REEA 3VT6A 4IW8A 1R5KA 3FUGA 5F9BA 3WMHA 3W0CA 5KCCA 2ZKCA 5KRMA 4PPPA 2E2RA 4Q50A 4HEEX 3UU7B 2Q6SA 2V0VA 3KMRA 5C4TA 3H0AA 3OLSA 4OH6A 1GWQA 3CWDA 4FGYA 2ZNQA 2AB2A 3IPSA 3VSPA 5DWLA 2PJLA 1N46A 3P0UA 5APKA 4MG9A 5A86A 1EXXA 1PQCA 2JFAB 1XNXA 3D90A 4MG9B 4ZNWA 5E14A 4TV1B 3A2IA 2GP7A 3DZUA 4NB6A 1ERRA 4OKBA 2R6YA 3D57A 5HJPA 2HBHA 3U9QA 5L7EA 3E00A 3RY9A 1U3SA 4S15A 2HARA 5HJPB 3W0YA 4G1DA 1XIUA 2GIUA 4P6XA 1X7EA 1K74D 3VRTA 4DK7A 1XP6A 5H1EA 5IZ0A 3ADXA 2NXXE 2GPPA 3T03A 5DXBA 5KYAA 4DM6A 3VRUA 4EM9A 5DUEA 3L3XA 4XUMA 1BSXA 5B41A 5EI1A 3ET1A 4G2IA 2HWQA 2YLOA 4QJRA 2AO6A 2P1UA 3F5CB 1KNUA 3OSIA 1HG4A 5ICKA 1Y0SA 5L7HA 5DXMA 1NYXA 2QA6A 5E0XA 3OZ0A 3GYUA 3OZJA 5C4UA 4MG7A 4IU7A 1K7LA 3PBAA 1NQ0A 5E0WA 3WT7A 3CQVA 5KRJA 2ZMHA 5G3JA 1MV9A 4MG7B 3HM1A 4XHDA 4F9MA 1PK5A 3DZYA 1YY4A 3GN8A 3RLJA 1PQ6A 5DUHA 1YOKA 5AAVB 2AMAA 3K8SA 5KRKA 1YJEA 2ZVTA 3VI8A 5HJSA 1ZKYA 1ZUCA 3B0QA 3CS6A 4NQAB 2I4PA 2NXXA 1RJKA 3ERTA 3HODA 1XPCA 1YIMA 2OAXA 3FURA 3HO0A 3KMGA 5DZ3A 3OMKA 5DWJA 1NAVA 3O1EA 3Q95A 3AFRA 5GT4A 2QNVA 4RUPA 1GWRA 2HAMA 3DY6A 5C4OA 1H9UA 2OM9A 3Q95B 1GWXA 2B23A 5DSHA 3W0HA 2PITA 4OZTU 4CI4A 4PVUA 3DCTA 1DB1A 3PCUA 2J14A 4O8FA 4ZO1B 2QH6A 5KYJA 3ERDA 1X76A 2AXAA 1IE9A 1R20A 2HCDA 3FC6A 3IMYA 5KRIA 1XAPA 2GPUA 3K6PA 2QGTA 5AVIA 4IA7A 3W5QA 3L3ZA 4MGAA 4RUOX 2VSRA 4RWVA 2YLYA 2R6WA 5G45A 4OIUA 3VJSA 3B68A 2ZL9A 5APHA 2QA8A 3KFCA 1SJ0A 5E15A 2P7GA 3OLFA 5DV8A 2QXSA 1L2JA 3VN2A 3UUDA 3VJHA 3OKIA 3W5RA 4A4VA 5KCTA 2I4ZA 2PIVA 2VV0A 3OAPA 4IV4A 4IW6A 4Q13A 3ZRBA 4QE6A 4K6IA 5FQTA 1NDEA 2Q7IA 1T63A 4RMDA 3QT0A 5DUGA 1FM9A 3GZ9A 4ZN9A 4R06A 1K74A 4OFRA 4MGBB 1Y9RA 1X7JA 2I0JA 4K4JA 2ABIA 4PF3A 1E3GA 1P93A 1YUCA 3VHWA 4Y29A 2J7XA 3AURA 5KROA 2ZXZA 2B50A 3AZ1A 4KZMA 1XNNA 1U3QA 2AX8A 2ZK5A 1T79A 2AX7A 3AN4A 2GPVA 3FEJA 4TUZB 2PIPL 4QL8A 3HVLA 5LWPA 4WHFA 3KMZA 1Z5XE 2O9IA 3IXPA 4ZO1X 5DKGA 3VTDA 2QPYA 3AN3A 3KPZA 3RVFA 5KRCA 1XVPB 5KRHA 5LGAA 1XLSE 3FLIA 4LNWA 2Q7LA 4OLMA 1PZLA 1QKUA 5JI0D 1ZDTA 3O1DA 3K22A 4G21A 5DMFA 4OK1A 1OVLA 2B1ZA 3PO9A 5E19A 3OS9A 5KCWA 4RE8A 3VHVA 2LBDA 1T7RA 4UDAA 2Q1HA 1OVLB 1G2NA 1QKTA 1ILHA 2GPOA 2AAXA 1M7WA 2I0GA 2HB8A 5DXKA 4WVDA 1I37A 5EHJA 2ZK6A 3VT8A 3W0GA 3ADWA 1XB7A 3WWRA 2GTKA 3WT6A 2ZBSA 3AUNA 3CLDA 2PIQA 3V4AA 2QABA 4R6SA 5DRMA 2YFEA 3X31A 1MVCA 4JGVA 5GIDA 3OS8C 1QKNA 2QMVA 5EC9A 3MNPA 2ZXNA 4OZRE 4POHA 2IOGA 2PNUA 4REFA 4RUJA 5KRLA 2Q70A 3R5MA 4UDBA 2ATHA 2ZMJA 4FN9A 3BC5A 2G44A 3R8IA 3OKHA 3VHUA 3FALA 1Z95A 4IS8A 3ILZA 1FCZA 2ZNOA 4IWCA 1EXAA 1A28A 5DX3A 5GICA 2XKWA 4DORA 3FALB 2BAWA 5AWKA 1I7GA 3OOFA 3SP6A 5DX3B 2ACLA 3HZFA 3ET2A 3P88A 4OKXA 2PIXA 3R29A 5DZIA 5DTVA 2YJDA 2AYRA 3AZ3A 3TKMA 3WJ4A 4DM8A 4ZI1A 4ZN7A 5DXRA 1U3RA 1YYEA 2QR9A 4CI5A 5ETHA 2ZK3A 5DP0A 2AX6A 3WFGA 5KR9A 1UOMA 4J5WA 1PCGA 2Q3YA 4J5XC 2OVMA 5DWEA 1ZEOA 5DXBB 2P54A 4ITFA 4ZJWA 5DVCA 5DIEA 5K13A 5KD9A 1XP1A 5AK2A 4N8RA 5B5BA 4M8EA 3A2JA 2OZ7A 2YLQA 2HASA 3KDUA 1UPVA 3ADSA 4OHAA 2Q59A 2QE4A 3GYTA 4XTAA 5DZ0A 3WTQA 1XQ3A 4G20A 3A2HA 2GL8A 4WLBA 4XT9A 5DYDA 4MGDA 5DXGA 3OMPA 1Y0XX 1NQ1A 3L0JA 3TKCA 3VJTA 4MGDB 1NAXA 2Q61A 1UPWA 1RKHA 5G43A 3OLLA 1N4HA 2PIWA 1ZDUA 1FM6A 5G5WA 4JYHA 2JF9A 3G8IA 1A52A 5DK9A 1T76A 4RZGA 3DR1A 2Q60A 1ZGYA 2VV3A 4PXMA 4RZEA 4IA2A 4MG8A 4G2HA 1NRLA 3V49A 2POGA 3F7DA 2P1VA 1X78A 5EGVA 3W0AA 3D5FA 4MG8B 2R40D 4BCRA 3OS8A 4NY9A 4B7WA 4E4KA 3V9TA 3TY0A 3ET3A 2ZK2A 4EMAA 2HWRA 5DYBA 3OMOA 4RMCA 4FNEA 3RLLA 4ZJRA 2AA6A 5G42A 3FC6B 1RDTD 1S0XA 3L1BA 3OSWA 1M13A 4ONIA 4PRGA 1NHZA 3ZQTA 3NOAA 3V9VA 1PDUA 4MGAB 3B1MA 5DWIA 5IAWA 2B1VA 3LBDA 4QM0A 4ZNHA 3B65A 4YPQA 1XV9A 2HC4A 1I38A 2QA8B 2Q6RA 3VRWA 1XV9B 3B66A 3BEJA 4IWFA 1E3KA 4ITEA 4J5XA 2PIUA 2IHQA 2Q7KA 4NUFA 3UUDB 5KCDA 5DRJA 3B5RA 4QK4A 1I7IA 4E2JA 4X1GA 1IE8A 3CDSA 4MG5A 2BJ4A 2FSZA 3R2AA 5AZTA 3X1HA 5AAUA 2PIOA 1FCXA 3V3QA 1YOWA 2P7AA 3B3KA 5AWJA 2IOKA 4PLDA 1NUOA 1XZXX 5DV6A 3VT3A 3DCUA 5HCVA 5KRAA 3HQ5A 3VSOA 3FXVA 5G44A 2ZLCA 3VTCA 3GWXA 1T65A 4PP3A 3EYBA 4DOSA 1FBYA 1DKFA 2H77A 5HYRA 5DXPA 5E1CA 3UUAA 1KKQA 4N1YA 4OEYA 1T7TA 5CJ6A 5DI7A 2NV7A 1T7MA 3L0EA 3UUAB 1YMTA 2XYWA 2Q5GA 2YHDA 1QKMA 2P1TA 4P6WA 4XI3A 5E7VA 2QZOA 5FQPA 4N73A 2G5OA 2XHSA 3BQDA 3G0WA 1NQ2A 3V9YA 3G8OA 4XUHA 2QZOB 3AZ2A 2AM9A 1S19A 3NSPA 5FQSA 1FCYA 3NSQA 2AA5A 1OSHA 3HC5A 3WT5A 2I4JA 2F4BA 3OSAA 1ZAFA 3OMQA 2AWHA 5KRFA 3DZYD 2XYXA 4XAOA 5DL4A 3RUTA 3W0IA 3P89A 4R2UA 3A40X 1S9QA 3PLZA 2QSEA 2Z4BA 4UDDA 1XLSA 2YJAB 2ZFXA 3ADVA 2P7ZA 3VT9A 1OSVA 2REWA 1SR7A 2ZNPA 3IPUA 3R8AA 3UUCA 5KCEA 2NW4A 3ZRAA 1SKXA 3A78A 4PPSA 2QW4A 4RMEA 4YT1A 2JJ3A 4OZTE 3D6DA 3VJIA 4DK8A 1ZH7A 2GWXA 2P4YA 4RZFA 2PRGA 1T7FA 2ZXMA 2VV2A 4OKTA 3R8DA 3UU7A 2PIRA 4J24A 4PP6A 2A3IA 5DY8A 2HB7A 2PKLA 2Q8SA 4JYGA 4ZOMA 2EWPA 4UDCA 2ACLB 5I4VA 3H52A 1R20D 1RKGA 4YMQA 2O4JA 5HYKA 1S0ZA 5DIDA 3L0LA 4NIEA 3M7RA 1T74A 2V7CA 2J7YA 3HC6A 4J26A 4KZIA 4OGHA 5DXQA 2JFAA 1K4WA 4TV1A 4A4WA 2O4RA 4IQRA 2W8YA 4S0SA 3IA6A 5DKBA 5GIEA 1GS4A 3HLVA 1XQCA 3MNOA 4HLWA 4OILA 5KCFA 1P8DA 2ZK1A 2AMBA 2FVJA 5FQRA 5DWGA 3AUQA 5DKEA 3ADTA 4X1FA 5DKSA 1ILGA 3V3EA 1M2ZA 2Q59B 5IXKA 1UHLA 1T5ZA 1VJBA 4OEAA 5SYZA 5HZCA 1FM9D 3E7CA 3W5TA 4E4QA 5L7GA 3PRGA 1MZNA 1UHLB 1N83A 1R1KD 1Z5XU 5DMCA 3SP9A 1G50A 3UP3A 3VT4A 3X36A 2OCFA 3D24A 3JZCA 1Q4XA 3ET0A 3F5CA 3LMPA 5ACCA 3S9SA 3VT5A 3RUUA 2OVHA 3N00A 4LSJA 4ZNSA 1X7RA 2OUZA 2ZASA 4DQMA 1YINA 2ZK4A 4IV2A 4ZNVA 2AA2A 3A9EA 3L03A 4S0TA 2AA7A 3IXPD 3CDPA 5DZHA 3A9EB 3ADUA 3P8XA 4LTWA 3WFFA 2YLPA 3OMMA 5AAVA 3VRVA 2VSTA 3TX7B 4RAKA 5DIGA 4G1ZA 2J4AA 3VT7A 2ZY0A 1HJ1A 4DMAA 2YATA 3B0WA 4OJBA 1XP9A 4OFUA 2VV4A 2Q5SA 4WQPA 5L11A 2P15A 4PLEA 3GBKA 4IA1A 3G9EA 5AZVA 4G1YA 2VV4B 1FD0A 4OZRU 2ZLAA 3E94A 5JJMA 5DU5A 4OEDA 1TFCA 4OEZA 2Q1VA 4IUIA 4XLDA 4YNKA 5DV3A 3GWSX 1U9EA 5JJMB 3AX8A 1T73A 3B0RA 1OT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B67 A;  3CJW A;  4JYI A;  4Q0A C;  2ZMI A;  3A3Z X;  5DVV A;  3H0A D;  5AYG A;  2NPA A;  2BJ4 B;  4OJ4 A;  3GD2 A;  3WJ5 A;  1LBD A;  1LV2 A;  3K23 A;  2Z4J A;  2H79 A;  2QXM A;  1XOW A;  3KDT A;  3KYT A;  3OGT A;  4K7A A;  4N5G A;  5G46 A;  5EIT A;  4ZNU A;  4APU A;  3CS4 A;  4WHG A;  3UP0 A;  4JL4 A;  3JZB A;  4OAR A;  5EJV A;  4MGC A;  4OKW A;  3WGP A;  5DLR A;  3IPQ A;  4LNX A;  3E00 D;  3CS8 A;  4A2J A;  3OOK A;  4L96 A;  1ERE A;  3DT3 A;  1DKF B;  4M8H A;  4MGB A;  2QGW A;  4IVW A;  4CSJ A;  1R1K A;  2POB A;  5APJ A;  3ZR7 A;  4PP5 A;  3UVV A;  3FS1 A;  1RK3 A;  5M96 A;  4OJ9 A;  4JAZ A;  2G0H A;  5JY3 A;  2FAI A;  3UVV B;  3FEI A;  2QTU A;  4TUZ A;  1XDK A;  4RFW A;  3MNE A;  3KWY A;  1R6G A;  2Q7J A;  2PIN A;  1YP0 A;  5FQV A;  4QE8 A;  4IA3 A;  4WPF A;  1XDK B;  3PEQ A;  4J5W C;  1YA3 A;  4L98 A;  2HFP A;  2R40 A;  1XVP A;  4OC7 A;  5C4S A;  4OH5 A;  3VTB A;  2HVC A;  2AX9 A;  1L2I A;  1PRG A;  4PWL A;  3W5P A;  2VV1 A;  5DZ1 A;  4OIV A;  1S9P A;  1XJ7 A;  2XYJ A;  4MDD A;  4POJ A;  2Q6J A;  1PQ9 A;  2G0G A;  2VV1 B;  1FM6 D;  1X7B A;  2Q5P A;  3CTB A;  4KZJ A;  3B0T A;  4LBD A;  2ZK0 A;  3W0J A;  4ZNT A;  1TXI A;  4S14 A;  4FHI A;  5AVL A;  1G1U A;  1RDT A;  3SZ1 A;  3DZU D;  3X1I A;  1WM0 X;  2ZNN A;  3KBA A;  4MG6 A;  5KCU A;  1G5Y A;  4FHH A;  1SQN A;  4IVY A;  5DXE A;  3R5N A;  5DVS A;  1NQ7 A;  1KV6 A;  4REE A;  3VT6 A;  4IW8 A;  1R5K A;  3FUG A;  5F9B A;  3WMH A;  3W0C A;  5KCC A;  2ZKC A;  5KRM A;  4PPP A;  2E2R A;  4Q50 A;  4HEE X;  3UU7 B;  2Q6S A;  2V0V A;  3KMR A;  5C4T A;  3H0A A;  3OLS A;  4OH6 A;  1GWQ A;  3CWD A;  4FGY A;  2ZNQ A;  2AB2 A;  3IPS A;  3VSP A;  5DWL A;  2PJL A;  1N46 A;  3P0U A;  5APK A;  4MG9 A;  5A86 A;  1EXX A;  1PQC A;  2JFA B;  1XNX A;  3D90 A;  4MG9 B;  4ZNW A;  5E14 A;  4TV1 B;  3A2I A;  2GP7 A;  3DZU A;  4NB6 A;  1ERR A;  4OKB A;  2R6Y A;  3D57 A;  5HJP A;  2HBH A;  3U9Q A;  5L7E A;  3E00 A;  3RY9 A;  1U3S A;  4S15 A;  2HAR A;  5HJP B;  3W0Y A;  4G1D A;  1XIU A;  2GIU A;  4P6X A;  1X7E A;  1K74 D;  3VRT A;  4DK7 A;  1XP6 A;  5H1E A;  5IZ0 A;  3ADX A;  2NXX E;  2GPP A;  3T03 A;  5DXB A;  5KYA A;  4DM6 A;  3VRU A;  4EM9 A;  5DUE A;  3L3X A;  4XUM A;  1BSX A;  5B41 A;  5EI1 A;  3ET1 A;  4G2I A;  2HWQ A;  2YLO A;  4QJR A;  2AO6 A;  2P1U A;  3F5C B;  1KNU A;  3OSI A;  1HG4 A;  5ICK A;  1Y0S A;  5L7H A;  5DXM A;  1NYX A;  2QA6 A;  5E0X A;  3OZ0 A;  3GYU A;  3OZJ A;  5C4U A;  4MG7 A;  4IU7 A;  1K7L A;  3PBA A;  1NQ0 A;  5E0W A;  3WT7 A;  3CQV A;  5KRJ A;  2ZMH A;  5G3J A;  1MV9 A;  4MG7 B;  3HM1 A;  4XHD A;  4F9M A;  1PK5 A;  3DZY A;  1YY4 A;  3GN8 A;  3RLJ A;  1PQ6 A;  5DUH A;  1YOK A;  5AAV B;  2AMA A;  3K8S A;  5KRK A;  1YJE A;  2ZVT A;  3VI8 A;  5HJS A;  1ZKY A;  1ZUC A;  3B0Q A;  3CS6 A;  4NQA B;  2I4P A;  2NXX A;  1RJK A;  3ERT A;  3HOD A;  1XPC A;  1YIM A;  2OAX A;  3FUR A;  3HO0 A;  3KMG A;  5DZ3 A;  3OMK A;  5DWJ A;  1NAV A;  3O1E A;  3Q95 A;  3AFR A;  5GT4 A;  2QNV A;  4RUP A;  1GWR A;  2HAM A;  3DY6 A;  5C4O A;  1H9U A;  2OM9 A;  3Q95 B;  1GWX A;  2B23 A;  5DSH A;  3W0H A;  2PIT A;  4OZT U;  4CI4 A;  4PVU A;  3DCT A;  1DB1 A;  3PCU A;  2J14 A;  4O8F A;  4ZO1 B;  2QH6 A;  5KYJ A;  3ERD A;  1X76 A;  2AXA A;  1IE9 A;  1R20 A;  2HCD A;  3FC6 A;  3IMY A;  5KRI A;  1XAP A;  2GPU A;  3K6P A;  2QGT A;  5AVI A;  4IA7 A;  3W5Q A;  3L3Z A;  4MGA A;  4RUO X;  2VSR A;  4RWV A;  2YLY A;  2R6W A;  5G45 A;  4OIU A;  3VJS A;  3B68 A;  2ZL9 A;  5APH A;  2QA8 A;  3KFC A;  1SJ0 A;  5E15 A;  2P7G A;  3OLF A;  5DV8 A;  2QXS A;  1L2J A;  3VN2 A;  3UUD A;  3VJH A;  3OKI A;  3W5R A;  4A4V A;  5KCT A;  2I4Z A;  2PIV A;  2VV0 A;  3OAP A;  4IV4 A;  4IW6 A;  4Q13 A;  3ZRB A;  4QE6 A;  4K6I A;  5FQT A;  1NDE A;  2Q7I A;  1T63 A;  4RMD A;  3QT0 A;  5DUG A;  1FM9 A;  3GZ9 A;  4ZN9 A;  4R06 A;  1K74 A;  4OFR A;  4MGB B;  1Y9R A;  1X7J A;  2I0J A;  4K4J A;  2ABI A;  4PF3 A;  1E3G A;  1P93 A;  1YUC A;  3VHW A;  4Y29 A;  2J7X A;  3AUR A;  5KRO A;  2ZXZ A;  2B50 A;  3AZ1 A;  4KZM A;  1XNN A;  1U3Q A;  2AX8 A;  2ZK5 A;  1T79 A;  2AX7 A;  3AN4 A;  2GPV A;  3FEJ A;  4TUZ B;  2PIP L;  4QL8 A;  3HVL A;  5LWP A;  4WHF A;  3KMZ A;  1Z5X E;  2O9I A;  3IXP A;  4ZO1 X;  5DKG A;  3VTD A;  2QPY A;  3AN3 A;  3KPZ A;  3RVF A;  5KRC A;  1XVP B;  5KRH A;  5LGA A;  1XLS E;  3FLI A;  4LNW A;  2Q7L A;  4OLM A;  1PZL A;  1QKU A;  5JI0 D;  1ZDT A;  3O1D A;  3K22 A;  4G21 A;  5DMF A;  4OK1 A;  1OVL A;  2B1Z A;  3PO9 A;  5E19 A;  3OS9 A;  5KCW A;  4RE8 A;  3VHV A;  2LBD A;  1T7R A;  4UDA A;  2Q1H A;  1OVL B;  1G2N A;  1QKT A;  1ILH A;  2GPO A;  2AAX A;  1M7W A;  2I0G A;  2HB8 A;  5DXK A;  4WVD A;  1I37 A;  5EHJ A;  2ZK6 A;  3VT8 A;  3W0G A;  3ADW A;  1XB7 A;  3WWR A;  2GTK A;  3WT6 A;  2ZBS A;  3AUN A;  3CLD A;  2PIQ A;  3V4A A;  2QAB A;  4R6S A;  5DRM A;  2YFE A;  3X31 A;  1MVC A;  4JGV A;  5GID A;  3OS8 C;  1QKN A;  2QMV A;  5EC9 A;  3MNP A;  2ZXN A;  4OZR E;  4POH A;  2IOG A;  2PNU A;  4REF A;  4RUJ A;  5KRL A;  2Q70 A;  3R5M A;  4UDB A;  2ATH A;  2ZMJ A;  4FN9 A;  3BC5 A;  2G44 A;  3R8I A;  3OKH A;  3VHU A;  3FAL A;  1Z95 A;  4IS8 A;  3ILZ A;  1FCZ A;  2ZNO A;  4IWC A;  1EXA A;  1A28 A;  5DX3 A;  5GIC A;  2XKW A;  4DOR A;  3FAL B;  2BAW A;  5AWK A;  1I7G A;  3OOF A;  3SP6 A;  5DX3 B;  2ACL A;  3HZF A;  3ET2 A;  3P88 A;  4OKX A;  2PIX A;  3R29 A;  5DZI A;  5DTV A;  2YJD A;  2AYR A;  3AZ3 A;  3TKM A;  3WJ4 A;  4DM8 A;  4ZI1 A;  4ZN7 A;  5DXR A;  1U3R A;  1YYE A;  2QR9 A;  4CI5 A;  5ETH A;  2ZK3 A;  5DP0 A;  2AX6 A;  3WFG A;  5KR9 A;  1UOM A;  4J5W A;  1PCG A;  2Q3Y A;  4J5X C;  2OVM A;  5DWE A;  1ZEO A;  5DXB B;  2P54 A;  4ITF A;  4ZJW A;  5DVC A;  5DIE A;  5K13 A;  5KD9 A;  1XP1 A;  5AK2 A;  4N8R A;  5B5B A;  4M8E A;  3A2J A;  2OZ7 A;  2YLQ A;  2HAS A;  3KDU A;  1UPV A;  3ADS A;  4OHA A;  2Q59 A;  2QE4 A;  3GYT A;  4XTA A;  5DZ0 A;  3WTQ A;  1XQ3 A;  4G20 A;  3A2H A;  2GL8 A;  4WLB A;  4XT9 A;  5DYD A;  4MGD A;  5DXG A;  3OMP A;  1Y0X X;  1NQ1 A;  3L0J A;  3TKC A;  3VJT A;  4MGD B;  1NAX A;  2Q61 A;  1UPW A;  1RKH A;  5G43 A;  3OLL A;  1N4H A;  2PIW A;  1ZDU A;  1FM6 A;  5G5W A;  4JYH A;  2JF9 A;  3G8I A;  1A52 A;  5DK9 A;  1T76 A;  4RZG A;  3DR1 A;  2Q60 A;  1ZGY A;  2VV3 A;  4PXM A;  4RZE A;  4IA2 A;  4MG8 A;  4G2H A;  1NRL A;  3V49 A;  2POG A;  3F7D A;  2P1V A;  1X78 A;  5EGV A;  3W0A A;  3D5F A;  4MG8 B;  2R40 D;  4BCR A;  3OS8 A;  4NY9 A;  4B7W A;  4E4K A;  3V9T A;  3TY0 A;  3ET3 A;  2ZK2 A;  4EMA A;  2HWR A;  5DYB A;  3OMO A;  4RMC A;  4FNE A;  3RLL A;  4ZJR A;  2AA6 A;  5G42 A;  3FC6 B;  1RDT D;  1S0X A;  3L1B A;  3OSW A;  1M13 A;  4ONI A;  4PRG A;  1NHZ A;  3ZQT A;  3NOA A;  3V9V A;  1PDU A;  4MGA B;  3B1M A;  5DWI A;  5IAW A;  2B1V A;  3LBD A;  4QM0 A;  4ZNH A;  3B65 A;  4YPQ A;  1XV9 A;  2HC4 A;  1I38 A;  2QA8 B;  2Q6R A;  3VRW A;  1XV9 B;  3B66 A;  3BEJ A;  4IWF A;  1E3K A;  4ITE A;  4J5X A;  2PIU A;  2IHQ A;  2Q7K A;  4NUF A;  3UUD B;  5KCD A;  5DRJ A;  3B5R A;  4QK4 A;  1I7I A;  4E2J A;  4X1G A;  1IE8 A;  3CDS A;  4MG5 A;  2BJ4 A;  2FSZ A;  3R2A A;  5AZT A;  3X1H A;  5AAU A;  2PIO A;  1FCX A;  3V3Q A;  1YOW A;  2P7A A;  3B3K A;  5AWJ A;  2IOK A;  4PLD A;  1NUO A;  1XZX X;  5DV6 A;  3VT3 A;  3DCU A;  5HCV A;  5KRA A;  3HQ5 A;  3VSO A;  3FXV A;  5G44 A;  2ZLC A;  3VTC A;  3GWX A;  1T65 A;  4PP3 A;  3EYB A;  4DOS A;  1FBY A;  1DKF A;  2H77 A;  5HYR A;  5DXP A;  5E1C A;  3UUA A;  1KKQ A;  4N1Y A;  4OEY A;  1T7T A;  5CJ6 A;  5DI7 A;  2NV7 A;  1T7M A;  3L0E A;  3UUA B;  1YMT A;  2XYW A;  2Q5G A;  2YHD A;  1QKM A;  2P1T A;  4P6W A;  4XI3 A;  5E7V A;  2QZO A;  5FQP A;  4N73 A;  2G5O A;  2XHS A;  3BQD A;  3G0W A;  1NQ2 A;  3V9Y A;  3G8O A;  4XUH A;  2QZO B;  3AZ2 A;  2AM9 A;  1S19 A;  3NSP A;  5FQS A;  1FCY A;  3NSQ A;  2AA5 A;  1OSH A;  3HC5 A;  3WT5 A;  2I4J A;  2F4B A;  3OSA A;  1ZAF A;  3OMQ A;  2AWH A;  5KRF A;  3DZY D;  2XYX A;  4XAO A;  5DL4 A;  3RUT A;  3W0I A;  3P89 A;  4R2U A;  3A40 X;  1S9Q A;  3PLZ A;  2QSE A;  2Z4B A;  4UDD A;  1XLS A;  2YJA B;  2ZFX A;  3ADV A;  2P7Z A;  3VT9 A;  1OSV A;  2REW A;  1SR7 A;  2ZNP A;  3IPU A;  3R8A A;  3UUC A;  5KCE A;  2NW4 A;  3ZRA A;  1SKX A;  3A78 A;  4PPS A;  2QW4 A;  4RME A;  4YT1 A;  2JJ3 A;  4OZT E;  3D6D A;  3VJI A;  4DK8 A;  1ZH7 A;  2GWX A;  2P4Y A;  4RZF A;  2PRG A;  1T7F A;  2ZXM A;  2VV2 A;  4OKT A;  3R8D A;  3UU7 A;  2PIR A;  4J24 A;  4PP6 A;  2A3I A;  5DY8 A;  2HB7 A;  2PKL A;  2Q8S A;  4JYG A;  4ZOM A;  2EWP A;  4UDC A;  2ACL B;  5I4V A;  3H52 A;  1R20 D;  1RKG A;  4YMQ A;  2O4J A;  5HYK A;  1S0Z A;  5DID A;  3L0L A;  4NIE A;  3M7R A;  1T74 A;  2V7C A;  2J7Y A;  3HC6 A;  4J26 A;  4KZI A;  4OGH A;  5DXQ A;  2JFA A;  1K4W A;  4TV1 A;  4A4W A;  2O4R A;  4IQR A;  2W8Y A;  4S0S A;  3IA6 A;  5DKB A;  5GIE A;  1GS4 A;  3HLV A;  1XQC A;  3MNO A;  4HLW A;  4OIL A;  5KCF A;  1P8D A;  2ZK1 A;  2AMB A;  2FVJ A;  5FQR A;  5DWG A;  3AUQ A;  5DKE A;  3ADT A;  4X1F A;  5DKS A;  1ILG A;  3V3E A;  1M2Z A;  2Q59 B;  5IXK A;  1UHL A;  1T5Z A;  1VJB A;  4OEA A;  5SYZ A;  5HZC A;  1FM9 D;  3E7C A;  3W5T A;  4E4Q A;  5L7G A;  3PRG A;  1MZN A;  1UHL B;  1N83 A;  1R1K D;  1Z5X U;  5DMC A;  3SP9 A;  1G50 A;  3UP3 A;  3VT4 A;  3X36 A;  2OCF A;  3D24 A;  3JZC A;  1Q4X A;  3ET0 A;  3F5C A;  3LMP A;  5ACC A;  3S9S A;  3VT5 A;  3RUU A;  2OVH A;  3N00 A;  4LSJ A;  4ZNS A;  1X7R A;  2OUZ A;  2ZAS A;  4DQM A;  1YIN A;  2ZK4 A;  4IV2 A;  4ZNV A;  2AA2 A;  3A9E A;  3L03 A;  4S0T A;  2AA7 A;  3IXP D;  3CDP A;  5DZH A;  3A9E B;  3ADU A;  3P8X A;  4LTW A;  3WFF A;  2YLP A;  3OMM A;  5AAV A;  3VRV A;  2VST A;  3TX7 B;  4RAK A;  5DIG A;  4G1Z A;  2J4A A;  3VT7 A;  2ZY0 A;  1HJ1 A;  4DMA A;  2YAT A;  3B0W A;  4OJB A;  1XP9 A;  4OFU A;  2VV4 A;  2Q5S A;  4WQP A;  5L11 A;  2P15 A;  4PLE A;  3GBK A;  4IA1 A;  3G9E A;  5AZV A;  4G1Y A;  2VV4 B;  1FD0 A;  4OZR U;  2ZLA A;  3E94 A;  5JJM A;  5DU5 A;  4OED A;  1TFC A;  4OEZ A;  2Q1V A;  4IUI A;  4XLD A;  4YNK A;  5DV3 A;  3GWS X;  1U9E A;  5JJM B;  3AX8 A;  1T73 A;  3B0R A;  1OT7 A; 
#chains in the Genus database with same CATH topology
 3B67 A;  3CJW A;  4JYI A;  4Q0A C;  2ZMI A;  3A3Z X;  5DVV A;  3H0A D;  5AYG A;  2NPA A;  2BJ4 B;  4OJ4 A;  3GD2 A;  3WJ5 A;  1LBD A;  1LV2 A;  3K23 A;  2Z4J A;  2H79 A;  2QXM A;  1XOW A;  3KDT A;  3KYT A;  3OGT A;  4K7A A;  4N5G A;  5G46 A;  5EIT A;  4ZNU A;  4APU A;  3CS4 A;  4WHG A;  3UP0 A;  4JL4 A;  3JZB A;  4OAR A;  5EJV A;  4MGC A;  4OKW A;  3WGP A;  5DLR A;  3IPQ A;  4LNX A;  3E00 D;  3CS8 A;  4A2J A;  3OOK A;  4L96 A;  1ERE A;  3DT3 A;  1DKF B;  4M8H A;  4MGB A;  2QGW A;  4IVW A;  4CSJ A;  1R1K A;  2POB A;  5APJ A;  3ZR7 A;  4PP5 A;  3UVV A;  3FS1 A;  1RK3 A;  5M96 A;  4OJ9 A;  4JAZ A;  2G0H A;  5JY3 A;  2FAI A;  3UVV B;  3FEI A;  2QTU A;  4TUZ A;  1XDK A;  4RFW A;  3MNE A;  3KWY A;  1R6G A;  2Q7J A;  2PIN A;  1YP0 A;  5FQV A;  4QE8 A;  4IA3 A;  4WPF A;  1XDK B;  3PEQ A;  4J5W C;  1YA3 A;  4L98 A;  2HFP A;  2R40 A;  1XVP A;  4OC7 A;  5C4S A;  4OH5 A;  3VTB A;  2HVC A;  2AX9 A;  1L2I A;  1PRG A;  4PWL A;  3W5P A;  2VV1 A;  5DZ1 A;  4OIV A;  1S9P A;  1XJ7 A;  2XYJ A;  4MDD A;  4POJ A;  2Q6J A;  1PQ9 A;  2G0G A;  2VV1 B;  1FM6 D;  1X7B A;  2Q5P A;  3CTB A;  4KZJ A;  3B0T A;  4LBD A;  2ZK0 A;  3W0J A;  4ZNT A;  1TXI A;  4S14 A;  4FHI A;  5AVL A;  1G1U A;  1RDT A;  3SZ1 A;  3DZU D;  3X1I A;  1WM0 X;  2ZNN A;  3KBA A;  4MG6 A;  5KCU A;  1G5Y A;  4FHH A;  1SQN A;  4IVY A;  5DXE A;  3R5N A;  5DVS A;  1NQ7 A;  1KV6 A;  4REE A;  3VT6 A;  4IW8 A;  1R5K A;  3FUG A;  5F9B A;  3WMH A;  3W0C A;  5KCC A;  2ZKC A;  5KRM A;  4PPP A;  2E2R A;  4Q50 A;  4HEE X;  3UU7 B;  2Q6S A;  2V0V A;  3KMR A;  5C4T A;  3H0A A;  3OLS A;  4OH6 A;  1GWQ A;  3CWD A;  4FGY A;  2ZNQ A;  2AB2 A;  3IPS A;  3VSP A;  5DWL A;  2PJL A;  1N46 A;  3P0U A;  5APK A;  4MG9 A;  5A86 A;  1EXX A;  1PQC A;  2JFA B;  1XNX A;  3D90 A;  4MG9 B;  4ZNW A;  5E14 A;  4TV1 B;  3A2I A;  2GP7 A;  3DZU A;  4NB6 A;  1ERR A;  4OKB A;  2R6Y A;  3D57 A;  5HJP A;  2HBH A;  3U9Q A;  5L7E A;  3E00 A;  3RY9 A;  1U3S A;  4S15 A;  2HAR A;  5HJP B;  3W0Y A;  4G1D A;  1XIU A;  2GIU A;  4P6X A;  1X7E A;  1K74 D;  3VRT A;  4DK7 A;  1XP6 A;  5H1E A;  5IZ0 A;  3ADX A;  2NXX E;  2GPP A;  3T03 A;  5DXB A;  5KYA A;  4DM6 A;  3VRU A;  4EM9 A;  5DUE A;  3L3X A;  4XUM A;  1BSX A;  5B41 A;  5EI1 A;  3ET1 A;  4G2I A;  2HWQ A;  2YLO A;  4QJR A;  2AO6 A;  2P1U A;  3F5C B;  1KNU A;  3OSI A;  1HG4 A;  5ICK A;  1Y0S A;  5L7H A;  5DXM A;  1NYX A;  2QA6 A;  5E0X A;  3OZ0 A;  3GYU A;  3OZJ A;  5C4U A;  4MG7 A;  4IU7 A;  1K7L A;  3PBA A;  1NQ0 A;  5E0W A;  3WT7 A;  3CQV A;  5KRJ A;  2ZMH A;  5G3J A;  1MV9 A;  4MG7 B;  3HM1 A;  4XHD A;  4F9M A;  1PK5 A;  3DZY A;  1YY4 A;  3GN8 A;  3RLJ A;  1PQ6 A;  5DUH A;  1YOK A;  5AAV B;  2AMA A;  3K8S A;  5KRK A;  1YJE A;  2ZVT A;  3VI8 A;  5HJS A;  1ZKY A;  1ZUC A;  3B0Q A;  3CS6 A;  4NQA B;  2I4P A;  2NXX A;  1RJK A;  3ERT A;  3HOD A;  1XPC A;  1YIM A;  2OAX A;  3FUR A;  3HO0 A;  3KMG A;  5DZ3 A;  3OMK A;  5DWJ A;  1NAV A;  3O1E A;  3Q95 A;  3AFR A;  5GT4 A;  2QNV A;  4RUP A;  1GWR A;  2HAM A;  3DY6 A;  5C4O A;  1H9U A;  2OM9 A;  3Q95 B;  1GWX A;  2B23 A;  5DSH A;  3W0H A;  2PIT A;  4OZT U;  4CI4 A;  4PVU A;  3DCT A;  1DB1 A;  3PCU A;  2J14 A;  4O8F A;  4ZO1 B;  2QH6 A;  5KYJ A;  3ERD A;  1X76 A;  2AXA A;  1IE9 A;  1R20 A;  2HCD A;  3FC6 A;  3IMY A;  5KRI A;  1XAP A;  2GPU A;  3K6P A;  2QGT A;  5AVI A;  4IA7 A;  3W5Q A;  3L3Z A;  4MGA A;  4RUO X;  2VSR A;  4RWV A;  2YLY A;  2R6W A;  5G45 A;  4OIU A;  3VJS A;  3B68 A;  2ZL9 A;  5APH A;  2QA8 A;  3KFC A;  1SJ0 A;  5E15 A;  2P7G A;  3OLF A;  5DV8 A;  2QXS A;  1L2J A;  3VN2 A;  3UUD A;  3VJH A;  3OKI A;  3W5R A;  4A4V A;  5KCT A;  2I4Z A;  2PIV A;  2VV0 A;  3OAP A;  4IV4 A;  4IW6 A;  4Q13 A;  3ZRB A;  4QE6 A;  4K6I A;  5FQT A;  1NDE A;  2Q7I A;  1T63 A;  4RMD A;  3QT0 A;  5DUG A;  1FM9 A;  3GZ9 A;  4ZN9 A;  4R06 A;  1K74 A;  4OFR A;  4MGB B;  1Y9R A;  1X7J A;  2I0J A;  4K4J A;  2ABI A;  4PF3 A;  1E3G A;  1P93 A;  1YUC A;  3VHW A;  4Y29 A;  2J7X A;  3AUR A;  5KRO A;  2ZXZ A;  2B50 A;  3AZ1 A;  4KZM A;  1XNN A;  1U3Q A;  2AX8 A;  2ZK5 A;  1T79 A;  2AX7 A;  3AN4 A;  2GPV A;  3FEJ A;  4TUZ B;  2PIP L;  4QL8 A;  3HVL A;  5LWP A;  4WHF A;  3KMZ A;  1Z5X E;  2O9I A;  3IXP A;  4ZO1 X;  5DKG A;  3VTD A;  2QPY A;  3AN3 A;  3KPZ A;  3RVF A;  5KRC A;  1XVP B;  5KRH A;  5LGA A;  1XLS E;  3FLI A;  4LNW A;  2Q7L A;  4OLM A;  1PZL A;  1QKU A;  5JI0 D;  1ZDT A;  3O1D A;  3K22 A;  4G21 A;  5DMF A;  4OK1 A;  1OVL A;  2B1Z A;  3PO9 A;  5E19 A;  3OS9 A;  5KCW A;  4RE8 A;  3VHV A;  2LBD A;  1T7R A;  4UDA A;  2Q1H A;  1OVL B;  1G2N A;  1QKT A;  1ILH A;  2GPO A;  2AAX A;  1M7W A;  2I0G A;  2HB8 A;  5DXK A;  4WVD A;  1I37 A;  5EHJ A;  2ZK6 A;  3VT8 A;  3W0G A;  3ADW A;  1XB7 A;  3WWR A;  2GTK A;  3WT6 A;  2ZBS A;  3AUN A;  3CLD A;  2PIQ A;  3V4A A;  2QAB A;  4R6S A;  5DRM A;  2YFE A;  3X31 A;  1MVC A;  4JGV A;  5GID A;  3OS8 C;  1QKN A;  2QMV A;  5EC9 A;  3MNP A;  2ZXN A;  4OZR E;  4POH A;  2IOG A;  2PNU A;  4REF A;  4RUJ A;  5KRL A;  2Q70 A;  3R5M A;  4UDB A;  2ATH A;  2ZMJ A;  4FN9 A;  3BC5 A;  2G44 A;  3R8I A;  3OKH A;  3VHU A;  3FAL A;  1Z95 A;  4IS8 A;  3ILZ A;  1FCZ A;  2ZNO A;  4IWC A;  1EXA A;  1A28 A;  5DX3 A;  5GIC A;  2XKW A;  4DOR A;  3FAL B;  2BAW A;  5AWK A;  1I7G A;  3OOF A;  3SP6 A;  5DX3 B;  2ACL A;  3HZF A;  3ET2 A;  3P88 A;  4OKX A;  2PIX A;  3R29 A;  5DZI A;  5DTV A;  2YJD A;  2AYR A;  3AZ3 A;  3TKM A;  3WJ4 A;  4DM8 A;  4ZI1 A;  4ZN7 A;  5DXR A;  1U3R A;  1YYE A;  2QR9 A;  4CI5 A;  5ETH A;  2ZK3 A;  5DP0 A;  2AX6 A;  3WFG A;  5KR9 A;  1UOM A;  4J5W A;  1PCG A;  2Q3Y A;  4J5X C;  2OVM A;  5DWE A;  1ZEO A;  5DXB B;  2P54 A;  4ITF A;  4ZJW A;  5DVC A;  5DIE A;  5K13 A;  5KD9 A;  1XP1 A;  5AK2 A;  4N8R A;  5B5B A;  4M8E A;  3A2J A;  2OZ7 A;  2YLQ A;  2HAS A;  3KDU A;  1UPV A;  3ADS A;  4OHA A;  2Q59 A;  2QE4 A;  3GYT A;  4XTA A;  5DZ0 A;  3WTQ A;  1XQ3 A;  4G20 A;  3A2H A;  2GL8 A;  4WLB A;  4XT9 A;  5DYD A;  4MGD A;  5DXG A;  3OMP A;  1Y0X X;  1NQ1 A;  3L0J A;  3TKC A;  3VJT A;  4MGD B;  1NAX A;  2Q61 A;  1UPW A;  1RKH A;  5G43 A;  3OLL A;  1N4H A;  2PIW A;  1ZDU A;  1FM6 A;  5G5W A;  4JYH A;  2JF9 A;  3G8I A;  1A52 A;  5DK9 A;  1T76 A;  4RZG A;  3DR1 A;  2Q60 A;  1ZGY A;  2VV3 A;  4PXM A;  4RZE A;  4IA2 A;  4MG8 A;  4G2H A;  1NRL A;  3V49 A;  2POG A;  3F7D A;  2P1V A;  1X78 A;  5EGV A;  3W0A A;  3D5F A;  4MG8 B;  2R40 D;  4BCR A;  3OS8 A;  4NY9 A;  4B7W A;  4E4K A;  3V9T A;  3TY0 A;  3ET3 A;  2ZK2 A;  4EMA A;  2HWR A;  5DYB A;  3OMO A;  4RMC A;  4FNE A;  3RLL A;  4ZJR A;  2AA6 A;  5G42 A;  3FC6 B;  1RDT D;  1S0X A;  3L1B A;  3OSW A;  1M13 A;  4ONI A;  4PRG A;  1NHZ A;  3ZQT A;  3NOA A;  3V9V A;  1PDU A;  4MGA B;  3B1M A;  5DWI A;  5IAW A;  2B1V A;  3LBD A;  4QM0 A;  4ZNH A;  3B65 A;  4YPQ A;  1XV9 A;  2HC4 A;  1I38 A;  2QA8 B;  2Q6R A;  3VRW A;  1XV9 B;  3B66 A;  3BEJ A;  4IWF A;  1E3K A;  4ITE A;  4J5X A;  2PIU A;  2IHQ A;  2Q7K A;  4NUF A;  3UUD B;  5KCD A;  5DRJ A;  3B5R A;  4QK4 A;  1I7I A;  4E2J A;  4X1G A;  1IE8 A;  3CDS A;  4MG5 A;  2BJ4 A;  2FSZ A;  3R2A A;  5AZT A;  3X1H A;  5AAU A;  2PIO A;  1FCX A;  3V3Q A;  1YOW A;  2P7A A;  3B3K A;  5AWJ A;  2IOK A;  4PLD A;  1NUO A;  1XZX X;  5DV6 A;  3VT3 A;  3DCU A;  5HCV A;  5KRA A;  3HQ5 A;  3VSO A;  3FXV A;  5G44 A;  2ZLC A;  3VTC A;  3GWX A;  1T65 A;  4PP3 A;  3EYB A;  4DOS A;  1FBY A;  1DKF A;  2H77 A;  5HYR A;  5DXP A;  5E1C A;  3UUA A;  1KKQ A;  4N1Y A;  4OEY A;  1T7T A;  5CJ6 A;  5DI7 A;  2NV7 A;  1T7M A;  3L0E A;  3UUA B;  1YMT A;  2XYW A;  2Q5G A;  2YHD A;  1QKM A;  2P1T A;  4P6W A;  4XI3 A;  5E7V A;  2QZO A;  5FQP A;  4N73 A;  2G5O A;  2XHS A;  3BQD A;  3G0W A;  1NQ2 A;  3V9Y A;  3G8O A;  4XUH A;  2QZO B;  3AZ2 A;  2AM9 A;  1S19 A;  3NSP A;  5FQS A;  1FCY A;  3NSQ A;  2AA5 A;  1OSH A;  3HC5 A;  3WT5 A;  2I4J A;  2F4B A;  3OSA A;  1ZAF A;  3OMQ A;  2AWH A;  5KRF A;  3DZY D;  2XYX A;  4XAO A;  5DL4 A;  3RUT A;  3W0I A;  3P89 A;  4R2U A;  3A40 X;  1S9Q A;  3PLZ A;  2QSE A;  2Z4B A;  4UDD A;  1XLS A;  2YJA B;  2ZFX A;  3ADV A;  2P7Z A;  3VT9 A;  1OSV A;  2REW A;  1SR7 A;  2ZNP A;  3IPU A;  3R8A A;  3UUC A;  5KCE A;  2NW4 A;  3ZRA A;  1SKX A;  3A78 A;  4PPS A;  2QW4 A;  4RME A;  4YT1 A;  2JJ3 A;  4OZT E;  3D6D A;  3VJI A;  4DK8 A;  1ZH7 A;  2GWX A;  2P4Y A;  4RZF A;  2PRG A;  1T7F A;  2ZXM A;  2VV2 A;  4OKT A;  3R8D A;  3UU7 A;  2PIR A;  4J24 A;  4PP6 A;  2A3I A;  5DY8 A;  2HB7 A;  2PKL A;  2Q8S A;  4JYG A;  4ZOM A;  2EWP A;  4UDC A;  2ACL B;  5I4V A;  3H52 A;  1R20 D;  1RKG A;  4YMQ A;  2O4J A;  5HYK A;  1S0Z A;  5DID A;  3L0L A;  4NIE A;  3M7R A;  1T74 A;  2V7C A;  2J7Y A;  3HC6 A;  4J26 A;  4KZI A;  4OGH A;  5DXQ A;  2JFA A;  1K4W A;  4TV1 A;  4A4W A;  2O4R A;  4IQR A;  2W8Y A;  4S0S A;  3IA6 A;  5DKB A;  5GIE A;  1GS4 A;  3HLV A;  1XQC A;  3MNO A;  4HLW A;  4OIL A;  5KCF A;  1P8D A;  2ZK1 A;  2AMB A;  2FVJ A;  5FQR A;  5DWG A;  3AUQ A;  5DKE A;  3ADT A;  4X1F A;  5DKS A;  1ILG A;  3V3E A;  1M2Z A;  2Q59 B;  5IXK A;  1UHL A;  1T5Z A;  1VJB A;  4OEA A;  5SYZ A;  5HZC A;  1FM9 D;  3E7C A;  3W5T A;  4E4Q A;  5L7G A;  3PRG A;  1MZN A;  1UHL B;  1N83 A;  1R1K D;  1Z5X U;  5DMC A;  3SP9 A;  1G50 A;  3UP3 A;  3VT4 A;  3X36 A;  2OCF A;  3D24 A;  3JZC A;  1Q4X A;  3ET0 A;  3F5C A;  3LMP A;  5ACC A;  3S9S A;  3VT5 A;  3RUU A;  2OVH A;  3N00 A;  4LSJ A;  4ZNS A;  1X7R A;  2OUZ A;  2ZAS A;  4DQM A;  1YIN A;  2ZK4 A;  4IV2 A;  4ZNV A;  2AA2 A;  3A9E A;  3L03 A;  4S0T A;  2AA7 A;  3IXP D;  3CDP A;  5DZH A;  3A9E B;  3ADU A;  3P8X A;  4LTW A;  3WFF A;  2YLP A;  3OMM A;  5AAV A;  3VRV A;  2VST A;  3TX7 B;  4RAK A;  5DIG A;  4G1Z A;  2J4A A;  3VT7 A;  2ZY0 A;  1HJ1 A;  4DMA A;  2YAT A;  3B0W A;  4OJB A;  1XP9 A;  4OFU A;  2VV4 A;  2Q5S A;  4WQP A;  5L11 A;  2P15 A;  4PLE A;  3GBK A;  4IA1 A;  3G9E A;  5AZV A;  4G1Y A;  2VV4 B;  1FD0 A;  4OZR U;  2ZLA A;  3E94 A;  5JJM A;  5DU5 A;  4OED A;  1TFC A;  4OEZ A;  2Q1V A;  4IUI A;  4XLD A;  4YNK A;  5DV3 A;  3GWS X;  1U9E A;  5JJM B;  3AX8 A;  1T73 A;  3B0R A;  1OT7 A; 
#chains in the Genus database with same CATH homology
 3B67 A;  3CJW A;  4JYI A;  4Q0A C;  2ZMI A;  3A3Z X;  5DVV A;  3H0A D;  5AYG A;  2NPA A;  2BJ4 B;  4OJ4 A;  3GD2 A;  3WJ5 A;  1LBD A;  1LV2 A;  3K23 A;  2Z4J A;  2H79 A;  2QXM A;  1XOW A;  3KDT A;  3KYT A;  3OGT A;  4K7A A;  4N5G A;  5G46 A;  5EIT A;  4ZNU A;  4APU A;  3CS4 A;  4WHG A;  3UP0 A;  4JL4 A;  3JZB A;  4OAR A;  5EJV A;  4MGC A;  4OKW A;  3WGP A;  5DLR A;  3IPQ A;  4LNX A;  3E00 D;  3CS8 A;  4A2J A;  3OOK A;  4L96 A;  1ERE A;  3DT3 A;  1DKF B;  4M8H A;  4MGB A;  2QGW A;  4IVW A;  4CSJ A;  1R1K A;  2POB A;  5APJ A;  3ZR7 A;  4PP5 A;  3UVV A;  3FS1 A;  1RK3 A;  5M96 A;  4OJ9 A;  4JAZ A;  2G0H A;  5JY3 A;  2FAI A;  3UVV B;  3FEI A;  2QTU A;  4TUZ A;  1XDK A;  4RFW A;  3MNE A;  3KWY A;  1R6G A;  2Q7J A;  2PIN A;  1YP0 A;  5FQV A;  4QE8 A;  4IA3 A;  4WPF A;  1XDK B;  3PEQ A;  4J5W C;  1YA3 A;  4L98 A;  2HFP A;  2R40 A;  1XVP A;  4OC7 A;  5C4S A;  4OH5 A;  3VTB A;  2HVC A;  2AX9 A;  1L2I A;  1PRG A;  4PWL A;  3W5P A;  2VV1 A;  5DZ1 A;  4OIV A;  1S9P A;  1XJ7 A;  2XYJ A;  4MDD A;  4POJ A;  2Q6J A;  1PQ9 A;  2G0G A;  2VV1 B;  1FM6 D;  1X7B A;  2Q5P A;  3CTB A;  4KZJ A;  3B0T A;  4LBD A;  2ZK0 A;  3W0J A;  4ZNT A;  1TXI A;  4S14 A;  4FHI A;  5AVL A;  1G1U A;  1RDT A;  3SZ1 A;  3DZU D;  3X1I A;  1WM0 X;  2ZNN A;  3KBA A;  4MG6 A;  5KCU A;  1G5Y A;  4FHH A;  1SQN A;  4IVY A;  5DXE A;  3R5N A;  5DVS A;  1NQ7 A;  1KV6 A;  4REE A;  3VT6 A;  4IW8 A;  1R5K A;  3FUG A;  5F9B A;  3WMH A;  3W0C A;  5KCC A;  2ZKC A;  5KRM A;  4PPP A;  2E2R A;  4Q50 A;  4HEE X;  3UU7 B;  2Q6S A;  2V0V A;  3KMR A;  5C4T A;  3H0A A;  3OLS A;  4OH6 A;  1GWQ A;  3CWD A;  4FGY A;  2ZNQ A;  2AB2 A;  3IPS A;  3VSP A;  5DWL A;  2PJL A;  1N46 A;  3P0U A;  5APK A;  4MG9 A;  5A86 A;  1EXX A;  1PQC A;  2JFA B;  1XNX A;  3D90 A;  4MG9 B;  4ZNW A;  5E14 A;  4TV1 B;  3A2I A;  2GP7 A;  3DZU A;  4NB6 A;  1ERR A;  4OKB A;  2R6Y A;  3D57 A;  5HJP A;  2HBH A;  3U9Q A;  5L7E A;  3E00 A;  3RY9 A;  1U3S A;  4S15 A;  2HAR A;  5HJP B;  3W0Y A;  4G1D A;  1XIU A;  2GIU A;  4P6X A;  1X7E A;  1K74 D;  3VRT A;  4DK7 A;  1XP6 A;  5H1E A;  5IZ0 A;  3ADX A;  2NXX E;  2GPP A;  3T03 A;  5DXB A;  5KYA A;  4DM6 A;  3VRU A;  4EM9 A;  5DUE A;  3L3X A;  4XUM A;  1BSX A;  5B41 A;  5EI1 A;  3ET1 A;  4G2I A;  2HWQ A;  2YLO A;  4QJR A;  2AO6 A;  2P1U A;  3F5C B;  1KNU A;  3OSI A;  1HG4 A;  5ICK A;  1Y0S A;  5L7H A;  5DXM A;  1NYX A;  2QA6 A;  5E0X A;  3OZ0 A;  3GYU A;  3OZJ A;  5C4U A;  4MG7 A;  4IU7 A;  1K7L A;  3PBA A;  1NQ0 A;  5E0W A;  3WT7 A;  3CQV A;  5KRJ A;  2ZMH A;  5G3J A;  1MV9 A;  4MG7 B;  3HM1 A;  4XHD A;  4F9M A;  1PK5 A;  3DZY A;  1YY4 A;  3GN8 A;  3RLJ A;  1PQ6 A;  5DUH A;  1YOK A;  5AAV B;  2AMA A;  3K8S A;  5KRK A;  1YJE A;  2ZVT A;  3VI8 A;  5HJS A;  1ZKY A;  1ZUC A;  3B0Q A;  3CS6 A;  4NQA B;  2I4P A;  2NXX A;  1RJK A;  3ERT A;  3HOD A;  1XPC A;  1YIM A;  2OAX A;  3FUR A;  3HO0 A;  3KMG A;  5DZ3 A;  3OMK A;  5DWJ A;  1NAV A;  3O1E A;  3Q95 A;  3AFR A;  5GT4 A;  2QNV A;  4RUP A;  1GWR A;  2HAM A;  3DY6 A;  5C4O A;  1H9U A;  2OM9 A;  3Q95 B;  1GWX A;  2B23 A;  5DSH A;  3W0H A;  2PIT A;  4OZT U;  4CI4 A;  4PVU A;  3DCT A;  1DB1 A;  3PCU A;  2J14 A;  4O8F A;  4ZO1 B;  2QH6 A;  5KYJ A;  3ERD A;  1X76 A;  2AXA A;  1IE9 A;  1R20 A;  2HCD A;  3FC6 A;  3IMY A;  5KRI A;  1XAP A;  2GPU A;  3K6P A;  2QGT A;  5AVI A;  4IA7 A;  3W5Q A;  3L3Z A;  4MGA A;  4RUO X;  2VSR A;  4RWV A;  2YLY A;  2R6W A;  5G45 A;  4OIU A;  3VJS A;  3B68 A;  2ZL9 A;  5APH A;  2QA8 A;  3KFC A;  1SJ0 A;  5E15 A;  2P7G A;  3OLF A;  5DV8 A;  2QXS A;  1L2J A;  3VN2 A;  3UUD A;  3VJH A;  3OKI A;  3W5R A;  4A4V A;  5KCT A;  2I4Z A;  2PIV A;  2VV0 A;  3OAP A;  4IV4 A;  4IW6 A;  4Q13 A;  3ZRB A;  4QE6 A;  4K6I A;  5FQT A;  1NDE A;  2Q7I A;  1T63 A;  4RMD A;  3QT0 A;  5DUG A;  1FM9 A;  3GZ9 A;  4ZN9 A;  4R06 A;  1K74 A;  4OFR A;  4MGB B;  1Y9R A;  1X7J A;  2I0J A;  4K4J A;  2ABI A;  4PF3 A;  1E3G A;  1P93 A;  1YUC A;  3VHW A;  4Y29 A;  2J7X A;  3AUR A;  5KRO A;  2ZXZ A;  2B50 A;  3AZ1 A;  4KZM A;  1XNN A;  1U3Q A;  2AX8 A;  2ZK5 A;  1T79 A;  2AX7 A;  3AN4 A;  2GPV A;  3FEJ A;  4TUZ B;  2PIP L;  4QL8 A;  3HVL A;  5LWP A;  4WHF A;  3KMZ A;  1Z5X E;  2O9I A;  3IXP A;  4ZO1 X;  5DKG A;  3VTD A;  2QPY A;  3AN3 A;  3KPZ A;  3RVF A;  5KRC A;  1XVP B;  5KRH A;  5LGA A;  1XLS E;  3FLI A;  4LNW A;  2Q7L A;  4OLM A;  1PZL A;  1QKU A;  5JI0 D;  1ZDT A;  3O1D A;  3K22 A;  4G21 A;  5DMF A;  4OK1 A;  1OVL A;  2B1Z A;  3PO9 A;  5E19 A;  3OS9 A;  5KCW A;  4RE8 A;  3VHV A;  2LBD A;  1T7R A;  4UDA A;  2Q1H A;  1OVL B;  1G2N A;  1QKT A;  1ILH A;  2GPO A;  2AAX A;  1M7W A;  2I0G A;  2HB8 A;  5DXK A;  4WVD A;  1I37 A;  5EHJ A;  2ZK6 A;  3VT8 A;  3W0G A;  3ADW A;  1XB7 A;  3WWR A;  2GTK A;  3WT6 A;  2ZBS A;  3AUN A;  3CLD A;  2PIQ A;  3V4A A;  2QAB A;  4R6S A;  5DRM A;  2YFE A;  3X31 A;  1MVC A;  4JGV A;  5GID A;  3OS8 C;  1QKN A;  2QMV A;  5EC9 A;  3MNP A;  2ZXN A;  4OZR E;  4POH A;  2IOG A;  2PNU A;  4REF A;  4RUJ A;  5KRL A;  2Q70 A;  3R5M A;  4UDB A;  2ATH A;  2ZMJ A;  4FN9 A;  3BC5 A;  2G44 A;  3R8I A;  3OKH A;  3VHU A;  3FAL A;  1Z95 A;  4IS8 A;  3ILZ A;  1FCZ A;  2ZNO A;  4IWC A;  1EXA A;  1A28 A;  5DX3 A;  5GIC A;  2XKW A;  4DOR A;  3FAL B;  2BAW A;  5AWK A;  1I7G A;  3OOF A;  3SP6 A;  5DX3 B;  2ACL A;  3HZF A;  3ET2 A;  3P88 A;  4OKX A;  2PIX A;  3R29 A;  5DZI A;  5DTV A;  2YJD A;  2AYR A;  3AZ3 A;  3TKM A;  3WJ4 A;  4DM8 A;  4ZI1 A;  4ZN7 A;  5DXR A;  1U3R A;  1YYE A;  2QR9 A;  4CI5 A;  5ETH A;  2ZK3 A;  5DP0 A;  2AX6 A;  3WFG A;  5KR9 A;  1UOM A;  4J5W A;  1PCG A;  2Q3Y A;  4J5X C;  2OVM A;  5DWE A;  1ZEO A;  5DXB B;  2P54 A;  4ITF A;  4ZJW A;  5DVC A;  5DIE A;  5K13 A;  5KD9 A;  1XP1 A;  5AK2 A;  4N8R A;  5B5B A;  4M8E A;  3A2J A;  2OZ7 A;  2YLQ A;  2HAS A;  3KDU A;  1UPV A;  3ADS A;  4OHA A;  2Q59 A;  2QE4 A;  3GYT A;  4XTA A;  5DZ0 A;  3WTQ A;  1XQ3 A;  4G20 A;  3A2H A;  2GL8 A;  4WLB A;  4XT9 A;  5DYD A;  4MGD A;  5DXG A;  3OMP A;  1Y0X X;  1NQ1 A;  3L0J A;  3TKC A;  3VJT A;  4MGD B;  1NAX A;  2Q61 A;  1UPW A;  1RKH A;  5G43 A;  3OLL A;  1N4H A;  2PIW A;  1ZDU A;  1FM6 A;  5G5W A;  4JYH A;  2JF9 A;  3G8I A;  1A52 A;  5DK9 A;  1T76 A;  4RZG A;  3DR1 A;  2Q60 A;  1ZGY A;  2VV3 A;  4PXM A;  4RZE A;  4IA2 A;  4MG8 A;  4G2H A;  1NRL A;  3V49 A;  2POG A;  3F7D A;  2P1V A;  1X78 A;  5EGV A;  3W0A A;  3D5F A;  4MG8 B;  2R40 D;  4BCR A;  3OS8 A;  4NY9 A;  4B7W A;  4E4K A;  3V9T A;  3TY0 A;  3ET3 A;  2ZK2 A;  4EMA A;  2HWR A;  5DYB A;  3OMO A;  4RMC A;  4FNE A;  3RLL A;  4ZJR A;  2AA6 A;  5G42 A;  3FC6 B;  1RDT D;  1S0X A;  3L1B A;  3OSW A;  1M13 A;  4ONI A;  4PRG A;  1NHZ A;  3ZQT A;  3NOA A;  3V9V A;  1PDU A;  4MGA B;  3B1M A;  5DWI A;  5IAW A;  2B1V A;  3LBD A;  4QM0 A;  4ZNH A;  3B65 A;  4YPQ A;  1XV9 A;  2HC4 A;  1I38 A;  2QA8 B;  2Q6R A;  3VRW A;  1XV9 B;  3B66 A;  3BEJ A;  4IWF A;  1E3K A;  4ITE A;  4J5X A;  2PIU A;  2IHQ A;  2Q7K A;  4NUF A;  3UUD B;  5KCD A;  5DRJ A;  3B5R A;  4QK4 A;  1I7I A;  4E2J A;  4X1G A;  1IE8 A;  3CDS A;  4MG5 A;  2BJ4 A;  2FSZ A;  3R2A A;  5AZT A;  3X1H A;  5AAU A;  2PIO A;  1FCX A;  3V3Q A;  1YOW A;  2P7A A;  3B3K A;  5AWJ A;  2IOK A;  4PLD A;  1NUO A;  1XZX X;  5DV6 A;  3VT3 A;  3DCU A;  5HCV A;  5KRA A;  3HQ5 A;  3VSO A;  3FXV A;  5G44 A;  2ZLC A;  3VTC A;  3GWX A;  1T65 A;  4PP3 A;  3EYB A;  4DOS A;  1FBY A;  1DKF A;  2H77 A;  5HYR A;  5DXP A;  5E1C A;  3UUA A;  1KKQ A;  4N1Y A;  4OEY A;  1T7T A;  5CJ6 A;  5DI7 A;  2NV7 A;  1T7M A;  3L0E A;  3UUA B;  1YMT A;  2XYW A;  2Q5G A;  2YHD A;  1QKM A;  2P1T A;  4P6W A;  4XI3 A;  5E7V A;  2QZO A;  5FQP A;  4N73 A;  2G5O A;  2XHS A;  3BQD A;  3G0W A;  1NQ2 A;  3V9Y A;  3G8O A;  4XUH A;  2QZO B;  3AZ2 A;  2AM9 A;  1S19 A;  3NSP A;  5FQS A;  1FCY A;  3NSQ A;  2AA5 A;  1OSH A;  3HC5 A;  3WT5 A;  2I4J A;  2F4B A;  3OSA A;  1ZAF A;  3OMQ A;  2AWH A;  5KRF A;  3DZY D;  2XYX A;  4XAO A;  5DL4 A;  3RUT A;  3W0I A;  3P89 A;  4R2U A;  3A40 X;  1S9Q A;  3PLZ A;  2QSE A;  2Z4B A;  4UDD A;  1XLS A;  2YJA B;  2ZFX A;  3ADV A;  2P7Z A;  3VT9 A;  1OSV A;  2REW A;  1SR7 A;  2ZNP A;  3IPU A;  3R8A A;  3UUC A;  5KCE A;  2NW4 A;  3ZRA A;  1SKX A;  3A78 A;  4PPS A;  2QW4 A;  4RME A;  4YT1 A;  2JJ3 A;  4OZT E;  3D6D A;  3VJI A;  4DK8 A;  1ZH7 A;  2GWX A;  2P4Y A;  4RZF A;  2PRG A;  1T7F A;  2ZXM A;  2VV2 A;  4OKT A;  3R8D A;  3UU7 A;  2PIR A;  4J24 A;  4PP6 A;  2A3I A;  5DY8 A;  2HB7 A;  2PKL A;  2Q8S A;  4JYG A;  4ZOM A;  2EWP A;  4UDC A;  2ACL B;  5I4V A;  3H52 A;  1R20 D;  1RKG A;  4YMQ A;  2O4J A;  5HYK A;  1S0Z A;  5DID A;  3L0L A;  4NIE A;  3M7R A;  1T74 A;  2V7C A;  2J7Y A;  3HC6 A;  4J26 A;  4KZI A;  4OGH A;  5DXQ A;  2JFA A;  1K4W A;  4TV1 A;  4A4W A;  2O4R A;  4IQR A;  2W8Y A;  4S0S A;  3IA6 A;  5DKB A;  5GIE A;  1GS4 A;  3HLV A;  1XQC A;  3MNO A;  4HLW A;  4OIL A;  5KCF A;  1P8D A;  2ZK1 A;  2AMB A;  2FVJ A;  5FQR A;  5DWG A;  3AUQ A;  5DKE A;  3ADT A;  4X1F A;  5DKS A;  1ILG A;  3V3E A;  1M2Z A;  2Q59 B;  5IXK A;  1UHL A;  1T5Z A;  1VJB A;  4OEA A;  5SYZ A;  5HZC A;  1FM9 D;  3E7C A;  3W5T A;  4E4Q A;  5L7G A;  3PRG A;  1MZN A;  1UHL B;  1N83 A;  1R1K D;  1Z5X U;  5DMC A;  3SP9 A;  1G50 A;  3UP3 A;  3VT4 A;  3X36 A;  2OCF A;  3D24 A;  3JZC A;  1Q4X A;  3ET0 A;  3F5C A;  3LMP A;  5ACC A;  3S9S A;  3VT5 A;  3RUU A;  2OVH A;  3N00 A;  4LSJ A;  4ZNS A;  1X7R A;  2OUZ A;  2ZAS A;  4DQM A;  1YIN A;  2ZK4 A;  4IV2 A;  4ZNV A;  2AA2 A;  3A9E A;  3L03 A;  4S0T A;  2AA7 A;  3IXP D;  3CDP A;  5DZH A;  3A9E B;  3ADU A;  3P8X A;  4LTW A;  3WFF A;  2YLP A;  3OMM A;  5AAV A;  3VRV A;  2VST A;  3TX7 B;  4RAK A;  5DIG A;  4G1Z A;  2J4A A;  3VT7 A;  2ZY0 A;  1HJ1 A;  4DMA A;  2YAT A;  3B0W A;  4OJB A;  1XP9 A;  4OFU A;  2VV4 A;  2Q5S A;  4WQP A;  5L11 A;  2P15 A;  4PLE A;  3GBK A;  4IA1 A;  3G9E A;  5AZV A;  4G1Y A;  2VV4 B;  1FD0 A;  4OZR U;  2ZLA A;  3E94 A;  5JJM A;  5DU5 A;  4OED A;  1TFC A;  4OEZ A;  2Q1V A;  4IUI A;  4XLD A;  4YNK A;  5DV3 A;  3GWS X;  1U9E A;  5JJM B;  3AX8 A;  1T73 A;  3B0R A;  1OT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...