3SZ1A

Human ppar gamma ligand binding domain in complex with luteolin and myristic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
270
structure length
258
Chain Sequence
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mode of peroxisome proliferator-activated receptor gamma activation by luteolin.
pubmed doi rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 97
structure length 258
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3sz1A00
5DV8A 3B1MA 1G5YA 1NDEA 5DK9A 3X36A 3VHVA 3Q95B 3ADSA 4POHA 5DKEA 5FQSA 1U3RA 4Q0AC 3VJIA 5DVCA 2OCFA 1XZXX 1Z5XE 2QTUA 5DVSA 3UUDA 3D6DA 3W5RA 1LV2A 2P1UA 4A2JA 4OJ9A 2AX7A 2HVCA 5E0WA 4J5XA 3ZRBA 2AMBA 4E4KA 4REFA 2R6YA 1P93A 2W8YA 3WGPA 4ZJWA 1NRLA 4N1YA 3HC6A 1E3KA 2P7GA 4ZOMA 3CWDA 3F5CA 4IV2A 5KCWA 5GIDA 2B23A 3B5RA 4ZNSA 2QGTA 1ILHA 3OAPA 2PKLA 4MG6A 3OKHA 2QGWA 1N83A 1NYXA 3ET2A 3Q95A 4RZGA 3ZQTA 5KCEA 1QKNA 3R8DA 1LBDA 4OK1A 3ADUA 1WM0X 5GICA 1GS4A 3PCUA 4TV1B 3JZCA 5HYRA 1YA3A 5JI0D 2NV7A 3KFCA 3VHWA 2OAXA 4F9MA 1Y0SA 2PIXA 4ITFA 2AWHA 1M13A 1T76A 2POGA 2HB8A 3A78A 3AZ1A 2YLPA 4JYHA 4Y29A 2FVJA 3VT4A 4LNXA 3W5PA 2PITA 2B1ZA 4E4QA 2QXMA 5C4TA 3UP3A 2I0JA 4KZJA 3GN8A 2O4JA 4J24A 5DY8A 3LBDA 1R20D 4EM9A 1MZNA 4ITEA 3X1HA 2ZNPA 3B0QA 2VSRA 4XAOA 5F9BA 4MGBA 4MDDA 3AUNA 1UOMA 4J5WC 4OZRU 2AA2A 4ZN7A 3HVLA 3KWYA 1L2IA 4X1FA 3OMPA 4L98A 1E3GA 2OUZA 1Z95A 4ZNUA 1XPCA 2QMVA 4DM6A 1S19A 3WFFA 1T63A 5DX3B 1MV9A 2PINA 5KRMA 3W0JA 5KRAA 1R20A 1XJ7A 2ZLAA 4A4WA 4QE8A 5DKGA 3ERDA 1OT7A 2AAXA 4FHHA 2Q59B 4RMEA 4ZO1X 3RLJA 3UU7B 5DVVA 2HAMA 4PP5A 5KRFA 5DXRA 3VRWA 1Z5XU 2ZNQA 3VRTA 3VRVA 4RE8A 3MNOA 4RUOX 5DL4A 4QL8A 4E2JA 4WHGA 3U9QA 5HJPB 2P1VA 2Q3YA 1SR7A 4G1ZA 5DXEA 5DV3A 3K23A 3E00A 1FBYA 4IW6A 4RWVA 4XHDA 5ACCA 1NQ7A 2ZMJA 1TFCA 3X1IA 2Q70A 4PRGA 3K22A 3P0UA 3W0AA 2GP7A 4PWLA 5C4OA 4OARA 3KPZA 4RMDA 1ZDUA 4KZIA 4QJRA 4UDCA 1XP1A 4IUIA 3M7RA 3ZR7A 5IAWA 1M7WA 3F7DA 3G9EA 4R06A 5KCUA 2QPYA 1YY4A 4QK4A 3ADVA 3D90A 3E94A 5LGAA 3FEJA 2ATHA 2LBDA 5DKBA 4PPPA 1SKXA 2G44A 3B3KA 3GWSX 3K8SA 5GIEA 5KROA 1XAPA 3A40X 5E15A 3KYTA 5JJMB 1NUOA 2HWQA 4EMAA 3D24A 4TUZB 5DZ1A 1K74D 4OKBA 5KCTA 2HC4A 1ZEOA 3SP9A 1R6GA 4DMAA 3B0TA 5KCFA 4IQRA 3OLLA 3FALB 1I38A 3L03A 5G3JA 1VJBA 2HASA 3A9EB 3W0GA 3CLDA 1S0XA 3B67A 5EITA 3HO0A 3IPUA 3G8IA 1X78A 2HWRA 3OLFA 5DWIA 5KYAA 5AAVB 2B50A 5CJ6A 1FCYA 1TXIA 2JFAB 2PIWA 3BC5A 4IV4A 4WPFA 1MVCA 1FD0A 2PIOA 4DM8A 4S15A 4ZJRA 2Q5PA 4ZN9A 5DP0A 3WTQA 3ET0A 5HYKA 4TUZA 3OLSA 4JAZA 2QA8B 1DB1A 2XYWA 2YLQA 3VTCA 4J26A 4OEDA 4K7AA 4FNEA 4L96A 2ZNOA 5JY3A 2Q60A 4J5XC 3L1BA 1Y9RA 2AX8A 2PNUA 3A9EA 3O1DA 5E0XA 5AAUA 1NAVA 5G45A 3OSWA 4S0SA 1G50A 3H52A 3PO9A 2Z4JA 2I4JA 2ZK5A 2REWA 3VJTA 5AAVA 1XIUA 4MG7B 2IOGA 4NUFA 2JFAA 2ZK6A 3VT6A 2Q8SA 5DXBB 5C4SA 3DR1A 3OS8C 4YNKA 5IZ0A 3WWRA 3B0WA 4IU7A 3TX7B 5KYJA 2HARA 3IPQA 4DK8A 3HQ5A 1HG4A 4MGCA 3OOFA 4K6IA 4IA1A 5DU5A 3KBAA 3QT0A 2OVMA 2P7AA 4PP3A 3OSAA 4Q50A 4RZFA 4ZNVA 3V9VA 2ZY0A 5HCVA 2R6WA 2P54A 3AUQA 4OH6A 2Q1VA 2J7XA 3G0WA 4HEEX 2VV2A 2GL8A 3LMPA 2ZXZA 4PF3A 5DXBA 2HB7A 3HM1A 3OMQA 3SP6A 1NQ2A 2VV1B 3WT5A 3KDTA 3G8OA 5KCDA 1NQ1A 2H79A 3X31A 4PLEA 4R2UA 1QKMA 2E2RA 2YLOA 3FXVA 3CS8A 4QM0A 3KMGA 2PIPL 3CQVA 1T79A 1N4HA 4IW8A 5FQPA 3B66A 5DZIA 1DKFB 1GWRA 2P15A 2VV0A 3EYBA 1FCXA 5AWJA 3VN2A 1K4WA 2V7CA 3IPSA 1YOWA 1GWQA 2AYRA 5LWPA 4S14A 3GZ9A 2ZK3A 4TV1A 2VV1A 2F4BA 5ICKA 1FM6A 1NQ0A 1SJ0A 2ZNNA 5DWEA 5G46A 5DMCA 2Q5SA 2VSTA 5I4VA 2G5OA 5G42A 1XVPB 1A28A 4OC7A 5DKSA 3S9SA 2PIRA 5B5BA 4UDAA 5APKA 3W5QA 1PQCA 4IA3A 3E00D 1KKQA 4MGDB 2YHDA 4PVUA 2AA7A 4MGAB 4XUMA 1DKFA 2J14A 1PCGA 1QKTA 3H0AD 4UDDA 2Q1HA 5M96A 3ERTA 4K4JA 2ZASA 1KV6A 5DXPA 5DZ0A 2G0GA 2NXXA 3DY6A 1OVLB 2JJ3A 2AA6A 5G43A 3PBAA 5FQVA 3WT6A 3WJ5A 5APJA 3AZ3A 1T7TA 1T74A 5DYBA 5DMFA 4OZTE 2Q7KA 5DX3A 2HBHA 3A3ZX 5HJSA 5HZCA 4PLDA 3V3QA 1EREA 1RKHA 4ONIA 1XP6A 3AN3A 1H9UA 1PZLA 3H0AA 3OKIA 4IVWA 4N8RA 4OGHA 4MGDA 2Q59A 3FEIA 4J5WA 1X7EA 4RUJA 3W0IA 3W0CA 3B65A 1R5KA 4JL4A 3UU7A 5L7EA 4MG8B 3PEQA 1P8DA 1I7GA 2Q7IA 4XLDA 3V9TA 2ZXNA 1OVLA 3OZJA 2ZKCA 4IVYA 3GD2A 5AVLA 1XV9B 2I4PA 5G5WA 5L7HA 5A86A 2YJDA 5HJPA 3AURA 1U9EA 2ZMIA 4NY9A 4OJBA 2ACLB 5DSHA 4LBDA 3GYUA 5ETHA 3VSPA 2AB2A 3VT5A 1X7JA 3P8XA 2YATA 5DWGA 3DZYD 3N00A 1ZH7A 1RJKA 3V3EA 3W5TA 2ZK1A 3FS1A 5DXKA 2ZVTA 4MG8A 1FM9D 2P4YA 2XYJA 4ZI1A 5DIDA 5DWLA 5APHA 3ILZA 2O4RA 2R40A 2Z4BA 4RMCA 4RFWA 3SZ1A 5DRMA 3HLVA 1X7RA 3L3ZA 3R29A 2AXAA 1XV9A 2IOKA 5E14A 4N5GA 4ZNHA 3TKCA 4P6WA 5DUEA 3UUAB 3DZYA 3R2AA 1XP9A 2ACLA 2YFEA 3ADWA 5KCCA 4G2HA 4OILA 5DXGA 1S0ZA 2YLYA 5JJMA 5DI7A 3CS6A 4G2IA 5EHJA 1FM9A 1XLSA 4UDBA 4OEAA 2VV3A 2Q7JA 1ILGA 2PIQA 2GTKA 4XTAA 3FALA 2OZ7A 4OEZA 3FLIA 1KNUA 3WT7A 4NB6A 2NXXE 3ADXA 2NW4A 1G1UA 3V9YA 2QXSA 3R8IA 3VT8A 1UPWA 1IE8A 2FAIA 2JF9A 3VJHA 1ZDTA 1X76A 2A3IA 3UUAA 1XQCA 4OZTU 4X1GA 3T03A 3CTBA 4LNWA 3K6PA 3UUDB 3B68A 5DZ3A 1U3SA 1T7RA 3RY9A 1XOWA 2AX6A 2QA8A 3KDUA 2GPUA 4IWCA 3ADTA 4OLMA 5DZHA 5KRKA 3HC5A 5K13A 1S9PA 2Q5GA 1YIMA 2Q7LA 3O1EA 4N73A 4OHAA 4PP6A 3TKMA 3UVVB 2FSZA 3VT3A 4DORA 3F5CB 3DT3A 3JZBA 1FCZA 2OM9A 1RK3A 3NOAA 5FQTA 4YPQA 2ZXMA 4B7WA 1RKGA 1M2ZA 4MG7A 2I0GA 4PPSA 3OGTA 3V4AA 2VV4B 2H77A 2XKWA 2Q61A 5AWKA 3R8AA 3OOKA 2AMAA 4WQPA 2ABIA 2YJAB 5DIGA 4WHFA 4ZNTA 4CI5A 4APUA 2HFPA 1K7LA 1PDUA 4POJA 3OS9A 5IXKA 4XT9A 5KRHA 3OZ0A 1YP0A 3OSIA 1XDKB 3UUCA 1PQ6A 4MG5A 5DV6A 3BQDA 5EJVA 3KMRA 3UVVA 1FM6D 1PQ9A 3RUUA 2GWXA 5EGVA 3AZ2A 3R5MA 4CSJA 2PIUA 3TY0A 3OS8A 4WLBA 3OMKA 2V0VA 2P7ZA 1ERRA 1I7IA 1XNXA 1YMTA 2AO6A 1SQNA 2ZMHA 3IXPD 2XYXA 3L0JA 1GWXA 4JYIA 1G2NA 2VV4A 3A2IA 2NPAA 3CDSA 2BAWA 2ZFXA 1NAXA 3OMMA 3OMOA 1HJ1A 3CDPA 1YJEA 4G1YA 2XHSA 4HLWA 4MGBB 3DZUD 4RUPA 1XLSE 4QE6A 2ZK2A 3HZFA 1T7FA 4IWFA 1U3QA 5DYDA 3AFRA 1XDKA 2J7YA 4YMQA 1NHZA 1XQ3A 2BJ4B 3PLZA 2ZLCA 5DUGA 4O8FA 5AYGA 2AX9A 3MNPA 3IXPA 2Q6JA 4DK7A 3ZRAA 2O9IA 1ZKYA 4IA7A 4JGVA 4DQMA 3DZUA 1A52A 5E19A 2GIUA 3V49A 2P1TA 5EC9A 4MG9B 4YT1A 1L2JA 5DRJA 4OEYA 4DOSA 3W0YA 3GWXA 4XUHA 2QZOB 5DLRA 4XI3A 3P89A 5DXMA 2Q6RA 2ZK4A 3VT7A 1XVPA 3D5FA 2BJ4A 5AVIA 5GT4A 4IA2A 3VSOA 2POBA 2ZL9A 3NSPA 4PXMA 3VTDA 2J4AA 2I4ZA 5SYZA 5KRLA 1N46A 3VI8A 4MGAA 2GPVA 3FC6B 5L7GA 2AA5A 1I37A 4IS8A 1XB7A 4MG9A 5AK2A 3DCTA 1R1KD 3CS4A 3IA6A 4R6SA 5E7VA 5AZTA 1YOKA 1EXAA 4G20A 3L0LA 3B0RA 2QZOA 3BEJA 3GBKA 4JYGA 2QA6A 2R40D 4OFUA 2Q6SA 4RAKA 4OJ4A 5DWJA 4G1DA 5EI1A 1BSXA 3FURA 5FQRA 2B1VA 3IMYA 3P88A 1ZGYA 2ZBSA 3A2JA 2GPOA 2IHQA 1R1KA 1XNNA 1Y0XX 1PRGA 3PRGA 3FC6A 3VJSA 3D57A 5H1EA 1OSVA 5KRJA 3UP0A 2QW4A 4M8EA 3ET3A 5G44A 5KRIA 4KZMA 3AN4A 4NQAB 5KR9A 2QNVA 4OH5A 5B41A 2EWPA 3VTBA 4G21A 3NSQA 2ZK0A 2QABA 4OKXA 3CJWA 4OIUA 4LTWA 1RDTD 1T73A 2GPPA 2QR9A 3RUTA 4REEA 4ZNWA 2AM9A 2QSEA 5KD9A 3DCUA 3A2HA 4OIVA 2PRGA 4OKTA 3AX8A 4P6XA 3RVFA 1Q4XA 5KRCA 3W0HA 1T65A 2PIVA 3E7CA 1S9QA 1UHLB 3GYTA 3L0EA 2QH6A 5L11A 4WVDA 1YINA 1QKUA 1T5ZA 4RZEA 4BCRA 1X7BA 1RDTA 3WMHA 2OVHA 4FGYA 4M8HA 1IE9A 5DUHA 1T7MA 3WFGA 1EXXA 4OKWA 1YYEA 1ZAFA 1PK5A 4Q13A 3ET1A 3VRUA 5AZVA 3KMZA 1K74A 3FUGA 1YUCA 5DXQA 3L3XA 4OZRE 3RLLA 5DTVA 3VHUA 4OFRA 4CI4A 1ZUCA 2QE4A 2HCDA 4FHIA 4LSJA 4ZO1B 3VT9A 3WJ4A 4A4VA 2PJLA 5C4UA 4NIEA 5DIEA 1OSHA 1UHLA 1UPVA 4S0TA 3HODA 5E1CA 4FN9A 2G0HA 3MNEA 3R5NA
chains in the Genus database with same CATH superfamily
5DV8A 3B1MA 1G5YA 1NDEA 5DK9A 3X36A 3VHVA 3Q95B 3ADSA 4POHA 5DKEA 5FQSA 1U3RA 4Q0AC 3VJIA 5DVCA 2OCFA 1XZXX 1Z5XE 2QTUA 5DVSA 3UUDA 3D6DA 3W5RA 1LV2A 2P1UA 4A2JA 4OJ9A 2AX7A 2HVCA 5E0WA 4J5XA 3ZRBA 2AMBA 4E4KA 4REFA 2R6YA 1P93A 2W8YA 3WGPA 4ZJWA 1NRLA 4N1YA 3HC6A 1E3KA 2P7GA 4ZOMA 3CWDA 3F5CA 4IV2A 5KCWA 5GIDA 2B23A 3B5RA 4ZNSA 2QGTA 1ILHA 3OAPA 2PKLA 4MG6A 3OKHA 2QGWA 1N83A 1NYXA 3ET2A 3Q95A 4RZGA 3ZQTA 5KCEA 1QKNA 3R8DA 1LBDA 4OK1A 3ADUA 1WM0X 5GICA 1GS4A 3PCUA 4TV1B 3JZCA 5HYRA 1YA3A 5JI0D 2NV7A 3KFCA 3VHWA 2OAXA 4F9MA 1Y0SA 2PIXA 4ITFA 2AWHA 1M13A 1T76A 2POGA 2HB8A 3A78A 3AZ1A 2YLPA 4JYHA 4Y29A 2FVJA 3VT4A 4LNXA 3W5PA 2PITA 2B1ZA 4E4QA 2QXMA 5C4TA 3UP3A 2I0JA 4KZJA 3GN8A 2O4JA 4J24A 5DY8A 3LBDA 1R20D 4EM9A 1MZNA 4ITEA 3X1HA 2ZNPA 3B0QA 2VSRA 4XAOA 5F9BA 4MGBA 4MDDA 3AUNA 1UOMA 4J5WC 4OZRU 2AA2A 4ZN7A 3HVLA 3KWYA 1L2IA 4X1FA 3OMPA 4L98A 1E3GA 2OUZA 1Z95A 4ZNUA 1XPCA 2QMVA 4DM6A 1S19A 3WFFA 1T63A 5DX3B 1MV9A 2PINA 5KRMA 3W0JA 5KRAA 1R20A 1XJ7A 2ZLAA 4A4WA 4QE8A 5DKGA 3ERDA 1OT7A 2AAXA 4FHHA 2Q59B 4RMEA 4ZO1X 3RLJA 3UU7B 5DVVA 2HAMA 4PP5A 5KRFA 5DXRA 3VRWA 1Z5XU 2ZNQA 3VRTA 3VRVA 4RE8A 3MNOA 4RUOX 5DL4A 4QL8A 4E2JA 4WHGA 3U9QA 5HJPB 2P1VA 2Q3YA 1SR7A 4G1ZA 5DXEA 5DV3A 3K23A 3E00A 1FBYA 4IW6A 4RWVA 4XHDA 5ACCA 1NQ7A 2ZMJA 1TFCA 3X1IA 2Q70A 4PRGA 3K22A 3P0UA 3W0AA 2GP7A 4PWLA 5C4OA 4OARA 3KPZA 4RMDA 1ZDUA 4KZIA 4QJRA 4UDCA 1XP1A 4IUIA 3M7RA 3ZR7A 5IAWA 1M7WA 3F7DA 3G9EA 4R06A 5KCUA 2QPYA 1YY4A 4QK4A 3ADVA 3D90A 3E94A 5LGAA 3FEJA 2ATHA 2LBDA 5DKBA 4PPPA 1SKXA 2G44A 3B3KA 3GWSX 3K8SA 5GIEA 5KROA 1XAPA 3A40X 5E15A 3KYTA 5JJMB 1NUOA 2HWQA 4EMAA 3D24A 4TUZB 5DZ1A 1K74D 4OKBA 5KCTA 2HC4A 1ZEOA 3SP9A 1R6GA 4DMAA 3B0TA 5KCFA 4IQRA 3OLLA 3FALB 1I38A 3L03A 5G3JA 1VJBA 2HASA 3A9EB 3W0GA 3CLDA 1S0XA 3B67A 5EITA 3HO0A 3IPUA 3G8IA 1X78A 2HWRA 3OLFA 5DWIA 5KYAA 5AAVB 2B50A 5CJ6A 1FCYA 1TXIA 2JFAB 2PIWA 3BC5A 4IV4A 4WPFA 1MVCA 1FD0A 2PIOA 4DM8A 4S15A 4ZJRA 2Q5PA 4ZN9A 5DP0A 3WTQA 3ET0A 5HYKA 4TUZA 3OLSA 4JAZA 2QA8B 1DB1A 2XYWA 2YLQA 3VTCA 4J26A 4OEDA 4K7AA 4FNEA 4L96A 2ZNOA 5JY3A 2Q60A 4J5XC 3L1BA 1Y9RA 2AX8A 2PNUA 3A9EA 3O1DA 5E0XA 5AAUA 1NAVA 5G45A 3OSWA 4S0SA 1G50A 3H52A 3PO9A 2Z4JA 2I4JA 2ZK5A 2REWA 3VJTA 5AAVA 1XIUA 4MG7B 2IOGA 4NUFA 2JFAA 2ZK6A 3VT6A 2Q8SA 5DXBB 5C4SA 3DR1A 3OS8C 4YNKA 5IZ0A 3WWRA 3B0WA 4IU7A 3TX7B 5KYJA 2HARA 3IPQA 4DK8A 3HQ5A 1HG4A 4MGCA 3OOFA 4K6IA 4IA1A 5DU5A 3KBAA 3QT0A 2OVMA 2P7AA 4PP3A 3OSAA 4Q50A 4RZFA 4ZNVA 3V9VA 2ZY0A 5HCVA 2R6WA 2P54A 3AUQA 4OH6A 2Q1VA 2J7XA 3G0WA 4HEEX 2VV2A 2GL8A 3LMPA 2ZXZA 4PF3A 5DXBA 2HB7A 3HM1A 3OMQA 3SP6A 1NQ2A 2VV1B 3WT5A 3KDTA 3G8OA 5KCDA 1NQ1A 2H79A 3X31A 4PLEA 4R2UA 1QKMA 2E2RA 2YLOA 3FXVA 3CS8A 4QM0A 3KMGA 2PIPL 3CQVA 1T79A 1N4HA 4IW8A 5FQPA 3B66A 5DZIA 1DKFB 1GWRA 2P15A 2VV0A 3EYBA 1FCXA 5AWJA 3VN2A 1K4WA 2V7CA 3IPSA 1YOWA 1GWQA 2AYRA 5LWPA 4S14A 3GZ9A 2ZK3A 4TV1A 2VV1A 2F4BA 5ICKA 1FM6A 1NQ0A 1SJ0A 2ZNNA 5DWEA 5G46A 5DMCA 2Q5SA 2VSTA 5I4VA 2G5OA 5G42A 1XVPB 1A28A 4OC7A 5DKSA 3S9SA 2PIRA 5B5BA 4UDAA 5APKA 3W5QA 1PQCA 4IA3A 3E00D 1KKQA 4MGDB 2YHDA 4PVUA 2AA7A 4MGAB 4XUMA 1DKFA 2J14A 1PCGA 1QKTA 3H0AD 4UDDA 2Q1HA 5M96A 3ERTA 4K4JA 2ZASA 1KV6A 5DXPA 5DZ0A 2G0GA 2NXXA 3DY6A 1OVLB 2JJ3A 2AA6A 5G43A 3PBAA 5FQVA 3WT6A 3WJ5A 5APJA 3AZ3A 1T7TA 1T74A 5DYBA 5DMFA 4OZTE 2Q7KA 5DX3A 2HBHA 3A3ZX 5HJSA 5HZCA 4PLDA 3V3QA 1EREA 1RKHA 4ONIA 1XP6A 3AN3A 1H9UA 1PZLA 3H0AA 3OKIA 4IVWA 4N8RA 4OGHA 4MGDA 2Q59A 3FEIA 4J5WA 1X7EA 4RUJA 3W0IA 3W0CA 3B65A 1R5KA 4JL4A 3UU7A 5L7EA 4MG8B 3PEQA 1P8DA 1I7GA 2Q7IA 4XLDA 3V9TA 2ZXNA 1OVLA 3OZJA 2ZKCA 4IVYA 3GD2A 5AVLA 1XV9B 2I4PA 5G5WA 5L7HA 5A86A 2YJDA 5HJPA 3AURA 1U9EA 2ZMIA 4NY9A 4OJBA 2ACLB 5DSHA 4LBDA 3GYUA 5ETHA 3VSPA 2AB2A 3VT5A 1X7JA 3P8XA 2YATA 5DWGA 3DZYD 3N00A 1ZH7A 1RJKA 3V3EA 3W5TA 2ZK1A 3FS1A 5DXKA 2ZVTA 4MG8A 1FM9D 2P4YA 2XYJA 4ZI1A 5DIDA 5DWLA 5APHA 3ILZA 2O4RA 2R40A 2Z4BA 4RMCA 4RFWA 3SZ1A 5DRMA 3HLVA 1X7RA 3L3ZA 3R29A 2AXAA 1XV9A 2IOKA 5E14A 4N5GA 4ZNHA 3TKCA 4P6WA 5DUEA 3UUAB 3DZYA 3R2AA 1XP9A 2ACLA 2YFEA 3ADWA 5KCCA 4G2HA 4OILA 5DXGA 1S0ZA 2YLYA 5JJMA 5DI7A 3CS6A 4G2IA 5EHJA 1FM9A 1XLSA 4UDBA 4OEAA 2VV3A 2Q7JA 1ILGA 2PIQA 2GTKA 4XTAA 3FALA 2OZ7A 4OEZA 3FLIA 1KNUA 3WT7A 4NB6A 2NXXE 3ADXA 2NW4A 1G1UA 3V9YA 2QXSA 3R8IA 3VT8A 1UPWA 1IE8A 2FAIA 2JF9A 3VJHA 1ZDTA 1X76A 2A3IA 3UUAA 1XQCA 4OZTU 4X1GA 3T03A 3CTBA 4LNWA 3K6PA 3UUDB 3B68A 5DZ3A 1U3SA 1T7RA 3RY9A 1XOWA 2AX6A 2QA8A 3KDUA 2GPUA 4IWCA 3ADTA 4OLMA 5DZHA 5KRKA 3HC5A 5K13A 1S9PA 2Q5GA 1YIMA 2Q7LA 3O1EA 4N73A 4OHAA 4PP6A 3TKMA 3UVVB 2FSZA 3VT3A 4DORA 3F5CB 3DT3A 3JZBA 1FCZA 2OM9A 1RK3A 3NOAA 5FQTA 4YPQA 2ZXMA 4B7WA 1RKGA 1M2ZA 4MG7A 2I0GA 4PPSA 3OGTA 3V4AA 2VV4B 2H77A 2XKWA 2Q61A 5AWKA 3R8AA 3OOKA 2AMAA 4WQPA 2ABIA 2YJAB 5DIGA 4WHFA 4ZNTA 4CI5A 4APUA 2HFPA 1K7LA 1PDUA 4POJA 3OS9A 5IXKA 4XT9A 5KRHA 3OZ0A 1YP0A 3OSIA 1XDKB 3UUCA 1PQ6A 4MG5A 5DV6A 3BQDA 5EJVA 3KMRA 3UVVA 1FM6D 1PQ9A 3RUUA 2GWXA 5EGVA 3AZ2A 3R5MA 4CSJA 2PIUA 3TY0A 3OS8A 4WLBA 3OMKA 2V0VA 2P7ZA 1ERRA 1I7IA 1XNXA 1YMTA 2AO6A 1SQNA 2ZMHA 3IXPD 2XYXA 3L0JA 1GWXA 4JYIA 1G2NA 2VV4A 3A2IA 2NPAA 3CDSA 2BAWA 2ZFXA 1NAXA 3OMMA 3OMOA 1HJ1A 3CDPA 1YJEA 4G1YA 2XHSA 4HLWA 4MGBB 3DZUD 4RUPA 1XLSE 4QE6A 2ZK2A 3HZFA 1T7FA 4IWFA 1U3QA 5DYDA 3AFRA 1XDKA 2J7YA 4YMQA 1NHZA 1XQ3A 2BJ4B 3PLZA 2ZLCA 5DUGA 4O8FA 5AYGA 2AX9A 3MNPA 3IXPA 2Q6JA 4DK7A 3ZRAA 2O9IA 1ZKYA 4IA7A 4JGVA 4DQMA 3DZUA 1A52A 5E19A 2GIUA 3V49A 2P1TA 5EC9A 4MG9B 4YT1A 1L2JA 5DRJA 4OEYA 4DOSA 3W0YA 3GWXA 4XUHA 2QZOB 5DLRA 4XI3A 3P89A 5DXMA 2Q6RA 2ZK4A 3VT7A 1XVPA 3D5FA 2BJ4A 5AVIA 5GT4A 4IA2A 3VSOA 2POBA 2ZL9A 3NSPA 4PXMA 3VTDA 2J4AA 2I4ZA 5SYZA 5KRLA 1N46A 3VI8A 4MGAA 2GPVA 3FC6B 5L7GA 2AA5A 1I37A 4IS8A 1XB7A 4MG9A 5AK2A 3DCTA 1R1KD 3CS4A 3IA6A 4R6SA 5E7VA 5AZTA 1YOKA 1EXAA 4G20A 3L0LA 3B0RA 2QZOA 3BEJA 3GBKA 4JYGA 2QA6A 2R40D 4OFUA 2Q6SA 4RAKA 4OJ4A 5DWJA 4G1DA 5EI1A 1BSXA 3FURA 5FQRA 2B1VA 3IMYA 3P88A 1ZGYA 2ZBSA 3A2JA 2GPOA 2IHQA 1R1KA 1XNNA 1Y0XX 1PRGA 3PRGA 3FC6A 3VJSA 3D57A 5H1EA 1OSVA 5KRJA 3UP0A 2QW4A 4M8EA 3ET3A 5G44A 5KRIA 4KZMA 3AN4A 4NQAB 5KR9A 2QNVA 4OH5A 5B41A 2EWPA 3VTBA 4G21A 3NSQA 2ZK0A 2QABA 4OKXA 3CJWA 4OIUA 4LTWA 1RDTD 1T73A 2GPPA 2QR9A 3RUTA 4REEA 4ZNWA 2AM9A 2QSEA 5KD9A 3DCUA 3A2HA 4OIVA 2PRGA 4OKTA 3AX8A 4P6XA 3RVFA 1Q4XA 5KRCA 3W0HA 1T65A 2PIVA 3E7CA 1S9QA 1UHLB 3GYTA 3L0EA 2QH6A 5L11A 4WVDA 1YINA 1QKUA 1T5ZA 4RZEA 4BCRA 1X7BA 1RDTA 3WMHA 2OVHA 4FGYA 4M8HA 1IE9A 5DUHA 1T7MA 3WFGA 1EXXA 4OKWA 1YYEA 1ZAFA 1PK5A 4Q13A 3ET1A 3VRUA 5AZVA 3KMZA 1K74A 3FUGA 1YUCA 5DXQA 3L3XA 4OZRE 3RLLA 5DTVA 3VHUA 4OFRA 4CI4A 1ZUCA 2QE4A 2HCDA 4FHIA 4LSJA 4ZO1B 3VT9A 3WJ4A 4A4VA 2PJLA 5C4UA 4NIEA 5DIEA 1OSHA 1UHLA 1UPVA 4S0TA 3HODA 5E1CA 4FN9A 2G0HA 3MNEA 3R5NA
chains in the Genus database with same CATH topology
5DV8A 3B1MA 1G5YA 1NDEA 5DK9A 3X36A 3VHVA 3Q95B 3ADSA 4POHA 5DKEA 5FQSA 1U3RA 4Q0AC 3VJIA 5DVCA 2OCFA 1XZXX 1Z5XE 2QTUA 5DVSA 3UUDA 3D6DA 3W5RA 1LV2A 2P1UA 4A2JA 4OJ9A 2AX7A 2HVCA 5E0WA 4J5XA 3ZRBA 2AMBA 4E4KA 4REFA 2R6YA 1P93A 2W8YA 3WGPA 4ZJWA 1NRLA 4N1YA 3HC6A 1E3KA 2P7GA 4ZOMA 3CWDA 3F5CA 4IV2A 5KCWA 5GIDA 2B23A 3B5RA 4ZNSA 2QGTA 1ILHA 3OAPA 2PKLA 4MG6A 3OKHA 2QGWA 1N83A 1NYXA 3ET2A 3Q95A 4RZGA 3ZQTA 5KCEA 1QKNA 3R8DA 1LBDA 4OK1A 3ADUA 1WM0X 5GICA 1GS4A 3PCUA 4TV1B 3JZCA 5HYRA 1YA3A 5JI0D 2NV7A 3KFCA 3VHWA 2OAXA 4F9MA 1Y0SA 2PIXA 4ITFA 2AWHA 1M13A 1T76A 2POGA 2HB8A 3A78A 3AZ1A 2YLPA 4JYHA 4Y29A 2FVJA 3VT4A 4LNXA 3W5PA 2PITA 2B1ZA 4E4QA 2QXMA 5C4TA 3UP3A 2I0JA 4KZJA 3GN8A 2O4JA 4J24A 5DY8A 3LBDA 1R20D 4EM9A 1MZNA 4ITEA 3X1HA 2ZNPA 3B0QA 2VSRA 4XAOA 5F9BA 4MGBA 4MDDA 3AUNA 1UOMA 4J5WC 4OZRU 2AA2A 4ZN7A 3HVLA 3KWYA 1L2IA 4X1FA 3OMPA 4L98A 1E3GA 2OUZA 1Z95A 4ZNUA 1XPCA 2QMVA 4DM6A 1S19A 3WFFA 1T63A 5DX3B 1MV9A 2PINA 5KRMA 3W0JA 5KRAA 1R20A 1XJ7A 2ZLAA 4A4WA 4QE8A 5DKGA 3ERDA 1OT7A 2AAXA 4FHHA 2Q59B 4RMEA 4ZO1X 3RLJA 3UU7B 5DVVA 2HAMA 4PP5A 5KRFA 5DXRA 3VRWA 1Z5XU 2ZNQA 3VRTA 3VRVA 4RE8A 3MNOA 4RUOX 5DL4A 4QL8A 4E2JA 4WHGA 3U9QA 5HJPB 2P1VA 2Q3YA 1SR7A 4G1ZA 5DXEA 5DV3A 3K23A 3E00A 1FBYA 4IW6A 4RWVA 4XHDA 5ACCA 1NQ7A 2ZMJA 1TFCA 3X1IA 2Q70A 4PRGA 3K22A 3P0UA 3W0AA 2GP7A 4PWLA 5C4OA 4OARA 3KPZA 4RMDA 1ZDUA 4KZIA 4QJRA 4UDCA 1XP1A 4IUIA 3M7RA 3ZR7A 5IAWA 1M7WA 3F7DA 3G9EA 4R06A 5KCUA 2QPYA 1YY4A 4QK4A 3ADVA 3D90A 3E94A 5LGAA 3FEJA 2ATHA 2LBDA 5DKBA 4PPPA 1SKXA 2G44A 3B3KA 3GWSX 3K8SA 5GIEA 5KROA 1XAPA 3A40X 5E15A 3KYTA 5JJMB 1NUOA 2HWQA 4EMAA 3D24A 4TUZB 5DZ1A 1K74D 4OKBA 5KCTA 2HC4A 1ZEOA 3SP9A 1R6GA 4DMAA 3B0TA 5KCFA 4IQRA 3OLLA 3FALB 1I38A 3L03A 5G3JA 1VJBA 2HASA 3A9EB 3W0GA 3CLDA 1S0XA 3B67A 5EITA 3HO0A 3IPUA 3G8IA 1X78A 2HWRA 3OLFA 5DWIA 5KYAA 5AAVB 2B50A 5CJ6A 1FCYA 1TXIA 2JFAB 2PIWA 3BC5A 4IV4A 4WPFA 1MVCA 1FD0A 2PIOA 4DM8A 4S15A 4ZJRA 2Q5PA 4ZN9A 5DP0A 3WTQA 3ET0A 5HYKA 4TUZA 3OLSA 4JAZA 2QA8B 1DB1A 2XYWA 2YLQA 3VTCA 4J26A 4OEDA 4K7AA 4FNEA 4L96A 2ZNOA 5JY3A 2Q60A 4J5XC 3L1BA 1Y9RA 2AX8A 2PNUA 3A9EA 3O1DA 5E0XA 5AAUA 1NAVA 5G45A 3OSWA 4S0SA 1G50A 3H52A 3PO9A 2Z4JA 2I4JA 2ZK5A 2REWA 3VJTA 5AAVA 1XIUA 4MG7B 2IOGA 4NUFA 2JFAA 2ZK6A 3VT6A 2Q8SA 5DXBB 5C4SA 3DR1A 3OS8C 4YNKA 5IZ0A 3WWRA 3B0WA 4IU7A 3TX7B 5KYJA 2HARA 3IPQA 4DK8A 3HQ5A 1HG4A 4MGCA 3OOFA 4K6IA 4IA1A 5DU5A 3KBAA 3QT0A 2OVMA 2P7AA 4PP3A 3OSAA 4Q50A 4RZFA 4ZNVA 3V9VA 2ZY0A 5HCVA 2R6WA 2P54A 3AUQA 4OH6A 2Q1VA 2J7XA 3G0WA 4HEEX 2VV2A 2GL8A 3LMPA 2ZXZA 4PF3A 5DXBA 2HB7A 3HM1A 3OMQA 3SP6A 1NQ2A 2VV1B 3WT5A 3KDTA 3G8OA 5KCDA 1NQ1A 2H79A 3X31A 4PLEA 4R2UA 1QKMA 2E2RA 2YLOA 3FXVA 3CS8A 4QM0A 3KMGA 2PIPL 3CQVA 1T79A 1N4HA 4IW8A 5FQPA 3B66A 5DZIA 1DKFB 1GWRA 2P15A 2VV0A 3EYBA 1FCXA 5AWJA 3VN2A 1K4WA 2V7CA 3IPSA 1YOWA 1GWQA 2AYRA 5LWPA 4S14A 3GZ9A 2ZK3A 4TV1A 2VV1A 2F4BA 5ICKA 1FM6A 1NQ0A 1SJ0A 2ZNNA 5DWEA 5G46A 5DMCA 2Q5SA 2VSTA 5I4VA 2G5OA 5G42A 1XVPB 1A28A 4OC7A 5DKSA 3S9SA 2PIRA 5B5BA 4UDAA 5APKA 3W5QA 1PQCA 4IA3A 3E00D 1KKQA 4MGDB 2YHDA 4PVUA 2AA7A 4MGAB 4XUMA 1DKFA 2J14A 1PCGA 1QKTA 3H0AD 4UDDA 2Q1HA 5M96A 3ERTA 4K4JA 2ZASA 1KV6A 5DXPA 5DZ0A 2G0GA 2NXXA 3DY6A 1OVLB 2JJ3A 2AA6A 5G43A 3PBAA 5FQVA 3WT6A 3WJ5A 5APJA 3AZ3A 1T7TA 1T74A 5DYBA 5DMFA 4OZTE 2Q7KA 5DX3A 2HBHA 3A3ZX 5HJSA 5HZCA 4PLDA 3V3QA 1EREA 1RKHA 4ONIA 1XP6A 3AN3A 1H9UA 1PZLA 3H0AA 3OKIA 4IVWA 4N8RA 4OGHA 4MGDA 2Q59A 3FEIA 4J5WA 1X7EA 4RUJA 3W0IA 3W0CA 3B65A 1R5KA 4JL4A 3UU7A 5L7EA 4MG8B 3PEQA 1P8DA 1I7GA 2Q7IA 4XLDA 3V9TA 2ZXNA 1OVLA 3OZJA 2ZKCA 4IVYA 3GD2A 5AVLA 1XV9B 2I4PA 5G5WA 5L7HA 5A86A 2YJDA 5HJPA 3AURA 1U9EA 2ZMIA 4NY9A 4OJBA 2ACLB 5DSHA 4LBDA 3GYUA 5ETHA 3VSPA 2AB2A 3VT5A 1X7JA 3P8XA 2YATA 5DWGA 3DZYD 3N00A 1ZH7A 1RJKA 3V3EA 3W5TA 2ZK1A 3FS1A 5DXKA 2ZVTA 4MG8A 1FM9D 2P4YA 2XYJA 4ZI1A 5DIDA 5DWLA 5APHA 3ILZA 2O4RA 2R40A 2Z4BA 4RMCA 4RFWA 3SZ1A 5DRMA 3HLVA 1X7RA 3L3ZA 3R29A 2AXAA 1XV9A 2IOKA 5E14A 4N5GA 4ZNHA 3TKCA 4P6WA 5DUEA 3UUAB 3DZYA 3R2AA 1XP9A 2ACLA 2YFEA 3ADWA 5KCCA 4G2HA 4OILA 5DXGA 1S0ZA 2YLYA 5JJMA 5DI7A 3CS6A 4G2IA 5EHJA 1FM9A 1XLSA 4UDBA 4OEAA 2VV3A 2Q7JA 1ILGA 2PIQA 2GTKA 4XTAA 3FALA 2OZ7A 4OEZA 3FLIA 1KNUA 3WT7A 4NB6A 2NXXE 3ADXA 2NW4A 1G1UA 3V9YA 2QXSA 3R8IA 3VT8A 1UPWA 1IE8A 2FAIA 2JF9A 3VJHA 1ZDTA 1X76A 2A3IA 3UUAA 1XQCA 4OZTU 4X1GA 3T03A 3CTBA 4LNWA 3K6PA 3UUDB 3B68A 5DZ3A 1U3SA 1T7RA 3RY9A 1XOWA 2AX6A 2QA8A 3KDUA 2GPUA 4IWCA 3ADTA 4OLMA 5DZHA 5KRKA 3HC5A 5K13A 1S9PA 2Q5GA 1YIMA 2Q7LA 3O1EA 4N73A 4OHAA 4PP6A 3TKMA 3UVVB 2FSZA 3VT3A 4DORA 3F5CB 3DT3A 3JZBA 1FCZA 2OM9A 1RK3A 3NOAA 5FQTA 4YPQA 2ZXMA 4B7WA 1RKGA 1M2ZA 4MG7A 2I0GA 4PPSA 3OGTA 3V4AA 2VV4B 2H77A 2XKWA 2Q61A 5AWKA 3R8AA 3OOKA 2AMAA 4WQPA 2ABIA 2YJAB 5DIGA 4WHFA 4ZNTA 4CI5A 4APUA 2HFPA 1K7LA 1PDUA 4POJA 3OS9A 5IXKA 4XT9A 5KRHA 3OZ0A 1YP0A 3OSIA 1XDKB 3UUCA 1PQ6A 4MG5A 5DV6A 3BQDA 5EJVA 3KMRA 3UVVA 1FM6D 1PQ9A 3RUUA 2GWXA 5EGVA 3AZ2A 3R5MA 4CSJA 2PIUA 3TY0A 3OS8A 4WLBA 3OMKA 2V0VA 2P7ZA 1ERRA 1I7IA 1XNXA 1YMTA 2AO6A 1SQNA 2ZMHA 3IXPD 2XYXA 3L0JA 1GWXA 4JYIA 1G2NA 2VV4A 3A2IA 2NPAA 3CDSA 2BAWA 2ZFXA 1NAXA 3OMMA 3OMOA 1HJ1A 3CDPA 1YJEA 4G1YA 2XHSA 4HLWA 4MGBB 3DZUD 4RUPA 1XLSE 4QE6A 2ZK2A 3HZFA 1T7FA 4IWFA 1U3QA 5DYDA 3AFRA 1XDKA 2J7YA 4YMQA 1NHZA 1XQ3A 2BJ4B 3PLZA 2ZLCA 5DUGA 4O8FA 5AYGA 2AX9A 3MNPA 3IXPA 2Q6JA 4DK7A 3ZRAA 2O9IA 1ZKYA 4IA7A 4JGVA 4DQMA 3DZUA 1A52A 5E19A 2GIUA 3V49A 2P1TA 5EC9A 4MG9B 4YT1A 1L2JA 5DRJA 4OEYA 4DOSA 3W0YA 3GWXA 4XUHA 2QZOB 5DLRA 4XI3A 3P89A 5DXMA 2Q6RA 2ZK4A 3VT7A 1XVPA 3D5FA 2BJ4A 5AVIA 5GT4A 4IA2A 3VSOA 2POBA 2ZL9A 3NSPA 4PXMA 3VTDA 2J4AA 2I4ZA 5SYZA 5KRLA 1N46A 3VI8A 4MGAA 2GPVA 3FC6B 5L7GA 2AA5A 1I37A 4IS8A 1XB7A 4MG9A 5AK2A 3DCTA 1R1KD 3CS4A 3IA6A 4R6SA 5E7VA 5AZTA 1YOKA 1EXAA 4G20A 3L0LA 3B0RA 2QZOA 3BEJA 3GBKA 4JYGA 2QA6A 2R40D 4OFUA 2Q6SA 4RAKA 4OJ4A 5DWJA 4G1DA 5EI1A 1BSXA 3FURA 5FQRA 2B1VA 3IMYA 3P88A 1ZGYA 2ZBSA 3A2JA 2GPOA 2IHQA 1R1KA 1XNNA 1Y0XX 1PRGA 3PRGA 3FC6A 3VJSA 3D57A 5H1EA 1OSVA 5KRJA 3UP0A 2QW4A 4M8EA 3ET3A 5G44A 5KRIA 4KZMA 3AN4A 4NQAB 5KR9A 2QNVA 4OH5A 5B41A 2EWPA 3VTBA 4G21A 3NSQA 2ZK0A 2QABA 4OKXA 3CJWA 4OIUA 4LTWA 1RDTD 1T73A 2GPPA 2QR9A 3RUTA 4REEA 4ZNWA 2AM9A 2QSEA 5KD9A 3DCUA 3A2HA 4OIVA 2PRGA 4OKTA 3AX8A 4P6XA 3RVFA 1Q4XA 5KRCA 3W0HA 1T65A 2PIVA 3E7CA 1S9QA 1UHLB 3GYTA 3L0EA 2QH6A 5L11A 4WVDA 1YINA 1QKUA 1T5ZA 4RZEA 4BCRA 1X7BA 1RDTA 3WMHA 2OVHA 4FGYA 4M8HA 1IE9A 5DUHA 1T7MA 3WFGA 1EXXA 4OKWA 1YYEA 1ZAFA 1PK5A 4Q13A 3ET1A 3VRUA 5AZVA 3KMZA 1K74A 3FUGA 1YUCA 5DXQA 3L3XA 4OZRE 3RLLA 5DTVA 3VHUA 4OFRA 4CI4A 1ZUCA 2QE4A 2HCDA 4FHIA 4LSJA 4ZO1B 3VT9A 3WJ4A 4A4VA 2PJLA 5C4UA 4NIEA 5DIEA 1OSHA 1UHLA 1UPVA 4S0TA 3HODA 5E1CA 4FN9A 2G0HA 3MNEA 3R5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DV8 A;  3B1M A;  1G5Y A;  1NDE A;  5DK9 A;  3X36 A;  3VHV A;  3Q95 B;  3ADS A;  4POH A;  5DKE A;  5FQS A;  1U3R A;  4Q0A C;  3VJI A;  5DVC A;  2OCF A;  1XZX X;  1Z5X E;  2QTU A;  5DVS A;  3UUD A;  3D6D A;  3W5R A;  1LV2 A;  2P1U A;  4A2J A;  4OJ9 A;  2AX7 A;  2HVC A;  5E0W A;  4J5X A;  3ZRB A;  2AMB A;  4E4K A;  4REF A;  2R6Y A;  1P93 A;  2W8Y A;  3WGP A;  4ZJW A;  1NRL A;  4N1Y A;  3HC6 A;  1E3K A;  2P7G A;  4ZOM A;  3CWD A;  3F5C A;  4IV2 A;  5KCW A;  5GID A;  2B23 A;  3B5R A;  4ZNS A;  2QGT A;  1ILH A;  3OAP A;  2PKL A;  4MG6 A;  3OKH A;  2QGW A;  1N83 A;  1NYX A;  3ET2 A;  3Q95 A;  4RZG A;  3ZQT A;  5KCE A;  1QKN A;  3R8D A;  1LBD A;  4OK1 A;  3ADU A;  1WM0 X;  5GIC A;  1GS4 A;  3PCU A;  4TV1 B;  3JZC A;  5HYR A;  1YA3 A;  5JI0 D;  2NV7 A;  3KFC A;  3VHW A;  2OAX A;  4F9M A;  1Y0S A;  2PIX A;  4ITF A;  2AWH A;  1M13 A;  1T76 A;  2POG A;  2HB8 A;  3A78 A;  3AZ1 A;  2YLP A;  4JYH A;  4Y29 A;  2FVJ A;  3VT4 A;  4LNX A;  3W5P A;  2PIT A;  2B1Z A;  4E4Q A;  2QXM A;  5C4T A;  3UP3 A;  2I0J A;  4KZJ A;  3GN8 A;  2O4J A;  4J24 A;  5DY8 A;  3LBD A;  1R20 D;  4EM9 A;  1MZN A;  4ITE A;  3X1H A;  2ZNP A;  3B0Q A;  2VSR A;  4XAO A;  5F9B A;  4MGB A;  4MDD A;  3AUN A;  1UOM A;  4J5W C;  4OZR U;  2AA2 A;  4ZN7 A;  3HVL A;  3KWY A;  1L2I A;  4X1F A;  3OMP A;  4L98 A;  1E3G A;  2OUZ A;  1Z95 A;  4ZNU A;  1XPC A;  2QMV A;  4DM6 A;  1S19 A;  3WFF A;  1T63 A;  5DX3 B;  1MV9 A;  2PIN A;  5KRM A;  3W0J A;  5KRA A;  1R20 A;  1XJ7 A;  2ZLA A;  4A4W A;  4QE8 A;  5DKG A;  3ERD A;  1OT7 A;  2AAX A;  4FHH A;  2Q59 B;  4RME A;  4ZO1 X;  3RLJ A;  3UU7 B;  5DVV A;  2HAM A;  4PP5 A;  5KRF A;  5DXR A;  3VRW A;  1Z5X U;  2ZNQ A;  3VRT A;  3VRV A;  4RE8 A;  3MNO A;  4RUO X;  5DL4 A;  4QL8 A;  4E2J A;  4WHG A;  3U9Q A;  5HJP B;  2P1V A;  2Q3Y A;  1SR7 A;  4G1Z A;  5DXE A;  5DV3 A;  3K23 A;  3E00 A;  1FBY A;  4IW6 A;  4RWV A;  4XHD A;  5ACC A;  1NQ7 A;  2ZMJ A;  1TFC A;  3X1I A;  2Q70 A;  4PRG A;  3K22 A;  3P0U A;  3W0A A;  2GP7 A;  4PWL A;  5C4O A;  4OAR A;  3KPZ A;  4RMD A;  1ZDU A;  4KZI A;  4QJR A;  4UDC A;  1XP1 A;  4IUI A;  3M7R A;  3ZR7 A;  5IAW A;  1M7W A;  3F7D A;  3G9E A;  4R06 A;  5KCU A;  2QPY A;  1YY4 A;  4QK4 A;  3ADV A;  3D90 A;  3E94 A;  5LGA A;  3FEJ A;  2ATH A;  2LBD A;  5DKB A;  4PPP A;  1SKX A;  2G44 A;  3B3K A;  3GWS X;  3K8S A;  5GIE A;  5KRO A;  1XAP A;  3A40 X;  5E15 A;  3KYT A;  5JJM B;  1NUO A;  2HWQ A;  4EMA A;  3D24 A;  4TUZ B;  5DZ1 A;  1K74 D;  4OKB A;  5KCT A;  2HC4 A;  1ZEO A;  3SP9 A;  1R6G A;  4DMA A;  3B0T A;  5KCF A;  4IQR A;  3OLL A;  3FAL B;  1I38 A;  3L03 A;  5G3J A;  1VJB A;  2HAS A;  3A9E B;  3W0G A;  3CLD A;  1S0X A;  3B67 A;  5EIT A;  3HO0 A;  3IPU A;  3G8I A;  1X78 A;  2HWR A;  3OLF A;  5DWI A;  5KYA A;  5AAV B;  2B50 A;  5CJ6 A;  1FCY A;  1TXI A;  2JFA B;  2PIW A;  3BC5 A;  4IV4 A;  4WPF A;  1MVC A;  1FD0 A;  2PIO A;  4DM8 A;  4S15 A;  4ZJR A;  2Q5P A;  4ZN9 A;  5DP0 A;  3WTQ A;  3ET0 A;  5HYK A;  4TUZ A;  3OLS A;  4JAZ A;  2QA8 B;  1DB1 A;  2XYW A;  2YLQ A;  3VTC A;  4J26 A;  4OED A;  4K7A A;  4FNE A;  4L96 A;  2ZNO A;  5JY3 A;  2Q60 A;  4J5X C;  3L1B A;  1Y9R A;  2AX8 A;  2PNU A;  3A9E A;  3O1D A;  5E0X A;  5AAU A;  1NAV A;  5G45 A;  3OSW A;  4S0S A;  1G50 A;  3H52 A;  3PO9 A;  2Z4J A;  2I4J A;  2ZK5 A;  2REW A;  3VJT A;  5AAV A;  1XIU A;  4MG7 B;  2IOG A;  4NUF A;  2JFA A;  2ZK6 A;  3VT6 A;  2Q8S A;  5DXB B;  5C4S A;  3DR1 A;  3OS8 C;  4YNK A;  5IZ0 A;  3WWR A;  3B0W A;  4IU7 A;  3TX7 B;  5KYJ A;  2HAR A;  3IPQ A;  4DK8 A;  3HQ5 A;  1HG4 A;  4MGC A;  3OOF A;  4K6I A;  4IA1 A;  5DU5 A;  3KBA A;  3QT0 A;  2OVM A;  2P7A A;  4PP3 A;  3OSA A;  4Q50 A;  4RZF A;  4ZNV A;  3V9V A;  2ZY0 A;  5HCV A;  2R6W A;  2P54 A;  3AUQ A;  4OH6 A;  2Q1V A;  2J7X A;  3G0W A;  4HEE X;  2VV2 A;  2GL8 A;  3LMP A;  2ZXZ A;  4PF3 A;  5DXB A;  2HB7 A;  3HM1 A;  3OMQ A;  3SP6 A;  1NQ2 A;  2VV1 B;  3WT5 A;  3KDT A;  3G8O A;  5KCD A;  1NQ1 A;  2H79 A;  3X31 A;  4PLE A;  4R2U A;  1QKM A;  2E2R A;  2YLO A;  3FXV A;  3CS8 A;  4QM0 A;  3KMG A;  2PIP L;  3CQV A;  1T79 A;  1N4H A;  4IW8 A;  5FQP A;  3B66 A;  5DZI A;  1DKF B;  1GWR A;  2P15 A;  2VV0 A;  3EYB A;  1FCX A;  5AWJ A;  3VN2 A;  1K4W A;  2V7C A;  3IPS A;  1YOW A;  1GWQ A;  2AYR A;  5LWP A;  4S14 A;  3GZ9 A;  2ZK3 A;  4TV1 A;  2VV1 A;  2F4B A;  5ICK A;  1FM6 A;  1NQ0 A;  1SJ0 A;  2ZNN A;  5DWE A;  5G46 A;  5DMC A;  2Q5S A;  2VST A;  5I4V A;  2G5O A;  5G42 A;  1XVP B;  1A28 A;  4OC7 A;  5DKS A;  3S9S A;  2PIR A;  5B5B A;  4UDA A;  5APK A;  3W5Q A;  1PQC A;  4IA3 A;  3E00 D;  1KKQ A;  4MGD B;  2YHD A;  4PVU A;  2AA7 A;  4MGA B;  4XUM A;  1DKF A;  2J14 A;  1PCG A;  1QKT A;  3H0A D;  4UDD A;  2Q1H A;  5M96 A;  3ERT A;  4K4J A;  2ZAS A;  1KV6 A;  5DXP A;  5DZ0 A;  2G0G A;  2NXX A;  3DY6 A;  1OVL B;  2JJ3 A;  2AA6 A;  5G43 A;  3PBA A;  5FQV A;  3WT6 A;  3WJ5 A;  5APJ A;  3AZ3 A;  1T7T A;  1T74 A;  5DYB A;  5DMF A;  4OZT E;  2Q7K A;  5DX3 A;  2HBH A;  3A3Z X;  5HJS A;  5HZC A;  4PLD A;  3V3Q A;  1ERE A;  1RKH A;  4ONI A;  1XP6 A;  3AN3 A;  1H9U A;  1PZL A;  3H0A A;  3OKI A;  4IVW A;  4N8R A;  4OGH A;  4MGD A;  2Q59 A;  3FEI A;  4J5W A;  1X7E A;  4RUJ A;  3W0I A;  3W0C A;  3B65 A;  1R5K A;  4JL4 A;  3UU7 A;  5L7E A;  4MG8 B;  3PEQ A;  1P8D A;  1I7G A;  2Q7I A;  4XLD A;  3V9T A;  2ZXN A;  1OVL A;  3OZJ A;  2ZKC A;  4IVY A;  3GD2 A;  5AVL A;  1XV9 B;  2I4P A;  5G5W A;  5L7H A;  5A86 A;  2YJD A;  5HJP A;  3AUR A;  1U9E A;  2ZMI A;  4NY9 A;  4OJB A;  2ACL B;  5DSH A;  4LBD A;  3GYU A;  5ETH A;  3VSP A;  2AB2 A;  3VT5 A;  1X7J A;  3P8X A;  2YAT A;  5DWG A;  3DZY D;  3N00 A;  1ZH7 A;  1RJK A;  3V3E A;  3W5T A;  2ZK1 A;  3FS1 A;  5DXK A;  2ZVT A;  4MG8 A;  1FM9 D;  2P4Y A;  2XYJ A;  4ZI1 A;  5DID A;  5DWL A;  5APH A;  3ILZ A;  2O4R A;  2R40 A;  2Z4B A;  4RMC A;  4RFW A;  3SZ1 A;  5DRM A;  3HLV A;  1X7R A;  3L3Z A;  3R29 A;  2AXA A;  1XV9 A;  2IOK A;  5E14 A;  4N5G A;  4ZNH A;  3TKC A;  4P6W A;  5DUE A;  3UUA B;  3DZY A;  3R2A A;  1XP9 A;  2ACL A;  2YFE A;  3ADW A;  5KCC A;  4G2H A;  4OIL A;  5DXG A;  1S0Z A;  2YLY A;  5JJM A;  5DI7 A;  3CS6 A;  4G2I A;  5EHJ A;  1FM9 A;  1XLS A;  4UDB A;  4OEA A;  2VV3 A;  2Q7J A;  1ILG A;  2PIQ A;  2GTK A;  4XTA A;  3FAL A;  2OZ7 A;  4OEZ A;  3FLI A;  1KNU A;  3WT7 A;  4NB6 A;  2NXX E;  3ADX A;  2NW4 A;  1G1U A;  3V9Y A;  2QXS A;  3R8I A;  3VT8 A;  1UPW A;  1IE8 A;  2FAI A;  2JF9 A;  3VJH A;  1ZDT A;  1X76 A;  2A3I A;  3UUA A;  1XQC A;  4OZT U;  4X1G A;  3T03 A;  3CTB A;  4LNW A;  3K6P A;  3UUD B;  3B68 A;  5DZ3 A;  1U3S A;  1T7R A;  3RY9 A;  1XOW A;  2AX6 A;  2QA8 A;  3KDU A;  2GPU A;  4IWC A;  3ADT A;  4OLM A;  5DZH A;  5KRK A;  3HC5 A;  5K13 A;  1S9P A;  2Q5G A;  1YIM A;  2Q7L A;  3O1E A;  4N73 A;  4OHA A;  4PP6 A;  3TKM A;  3UVV B;  2FSZ A;  3VT3 A;  4DOR A;  3F5C B;  3DT3 A;  3JZB A;  1FCZ A;  2OM9 A;  1RK3 A;  3NOA A;  5FQT A;  4YPQ A;  2ZXM A;  4B7W A;  1RKG A;  1M2Z A;  4MG7 A;  2I0G A;  4PPS A;  3OGT A;  3V4A A;  2VV4 B;  2H77 A;  2XKW A;  2Q61 A;  5AWK A;  3R8A A;  3OOK A;  2AMA A;  4WQP A;  2ABI A;  2YJA B;  5DIG A;  4WHF A;  4ZNT A;  4CI5 A;  4APU A;  2HFP A;  1K7L A;  1PDU A;  4POJ A;  3OS9 A;  5IXK A;  4XT9 A;  5KRH A;  3OZ0 A;  1YP0 A;  3OSI A;  1XDK B;  3UUC A;  1PQ6 A;  4MG5 A;  5DV6 A;  3BQD A;  5EJV A;  3KMR A;  3UVV A;  1FM6 D;  1PQ9 A;  3RUU A;  2GWX A;  5EGV A;  3AZ2 A;  3R5M A;  4CSJ A;  2PIU A;  3TY0 A;  3OS8 A;  4WLB A;  3OMK A;  2V0V A;  2P7Z A;  1ERR A;  1I7I A;  1XNX A;  1YMT A;  2AO6 A;  1SQN A;  2ZMH A;  3IXP D;  2XYX A;  3L0J A;  1GWX A;  4JYI A;  1G2N A;  2VV4 A;  3A2I A;  2NPA A;  3CDS A;  2BAW A;  2ZFX A;  1NAX A;  3OMM A;  3OMO A;  1HJ1 A;  3CDP A;  1YJE A;  4G1Y A;  2XHS A;  4HLW A;  4MGB B;  3DZU D;  4RUP A;  1XLS E;  4QE6 A;  2ZK2 A;  3HZF A;  1T7F A;  4IWF A;  1U3Q A;  5DYD A;  3AFR A;  1XDK A;  2J7Y A;  4YMQ A;  1NHZ A;  1XQ3 A;  2BJ4 B;  3PLZ A;  2ZLC A;  5DUG A;  4O8F A;  5AYG A;  2AX9 A;  3MNP A;  3IXP A;  2Q6J A;  4DK7 A;  3ZRA A;  2O9I A;  1ZKY A;  4IA7 A;  4JGV A;  4DQM A;  3DZU A;  1A52 A;  5E19 A;  2GIU A;  3V49 A;  2P1T A;  5EC9 A;  4MG9 B;  4YT1 A;  1L2J A;  5DRJ A;  4OEY A;  4DOS A;  3W0Y A;  3GWX A;  4XUH A;  2QZO B;  5DLR A;  4XI3 A;  3P89 A;  5DXM A;  2Q6R A;  2ZK4 A;  3VT7 A;  1XVP A;  3D5F A;  2BJ4 A;  5AVI A;  5GT4 A;  4IA2 A;  3VSO A;  2POB A;  2ZL9 A;  3NSP A;  4PXM A;  3VTD A;  2J4A A;  2I4Z A;  5SYZ A;  5KRL A;  1N46 A;  3VI8 A;  4MGA A;  2GPV A;  3FC6 B;  5L7G A;  2AA5 A;  1I37 A;  4IS8 A;  1XB7 A;  4MG9 A;  5AK2 A;  3DCT A;  1R1K D;  3CS4 A;  3IA6 A;  4R6S A;  5E7V A;  5AZT A;  1YOK A;  1EXA A;  4G20 A;  3L0L A;  3B0R A;  2QZO A;  3BEJ A;  3GBK A;  4JYG A;  2QA6 A;  2R40 D;  4OFU A;  2Q6S A;  4RAK A;  4OJ4 A;  5DWJ A;  4G1D A;  5EI1 A;  1BSX A;  3FUR A;  5FQR A;  2B1V A;  3IMY A;  3P88 A;  1ZGY A;  2ZBS A;  3A2J A;  2GPO A;  2IHQ A;  1R1K A;  1XNN A;  1Y0X X;  1PRG A;  3PRG A;  3FC6 A;  3VJS A;  3D57 A;  5H1E A;  1OSV A;  5KRJ A;  3UP0 A;  2QW4 A;  4M8E A;  3ET3 A;  5G44 A;  5KRI A;  4KZM A;  3AN4 A;  4NQA B;  5KR9 A;  2QNV A;  4OH5 A;  5B41 A;  2EWP A;  3VTB A;  4G21 A;  3NSQ A;  2ZK0 A;  2QAB A;  4OKX A;  3CJW A;  4OIU A;  4LTW A;  1RDT D;  1T73 A;  2GPP A;  2QR9 A;  3RUT A;  4REE A;  4ZNW A;  2AM9 A;  2QSE A;  5KD9 A;  3DCU A;  3A2H A;  4OIV A;  2PRG A;  4OKT A;  3AX8 A;  4P6X A;  3RVF A;  1Q4X A;  5KRC A;  3W0H A;  1T65 A;  2PIV A;  3E7C A;  1S9Q A;  1UHL B;  3GYT A;  3L0E A;  2QH6 A;  5L11 A;  4WVD A;  1YIN A;  1QKU A;  1T5Z A;  4RZE A;  4BCR A;  1X7B A;  1RDT A;  3WMH A;  2OVH A;  4FGY A;  4M8H A;  1IE9 A;  5DUH A;  1T7M A;  3WFG A;  1EXX A;  4OKW A;  1YYE A;  1ZAF A;  1PK5 A;  4Q13 A;  3ET1 A;  3VRU A;  5AZV A;  3KMZ A;  1K74 A;  3FUG A;  1YUC A;  5DXQ A;  3L3X A;  4OZR E;  3RLL A;  5DTV A;  3VHU A;  4OFR A;  4CI4 A;  1ZUC A;  2QE4 A;  2HCD A;  4FHI A;  4LSJ A;  4ZO1 B;  3VT9 A;  3WJ4 A;  4A4V A;  2PJL A;  5C4U A;  4NIE A;  5DIE A;  1OSH A;  1UHL A;  1UPV A;  4S0T A;  3HOD A;  5E1C A;  4FN9 A;  2G0H A;  3MNE A;  3R5N A; 
#chains in the Genus database with same CATH topology
 5DV8 A;  3B1M A;  1G5Y A;  1NDE A;  5DK9 A;  3X36 A;  3VHV A;  3Q95 B;  3ADS A;  4POH A;  5DKE A;  5FQS A;  1U3R A;  4Q0A C;  3VJI A;  5DVC A;  2OCF A;  1XZX X;  1Z5X E;  2QTU A;  5DVS A;  3UUD A;  3D6D A;  3W5R A;  1LV2 A;  2P1U A;  4A2J A;  4OJ9 A;  2AX7 A;  2HVC A;  5E0W A;  4J5X A;  3ZRB A;  2AMB A;  4E4K A;  4REF A;  2R6Y A;  1P93 A;  2W8Y A;  3WGP A;  4ZJW A;  1NRL A;  4N1Y A;  3HC6 A;  1E3K A;  2P7G A;  4ZOM A;  3CWD A;  3F5C A;  4IV2 A;  5KCW A;  5GID A;  2B23 A;  3B5R A;  4ZNS A;  2QGT A;  1ILH A;  3OAP A;  2PKL A;  4MG6 A;  3OKH A;  2QGW A;  1N83 A;  1NYX A;  3ET2 A;  3Q95 A;  4RZG A;  3ZQT A;  5KCE A;  1QKN A;  3R8D A;  1LBD A;  4OK1 A;  3ADU A;  1WM0 X;  5GIC A;  1GS4 A;  3PCU A;  4TV1 B;  3JZC A;  5HYR A;  1YA3 A;  5JI0 D;  2NV7 A;  3KFC A;  3VHW A;  2OAX A;  4F9M A;  1Y0S A;  2PIX A;  4ITF A;  2AWH A;  1M13 A;  1T76 A;  2POG A;  2HB8 A;  3A78 A;  3AZ1 A;  2YLP A;  4JYH A;  4Y29 A;  2FVJ A;  3VT4 A;  4LNX A;  3W5P A;  2PIT A;  2B1Z A;  4E4Q A;  2QXM A;  5C4T A;  3UP3 A;  2I0J A;  4KZJ A;  3GN8 A;  2O4J A;  4J24 A;  5DY8 A;  3LBD A;  1R20 D;  4EM9 A;  1MZN A;  4ITE A;  3X1H A;  2ZNP A;  3B0Q A;  2VSR A;  4XAO A;  5F9B A;  4MGB A;  4MDD A;  3AUN A;  1UOM A;  4J5W C;  4OZR U;  2AA2 A;  4ZN7 A;  3HVL A;  3KWY A;  1L2I A;  4X1F A;  3OMP A;  4L98 A;  1E3G A;  2OUZ A;  1Z95 A;  4ZNU A;  1XPC A;  2QMV A;  4DM6 A;  1S19 A;  3WFF A;  1T63 A;  5DX3 B;  1MV9 A;  2PIN A;  5KRM A;  3W0J A;  5KRA A;  1R20 A;  1XJ7 A;  2ZLA A;  4A4W A;  4QE8 A;  5DKG A;  3ERD A;  1OT7 A;  2AAX A;  4FHH A;  2Q59 B;  4RME A;  4ZO1 X;  3RLJ A;  3UU7 B;  5DVV A;  2HAM A;  4PP5 A;  5KRF A;  5DXR A;  3VRW A;  1Z5X U;  2ZNQ A;  3VRT A;  3VRV A;  4RE8 A;  3MNO A;  4RUO X;  5DL4 A;  4QL8 A;  4E2J A;  4WHG A;  3U9Q A;  5HJP B;  2P1V A;  2Q3Y A;  1SR7 A;  4G1Z A;  5DXE A;  5DV3 A;  3K23 A;  3E00 A;  1FBY A;  4IW6 A;  4RWV A;  4XHD A;  5ACC A;  1NQ7 A;  2ZMJ A;  1TFC A;  3X1I A;  2Q70 A;  4PRG A;  3K22 A;  3P0U A;  3W0A A;  2GP7 A;  4PWL A;  5C4O A;  4OAR A;  3KPZ A;  4RMD A;  1ZDU A;  4KZI A;  4QJR A;  4UDC A;  1XP1 A;  4IUI A;  3M7R A;  3ZR7 A;  5IAW A;  1M7W A;  3F7D A;  3G9E A;  4R06 A;  5KCU A;  2QPY A;  1YY4 A;  4QK4 A;  3ADV A;  3D90 A;  3E94 A;  5LGA A;  3FEJ A;  2ATH A;  2LBD A;  5DKB A;  4PPP A;  1SKX A;  2G44 A;  3B3K A;  3GWS X;  3K8S A;  5GIE A;  5KRO A;  1XAP A;  3A40 X;  5E15 A;  3KYT A;  5JJM B;  1NUO A;  2HWQ A;  4EMA A;  3D24 A;  4TUZ B;  5DZ1 A;  1K74 D;  4OKB A;  5KCT A;  2HC4 A;  1ZEO A;  3SP9 A;  1R6G A;  4DMA A;  3B0T A;  5KCF A;  4IQR A;  3OLL A;  3FAL B;  1I38 A;  3L03 A;  5G3J A;  1VJB A;  2HAS A;  3A9E B;  3W0G A;  3CLD A;  1S0X A;  3B67 A;  5EIT A;  3HO0 A;  3IPU A;  3G8I A;  1X78 A;  2HWR A;  3OLF A;  5DWI A;  5KYA A;  5AAV B;  2B50 A;  5CJ6 A;  1FCY A;  1TXI A;  2JFA B;  2PIW A;  3BC5 A;  4IV4 A;  4WPF A;  1MVC A;  1FD0 A;  2PIO A;  4DM8 A;  4S15 A;  4ZJR A;  2Q5P A;  4ZN9 A;  5DP0 A;  3WTQ A;  3ET0 A;  5HYK A;  4TUZ A;  3OLS A;  4JAZ A;  2QA8 B;  1DB1 A;  2XYW A;  2YLQ A;  3VTC A;  4J26 A;  4OED A;  4K7A A;  4FNE A;  4L96 A;  2ZNO A;  5JY3 A;  2Q60 A;  4J5X C;  3L1B A;  1Y9R A;  2AX8 A;  2PNU A;  3A9E A;  3O1D A;  5E0X A;  5AAU A;  1NAV A;  5G45 A;  3OSW A;  4S0S A;  1G50 A;  3H52 A;  3PO9 A;  2Z4J A;  2I4J A;  2ZK5 A;  2REW A;  3VJT A;  5AAV A;  1XIU A;  4MG7 B;  2IOG A;  4NUF A;  2JFA A;  2ZK6 A;  3VT6 A;  2Q8S A;  5DXB B;  5C4S A;  3DR1 A;  3OS8 C;  4YNK A;  5IZ0 A;  3WWR A;  3B0W A;  4IU7 A;  3TX7 B;  5KYJ A;  2HAR A;  3IPQ A;  4DK8 A;  3HQ5 A;  1HG4 A;  4MGC A;  3OOF A;  4K6I A;  4IA1 A;  5DU5 A;  3KBA A;  3QT0 A;  2OVM A;  2P7A A;  4PP3 A;  3OSA A;  4Q50 A;  4RZF A;  4ZNV A;  3V9V A;  2ZY0 A;  5HCV A;  2R6W A;  2P54 A;  3AUQ A;  4OH6 A;  2Q1V A;  2J7X A;  3G0W A;  4HEE X;  2VV2 A;  2GL8 A;  3LMP A;  2ZXZ A;  4PF3 A;  5DXB A;  2HB7 A;  3HM1 A;  3OMQ A;  3SP6 A;  1NQ2 A;  2VV1 B;  3WT5 A;  3KDT A;  3G8O A;  5KCD A;  1NQ1 A;  2H79 A;  3X31 A;  4PLE A;  4R2U A;  1QKM A;  2E2R A;  2YLO A;  3FXV A;  3CS8 A;  4QM0 A;  3KMG A;  2PIP L;  3CQV A;  1T79 A;  1N4H A;  4IW8 A;  5FQP A;  3B66 A;  5DZI A;  1DKF B;  1GWR A;  2P15 A;  2VV0 A;  3EYB A;  1FCX A;  5AWJ A;  3VN2 A;  1K4W A;  2V7C A;  3IPS A;  1YOW A;  1GWQ A;  2AYR A;  5LWP A;  4S14 A;  3GZ9 A;  2ZK3 A;  4TV1 A;  2VV1 A;  2F4B A;  5ICK A;  1FM6 A;  1NQ0 A;  1SJ0 A;  2ZNN A;  5DWE A;  5G46 A;  5DMC A;  2Q5S A;  2VST A;  5I4V A;  2G5O A;  5G42 A;  1XVP B;  1A28 A;  4OC7 A;  5DKS A;  3S9S A;  2PIR A;  5B5B A;  4UDA A;  5APK A;  3W5Q A;  1PQC A;  4IA3 A;  3E00 D;  1KKQ A;  4MGD B;  2YHD A;  4PVU A;  2AA7 A;  4MGA B;  4XUM A;  1DKF A;  2J14 A;  1PCG A;  1QKT A;  3H0A D;  4UDD A;  2Q1H A;  5M96 A;  3ERT A;  4K4J A;  2ZAS A;  1KV6 A;  5DXP A;  5DZ0 A;  2G0G A;  2NXX A;  3DY6 A;  1OVL B;  2JJ3 A;  2AA6 A;  5G43 A;  3PBA A;  5FQV A;  3WT6 A;  3WJ5 A;  5APJ A;  3AZ3 A;  1T7T A;  1T74 A;  5DYB A;  5DMF A;  4OZT E;  2Q7K A;  5DX3 A;  2HBH A;  3A3Z X;  5HJS A;  5HZC A;  4PLD A;  3V3Q A;  1ERE A;  1RKH A;  4ONI A;  1XP6 A;  3AN3 A;  1H9U A;  1PZL A;  3H0A A;  3OKI A;  4IVW A;  4N8R A;  4OGH A;  4MGD A;  2Q59 A;  3FEI A;  4J5W A;  1X7E A;  4RUJ A;  3W0I A;  3W0C A;  3B65 A;  1R5K A;  4JL4 A;  3UU7 A;  5L7E A;  4MG8 B;  3PEQ A;  1P8D A;  1I7G A;  2Q7I A;  4XLD A;  3V9T A;  2ZXN A;  1OVL A;  3OZJ A;  2ZKC A;  4IVY A;  3GD2 A;  5AVL A;  1XV9 B;  2I4P A;  5G5W A;  5L7H A;  5A86 A;  2YJD A;  5HJP A;  3AUR A;  1U9E A;  2ZMI A;  4NY9 A;  4OJB A;  2ACL B;  5DSH A;  4LBD A;  3GYU A;  5ETH A;  3VSP A;  2AB2 A;  3VT5 A;  1X7J A;  3P8X A;  2YAT A;  5DWG A;  3DZY D;  3N00 A;  1ZH7 A;  1RJK A;  3V3E A;  3W5T A;  2ZK1 A;  3FS1 A;  5DXK A;  2ZVT A;  4MG8 A;  1FM9 D;  2P4Y A;  2XYJ A;  4ZI1 A;  5DID A;  5DWL A;  5APH A;  3ILZ A;  2O4R A;  2R40 A;  2Z4B A;  4RMC A;  4RFW A;  3SZ1 A;  5DRM A;  3HLV A;  1X7R A;  3L3Z A;  3R29 A;  2AXA A;  1XV9 A;  2IOK A;  5E14 A;  4N5G A;  4ZNH A;  3TKC A;  4P6W A;  5DUE A;  3UUA B;  3DZY A;  3R2A A;  1XP9 A;  2ACL A;  2YFE A;  3ADW A;  5KCC A;  4G2H A;  4OIL A;  5DXG A;  1S0Z A;  2YLY A;  5JJM A;  5DI7 A;  3CS6 A;  4G2I A;  5EHJ A;  1FM9 A;  1XLS A;  4UDB A;  4OEA A;  2VV3 A;  2Q7J A;  1ILG A;  2PIQ A;  2GTK A;  4XTA A;  3FAL A;  2OZ7 A;  4OEZ A;  3FLI A;  1KNU A;  3WT7 A;  4NB6 A;  2NXX E;  3ADX A;  2NW4 A;  1G1U A;  3V9Y A;  2QXS A;  3R8I A;  3VT8 A;  1UPW A;  1IE8 A;  2FAI A;  2JF9 A;  3VJH A;  1ZDT A;  1X76 A;  2A3I A;  3UUA A;  1XQC A;  4OZT U;  4X1G A;  3T03 A;  3CTB A;  4LNW A;  3K6P A;  3UUD B;  3B68 A;  5DZ3 A;  1U3S A;  1T7R A;  3RY9 A;  1XOW A;  2AX6 A;  2QA8 A;  3KDU A;  2GPU A;  4IWC A;  3ADT A;  4OLM A;  5DZH A;  5KRK A;  3HC5 A;  5K13 A;  1S9P A;  2Q5G A;  1YIM A;  2Q7L A;  3O1E A;  4N73 A;  4OHA A;  4PP6 A;  3TKM A;  3UVV B;  2FSZ A;  3VT3 A;  4DOR A;  3F5C B;  3DT3 A;  3JZB A;  1FCZ A;  2OM9 A;  1RK3 A;  3NOA A;  5FQT A;  4YPQ A;  2ZXM A;  4B7W A;  1RKG A;  1M2Z A;  4MG7 A;  2I0G A;  4PPS A;  3OGT A;  3V4A A;  2VV4 B;  2H77 A;  2XKW A;  2Q61 A;  5AWK A;  3R8A A;  3OOK A;  2AMA A;  4WQP A;  2ABI A;  2YJA B;  5DIG A;  4WHF A;  4ZNT A;  4CI5 A;  4APU A;  2HFP A;  1K7L A;  1PDU A;  4POJ A;  3OS9 A;  5IXK A;  4XT9 A;  5KRH A;  3OZ0 A;  1YP0 A;  3OSI A;  1XDK B;  3UUC A;  1PQ6 A;  4MG5 A;  5DV6 A;  3BQD A;  5EJV A;  3KMR A;  3UVV A;  1FM6 D;  1PQ9 A;  3RUU A;  2GWX A;  5EGV A;  3AZ2 A;  3R5M A;  4CSJ A;  2PIU A;  3TY0 A;  3OS8 A;  4WLB A;  3OMK A;  2V0V A;  2P7Z A;  1ERR A;  1I7I A;  1XNX A;  1YMT A;  2AO6 A;  1SQN A;  2ZMH A;  3IXP D;  2XYX A;  3L0J A;  1GWX A;  4JYI A;  1G2N A;  2VV4 A;  3A2I A;  2NPA A;  3CDS A;  2BAW A;  2ZFX A;  1NAX A;  3OMM A;  3OMO A;  1HJ1 A;  3CDP A;  1YJE A;  4G1Y A;  2XHS A;  4HLW A;  4MGB B;  3DZU D;  4RUP A;  1XLS E;  4QE6 A;  2ZK2 A;  3HZF A;  1T7F A;  4IWF A;  1U3Q A;  5DYD A;  3AFR A;  1XDK A;  2J7Y A;  4YMQ A;  1NHZ A;  1XQ3 A;  2BJ4 B;  3PLZ A;  2ZLC A;  5DUG A;  4O8F A;  5AYG A;  2AX9 A;  3MNP A;  3IXP A;  2Q6J A;  4DK7 A;  3ZRA A;  2O9I A;  1ZKY A;  4IA7 A;  4JGV A;  4DQM A;  3DZU A;  1A52 A;  5E19 A;  2GIU A;  3V49 A;  2P1T A;  5EC9 A;  4MG9 B;  4YT1 A;  1L2J A;  5DRJ A;  4OEY A;  4DOS A;  3W0Y A;  3GWX A;  4XUH A;  2QZO B;  5DLR A;  4XI3 A;  3P89 A;  5DXM A;  2Q6R A;  2ZK4 A;  3VT7 A;  1XVP A;  3D5F A;  2BJ4 A;  5AVI A;  5GT4 A;  4IA2 A;  3VSO A;  2POB A;  2ZL9 A;  3NSP A;  4PXM A;  3VTD A;  2J4A A;  2I4Z A;  5SYZ A;  5KRL A;  1N46 A;  3VI8 A;  4MGA A;  2GPV A;  3FC6 B;  5L7G A;  2AA5 A;  1I37 A;  4IS8 A;  1XB7 A;  4MG9 A;  5AK2 A;  3DCT A;  1R1K D;  3CS4 A;  3IA6 A;  4R6S A;  5E7V A;  5AZT A;  1YOK A;  1EXA A;  4G20 A;  3L0L A;  3B0R A;  2QZO A;  3BEJ A;  3GBK A;  4JYG A;  2QA6 A;  2R40 D;  4OFU A;  2Q6S A;  4RAK A;  4OJ4 A;  5DWJ A;  4G1D A;  5EI1 A;  1BSX A;  3FUR A;  5FQR A;  2B1V A;  3IMY A;  3P88 A;  1ZGY A;  2ZBS A;  3A2J A;  2GPO A;  2IHQ A;  1R1K A;  1XNN A;  1Y0X X;  1PRG A;  3PRG A;  3FC6 A;  3VJS A;  3D57 A;  5H1E A;  1OSV A;  5KRJ A;  3UP0 A;  2QW4 A;  4M8E A;  3ET3 A;  5G44 A;  5KRI A;  4KZM A;  3AN4 A;  4NQA B;  5KR9 A;  2QNV A;  4OH5 A;  5B41 A;  2EWP A;  3VTB A;  4G21 A;  3NSQ A;  2ZK0 A;  2QAB A;  4OKX A;  3CJW A;  4OIU A;  4LTW A;  1RDT D;  1T73 A;  2GPP A;  2QR9 A;  3RUT A;  4REE A;  4ZNW A;  2AM9 A;  2QSE A;  5KD9 A;  3DCU A;  3A2H A;  4OIV A;  2PRG A;  4OKT A;  3AX8 A;  4P6X A;  3RVF A;  1Q4X A;  5KRC A;  3W0H A;  1T65 A;  2PIV A;  3E7C A;  1S9Q A;  1UHL B;  3GYT A;  3L0E A;  2QH6 A;  5L11 A;  4WVD A;  1YIN A;  1QKU A;  1T5Z A;  4RZE A;  4BCR A;  1X7B A;  1RDT A;  3WMH A;  2OVH A;  4FGY A;  4M8H A;  1IE9 A;  5DUH A;  1T7M A;  3WFG A;  1EXX A;  4OKW A;  1YYE A;  1ZAF A;  1PK5 A;  4Q13 A;  3ET1 A;  3VRU A;  5AZV A;  3KMZ A;  1K74 A;  3FUG A;  1YUC A;  5DXQ A;  3L3X A;  4OZR E;  3RLL A;  5DTV A;  3VHU A;  4OFR A;  4CI4 A;  1ZUC A;  2QE4 A;  2HCD A;  4FHI A;  4LSJ A;  4ZO1 B;  3VT9 A;  3WJ4 A;  4A4V A;  2PJL A;  5C4U A;  4NIE A;  5DIE A;  1OSH A;  1UHL A;  1UPV A;  4S0T A;  3HOD A;  5E1C A;  4FN9 A;  2G0H A;  3MNE A;  3R5N A; 
#chains in the Genus database with same CATH homology
 5DV8 A;  3B1M A;  1G5Y A;  1NDE A;  5DK9 A;  3X36 A;  3VHV A;  3Q95 B;  3ADS A;  4POH A;  5DKE A;  5FQS A;  1U3R A;  4Q0A C;  3VJI A;  5DVC A;  2OCF A;  1XZX X;  1Z5X E;  2QTU A;  5DVS A;  3UUD A;  3D6D A;  3W5R A;  1LV2 A;  2P1U A;  4A2J A;  4OJ9 A;  2AX7 A;  2HVC A;  5E0W A;  4J5X A;  3ZRB A;  2AMB A;  4E4K A;  4REF A;  2R6Y A;  1P93 A;  2W8Y A;  3WGP A;  4ZJW A;  1NRL A;  4N1Y A;  3HC6 A;  1E3K A;  2P7G A;  4ZOM A;  3CWD A;  3F5C A;  4IV2 A;  5KCW A;  5GID A;  2B23 A;  3B5R A;  4ZNS A;  2QGT A;  1ILH A;  3OAP A;  2PKL A;  4MG6 A;  3OKH A;  2QGW A;  1N83 A;  1NYX A;  3ET2 A;  3Q95 A;  4RZG A;  3ZQT A;  5KCE A;  1QKN A;  3R8D A;  1LBD A;  4OK1 A;  3ADU A;  1WM0 X;  5GIC A;  1GS4 A;  3PCU A;  4TV1 B;  3JZC A;  5HYR A;  1YA3 A;  5JI0 D;  2NV7 A;  3KFC A;  3VHW A;  2OAX A;  4F9M A;  1Y0S A;  2PIX A;  4ITF A;  2AWH A;  1M13 A;  1T76 A;  2POG A;  2HB8 A;  3A78 A;  3AZ1 A;  2YLP A;  4JYH A;  4Y29 A;  2FVJ A;  3VT4 A;  4LNX A;  3W5P A;  2PIT A;  2B1Z A;  4E4Q A;  2QXM A;  5C4T A;  3UP3 A;  2I0J A;  4KZJ A;  3GN8 A;  2O4J A;  4J24 A;  5DY8 A;  3LBD A;  1R20 D;  4EM9 A;  1MZN A;  4ITE A;  3X1H A;  2ZNP A;  3B0Q A;  2VSR A;  4XAO A;  5F9B A;  4MGB A;  4MDD A;  3AUN A;  1UOM A;  4J5W C;  4OZR U;  2AA2 A;  4ZN7 A;  3HVL A;  3KWY A;  1L2I A;  4X1F A;  3OMP A;  4L98 A;  1E3G A;  2OUZ A;  1Z95 A;  4ZNU A;  1XPC A;  2QMV A;  4DM6 A;  1S19 A;  3WFF A;  1T63 A;  5DX3 B;  1MV9 A;  2PIN A;  5KRM A;  3W0J A;  5KRA A;  1R20 A;  1XJ7 A;  2ZLA A;  4A4W A;  4QE8 A;  5DKG A;  3ERD A;  1OT7 A;  2AAX A;  4FHH A;  2Q59 B;  4RME A;  4ZO1 X;  3RLJ A;  3UU7 B;  5DVV A;  2HAM A;  4PP5 A;  5KRF A;  5DXR A;  3VRW A;  1Z5X U;  2ZNQ A;  3VRT A;  3VRV A;  4RE8 A;  3MNO A;  4RUO X;  5DL4 A;  4QL8 A;  4E2J A;  4WHG A;  3U9Q A;  5HJP B;  2P1V A;  2Q3Y A;  1SR7 A;  4G1Z A;  5DXE A;  5DV3 A;  3K23 A;  3E00 A;  1FBY A;  4IW6 A;  4RWV A;  4XHD A;  5ACC A;  1NQ7 A;  2ZMJ A;  1TFC A;  3X1I A;  2Q70 A;  4PRG A;  3K22 A;  3P0U A;  3W0A A;  2GP7 A;  4PWL A;  5C4O A;  4OAR A;  3KPZ A;  4RMD A;  1ZDU A;  4KZI A;  4QJR A;  4UDC A;  1XP1 A;  4IUI A;  3M7R A;  3ZR7 A;  5IAW A;  1M7W A;  3F7D A;  3G9E A;  4R06 A;  5KCU A;  2QPY A;  1YY4 A;  4QK4 A;  3ADV A;  3D90 A;  3E94 A;  5LGA A;  3FEJ A;  2ATH A;  2LBD A;  5DKB A;  4PPP A;  1SKX A;  2G44 A;  3B3K A;  3GWS X;  3K8S A;  5GIE A;  5KRO A;  1XAP A;  3A40 X;  5E15 A;  3KYT A;  5JJM B;  1NUO A;  2HWQ A;  4EMA A;  3D24 A;  4TUZ B;  5DZ1 A;  1K74 D;  4OKB A;  5KCT A;  2HC4 A;  1ZEO A;  3SP9 A;  1R6G A;  4DMA A;  3B0T A;  5KCF A;  4IQR A;  3OLL A;  3FAL B;  1I38 A;  3L03 A;  5G3J A;  1VJB A;  2HAS A;  3A9E B;  3W0G A;  3CLD A;  1S0X A;  3B67 A;  5EIT A;  3HO0 A;  3IPU A;  3G8I A;  1X78 A;  2HWR A;  3OLF A;  5DWI A;  5KYA A;  5AAV B;  2B50 A;  5CJ6 A;  1FCY A;  1TXI A;  2JFA B;  2PIW A;  3BC5 A;  4IV4 A;  4WPF A;  1MVC A;  1FD0 A;  2PIO A;  4DM8 A;  4S15 A;  4ZJR A;  2Q5P A;  4ZN9 A;  5DP0 A;  3WTQ A;  3ET0 A;  5HYK A;  4TUZ A;  3OLS A;  4JAZ A;  2QA8 B;  1DB1 A;  2XYW A;  2YLQ A;  3VTC A;  4J26 A;  4OED A;  4K7A A;  4FNE A;  4L96 A;  2ZNO A;  5JY3 A;  2Q60 A;  4J5X C;  3L1B A;  1Y9R A;  2AX8 A;  2PNU A;  3A9E A;  3O1D A;  5E0X A;  5AAU A;  1NAV A;  5G45 A;  3OSW A;  4S0S A;  1G50 A;  3H52 A;  3PO9 A;  2Z4J A;  2I4J A;  2ZK5 A;  2REW A;  3VJT A;  5AAV A;  1XIU A;  4MG7 B;  2IOG A;  4NUF A;  2JFA A;  2ZK6 A;  3VT6 A;  2Q8S A;  5DXB B;  5C4S A;  3DR1 A;  3OS8 C;  4YNK A;  5IZ0 A;  3WWR A;  3B0W A;  4IU7 A;  3TX7 B;  5KYJ A;  2HAR A;  3IPQ A;  4DK8 A;  3HQ5 A;  1HG4 A;  4MGC A;  3OOF A;  4K6I A;  4IA1 A;  5DU5 A;  3KBA A;  3QT0 A;  2OVM A;  2P7A A;  4PP3 A;  3OSA A;  4Q50 A;  4RZF A;  4ZNV A;  3V9V A;  2ZY0 A;  5HCV A;  2R6W A;  2P54 A;  3AUQ A;  4OH6 A;  2Q1V A;  2J7X A;  3G0W A;  4HEE X;  2VV2 A;  2GL8 A;  3LMP A;  2ZXZ A;  4PF3 A;  5DXB A;  2HB7 A;  3HM1 A;  3OMQ A;  3SP6 A;  1NQ2 A;  2VV1 B;  3WT5 A;  3KDT A;  3G8O A;  5KCD A;  1NQ1 A;  2H79 A;  3X31 A;  4PLE A;  4R2U A;  1QKM A;  2E2R A;  2YLO A;  3FXV A;  3CS8 A;  4QM0 A;  3KMG A;  2PIP L;  3CQV A;  1T79 A;  1N4H A;  4IW8 A;  5FQP A;  3B66 A;  5DZI A;  1DKF B;  1GWR A;  2P15 A;  2VV0 A;  3EYB A;  1FCX A;  5AWJ A;  3VN2 A;  1K4W A;  2V7C A;  3IPS A;  1YOW A;  1GWQ A;  2AYR A;  5LWP A;  4S14 A;  3GZ9 A;  2ZK3 A;  4TV1 A;  2VV1 A;  2F4B A;  5ICK A;  1FM6 A;  1NQ0 A;  1SJ0 A;  2ZNN A;  5DWE A;  5G46 A;  5DMC A;  2Q5S A;  2VST A;  5I4V A;  2G5O A;  5G42 A;  1XVP B;  1A28 A;  4OC7 A;  5DKS A;  3S9S A;  2PIR A;  5B5B A;  4UDA A;  5APK A;  3W5Q A;  1PQC A;  4IA3 A;  3E00 D;  1KKQ A;  4MGD B;  2YHD A;  4PVU A;  2AA7 A;  4MGA B;  4XUM A;  1DKF A;  2J14 A;  1PCG A;  1QKT A;  3H0A D;  4UDD A;  2Q1H A;  5M96 A;  3ERT A;  4K4J A;  2ZAS A;  1KV6 A;  5DXP A;  5DZ0 A;  2G0G A;  2NXX A;  3DY6 A;  1OVL B;  2JJ3 A;  2AA6 A;  5G43 A;  3PBA A;  5FQV A;  3WT6 A;  3WJ5 A;  5APJ A;  3AZ3 A;  1T7T A;  1T74 A;  5DYB A;  5DMF A;  4OZT E;  2Q7K A;  5DX3 A;  2HBH A;  3A3Z X;  5HJS A;  5HZC A;  4PLD A;  3V3Q A;  1ERE A;  1RKH A;  4ONI A;  1XP6 A;  3AN3 A;  1H9U A;  1PZL A;  3H0A A;  3OKI A;  4IVW A;  4N8R A;  4OGH A;  4MGD A;  2Q59 A;  3FEI A;  4J5W A;  1X7E A;  4RUJ A;  3W0I A;  3W0C A;  3B65 A;  1R5K A;  4JL4 A;  3UU7 A;  5L7E A;  4MG8 B;  3PEQ A;  1P8D A;  1I7G A;  2Q7I A;  4XLD A;  3V9T A;  2ZXN A;  1OVL A;  3OZJ A;  2ZKC A;  4IVY A;  3GD2 A;  5AVL A;  1XV9 B;  2I4P A;  5G5W A;  5L7H A;  5A86 A;  2YJD A;  5HJP A;  3AUR A;  1U9E A;  2ZMI A;  4NY9 A;  4OJB A;  2ACL B;  5DSH A;  4LBD A;  3GYU A;  5ETH A;  3VSP A;  2AB2 A;  3VT5 A;  1X7J A;  3P8X A;  2YAT A;  5DWG A;  3DZY D;  3N00 A;  1ZH7 A;  1RJK A;  3V3E A;  3W5T A;  2ZK1 A;  3FS1 A;  5DXK A;  2ZVT A;  4MG8 A;  1FM9 D;  2P4Y A;  2XYJ A;  4ZI1 A;  5DID A;  5DWL A;  5APH A;  3ILZ A;  2O4R A;  2R40 A;  2Z4B A;  4RMC A;  4RFW A;  3SZ1 A;  5DRM A;  3HLV A;  1X7R A;  3L3Z A;  3R29 A;  2AXA A;  1XV9 A;  2IOK A;  5E14 A;  4N5G A;  4ZNH A;  3TKC A;  4P6W A;  5DUE A;  3UUA B;  3DZY A;  3R2A A;  1XP9 A;  2ACL A;  2YFE A;  3ADW A;  5KCC A;  4G2H A;  4OIL A;  5DXG A;  1S0Z A;  2YLY A;  5JJM A;  5DI7 A;  3CS6 A;  4G2I A;  5EHJ A;  1FM9 A;  1XLS A;  4UDB A;  4OEA A;  2VV3 A;  2Q7J A;  1ILG A;  2PIQ A;  2GTK A;  4XTA A;  3FAL A;  2OZ7 A;  4OEZ A;  3FLI A;  1KNU A;  3WT7 A;  4NB6 A;  2NXX E;  3ADX A;  2NW4 A;  1G1U A;  3V9Y A;  2QXS A;  3R8I A;  3VT8 A;  1UPW A;  1IE8 A;  2FAI A;  2JF9 A;  3VJH A;  1ZDT A;  1X76 A;  2A3I A;  3UUA A;  1XQC A;  4OZT U;  4X1G A;  3T03 A;  3CTB A;  4LNW A;  3K6P A;  3UUD B;  3B68 A;  5DZ3 A;  1U3S A;  1T7R A;  3RY9 A;  1XOW A;  2AX6 A;  2QA8 A;  3KDU A;  2GPU A;  4IWC A;  3ADT A;  4OLM A;  5DZH A;  5KRK A;  3HC5 A;  5K13 A;  1S9P A;  2Q5G A;  1YIM A;  2Q7L A;  3O1E A;  4N73 A;  4OHA A;  4PP6 A;  3TKM A;  3UVV B;  2FSZ A;  3VT3 A;  4DOR A;  3F5C B;  3DT3 A;  3JZB A;  1FCZ A;  2OM9 A;  1RK3 A;  3NOA A;  5FQT A;  4YPQ A;  2ZXM A;  4B7W A;  1RKG A;  1M2Z A;  4MG7 A;  2I0G A;  4PPS A;  3OGT A;  3V4A A;  2VV4 B;  2H77 A;  2XKW A;  2Q61 A;  5AWK A;  3R8A A;  3OOK A;  2AMA A;  4WQP A;  2ABI A;  2YJA B;  5DIG A;  4WHF A;  4ZNT A;  4CI5 A;  4APU A;  2HFP A;  1K7L A;  1PDU A;  4POJ A;  3OS9 A;  5IXK A;  4XT9 A;  5KRH A;  3OZ0 A;  1YP0 A;  3OSI A;  1XDK B;  3UUC A;  1PQ6 A;  4MG5 A;  5DV6 A;  3BQD A;  5EJV A;  3KMR A;  3UVV A;  1FM6 D;  1PQ9 A;  3RUU A;  2GWX A;  5EGV A;  3AZ2 A;  3R5M A;  4CSJ A;  2PIU A;  3TY0 A;  3OS8 A;  4WLB A;  3OMK A;  2V0V A;  2P7Z A;  1ERR A;  1I7I A;  1XNX A;  1YMT A;  2AO6 A;  1SQN A;  2ZMH A;  3IXP D;  2XYX A;  3L0J A;  1GWX A;  4JYI A;  1G2N A;  2VV4 A;  3A2I A;  2NPA A;  3CDS A;  2BAW A;  2ZFX A;  1NAX A;  3OMM A;  3OMO A;  1HJ1 A;  3CDP A;  1YJE A;  4G1Y A;  2XHS A;  4HLW A;  4MGB B;  3DZU D;  4RUP A;  1XLS E;  4QE6 A;  2ZK2 A;  3HZF A;  1T7F A;  4IWF A;  1U3Q A;  5DYD A;  3AFR A;  1XDK A;  2J7Y A;  4YMQ A;  1NHZ A;  1XQ3 A;  2BJ4 B;  3PLZ A;  2ZLC A;  5DUG A;  4O8F A;  5AYG A;  2AX9 A;  3MNP A;  3IXP A;  2Q6J A;  4DK7 A;  3ZRA A;  2O9I A;  1ZKY A;  4IA7 A;  4JGV A;  4DQM A;  3DZU A;  1A52 A;  5E19 A;  2GIU A;  3V49 A;  2P1T A;  5EC9 A;  4MG9 B;  4YT1 A;  1L2J A;  5DRJ A;  4OEY A;  4DOS A;  3W0Y A;  3GWX A;  4XUH A;  2QZO B;  5DLR A;  4XI3 A;  3P89 A;  5DXM A;  2Q6R A;  2ZK4 A;  3VT7 A;  1XVP A;  3D5F A;  2BJ4 A;  5AVI A;  5GT4 A;  4IA2 A;  3VSO A;  2POB A;  2ZL9 A;  3NSP A;  4PXM A;  3VTD A;  2J4A A;  2I4Z A;  5SYZ A;  5KRL A;  1N46 A;  3VI8 A;  4MGA A;  2GPV A;  3FC6 B;  5L7G A;  2AA5 A;  1I37 A;  4IS8 A;  1XB7 A;  4MG9 A;  5AK2 A;  3DCT A;  1R1K D;  3CS4 A;  3IA6 A;  4R6S A;  5E7V A;  5AZT A;  1YOK A;  1EXA A;  4G20 A;  3L0L A;  3B0R A;  2QZO A;  3BEJ A;  3GBK A;  4JYG A;  2QA6 A;  2R40 D;  4OFU A;  2Q6S A;  4RAK A;  4OJ4 A;  5DWJ A;  4G1D A;  5EI1 A;  1BSX A;  3FUR A;  5FQR A;  2B1V A;  3IMY A;  3P88 A;  1ZGY A;  2ZBS A;  3A2J A;  2GPO A;  2IHQ A;  1R1K A;  1XNN A;  1Y0X X;  1PRG A;  3PRG A;  3FC6 A;  3VJS A;  3D57 A;  5H1E A;  1OSV A;  5KRJ A;  3UP0 A;  2QW4 A;  4M8E A;  3ET3 A;  5G44 A;  5KRI A;  4KZM A;  3AN4 A;  4NQA B;  5KR9 A;  2QNV A;  4OH5 A;  5B41 A;  2EWP A;  3VTB A;  4G21 A;  3NSQ A;  2ZK0 A;  2QAB A;  4OKX A;  3CJW A;  4OIU A;  4LTW A;  1RDT D;  1T73 A;  2GPP A;  2QR9 A;  3RUT A;  4REE A;  4ZNW A;  2AM9 A;  2QSE A;  5KD9 A;  3DCU A;  3A2H A;  4OIV A;  2PRG A;  4OKT A;  3AX8 A;  4P6X A;  3RVF A;  1Q4X A;  5KRC A;  3W0H A;  1T65 A;  2PIV A;  3E7C A;  1S9Q A;  1UHL B;  3GYT A;  3L0E A;  2QH6 A;  5L11 A;  4WVD A;  1YIN A;  1QKU A;  1T5Z A;  4RZE A;  4BCR A;  1X7B A;  1RDT A;  3WMH A;  2OVH A;  4FGY A;  4M8H A;  1IE9 A;  5DUH A;  1T7M A;  3WFG A;  1EXX A;  4OKW A;  1YYE A;  1ZAF A;  1PK5 A;  4Q13 A;  3ET1 A;  3VRU A;  5AZV A;  3KMZ A;  1K74 A;  3FUG A;  1YUC A;  5DXQ A;  3L3X A;  4OZR E;  3RLL A;  5DTV A;  3VHU A;  4OFR A;  4CI4 A;  1ZUC A;  2QE4 A;  2HCD A;  4FHI A;  4LSJ A;  4ZO1 B;  3VT9 A;  3WJ4 A;  4A4V A;  2PJL A;  5C4U A;  4NIE A;  5DIE A;  1OSH A;  1UHL A;  1UPV A;  4S0T A;  3HOD A;  5E1C A;  4FN9 A;  2G0H A;  3MNE A;  3R5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...