4K7AA

Crystal structure of the androgen receptor ligand binding domain in complex with minoxidil
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
249
structure length
242
Chain Sequence
QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIASCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the androgen receptor ligand binding domain in complex with minoxidil
rcsb
molecule keywords Androgen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 92
structure length 242
sequence length 249
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4k7aA00
4OGHA 3KPZA 4R2UA 3OS8A 3OZ0A 5DZ0A 1K7LA 2B23A 3VRTA 2QGTA 5E0WA 4OIVA 5HYRA 4Q50A 3CJWA 3RLLA 1UHLB 4HLWA 3OS8C 3OAPA 3A9EB 3KMZA 2QZOB 3OSWA 1T7RA 2JF9A 1K74A 3ZRBA 3HC6A 3G8OA 3HZFA 3KMRA 1ZDTA 3N00A 3O1DA 4MGDA 5DWGA 5DXGA 3TKMA 4LNWA 3IA6A 4MGBA 3Q95B 1MV9A 1X7BA 2PNUA 2P7GA 2HAMA 2ZY0A 2REWA 3KBAA 3B66A 5FQPA 5AVLA 4OKXA 5AK2A 2ZL9A 4YT1A 3DR1A 3R5NA 4IS8A 4UDAA 2QA8B 1U3SA 4G2IA 1YY4A 4IA3A 5DZHA 5G3JA 4IQRA 2YLPA 3R8DA 5FQSA 1GWXA 5HJPB 1PQ6A 2J14A 3E94A 4RE8A 3JZCA 3R2AA 5DL4A 3VT5A 1XP9A 4NUFA 1A28A 2GL8A 1KKQA 3UUAB 1G2NA 1QKMA 1DKFA 2Q8SA 4IVWA 4OEYA 3ADSA 1G1UA 2XYXA 3OMOA 2XKWA 4MG7A 5A86A 1EREA 4S15A 2ZMJA 4NB6A 4RUOX 2AO6A 5GIDA 1T7TA 5DWLA 5AZVA 4FHHA 5KR9A 1R5KA 2Q5PA 1OVLB 5KRIA 4WPFA 2QA6A 3KDTA 5DXBA 4PLDA 1XPCA 5JY3A 4K4JA 1YMTA 1FCZA 3GD2A 3B0TA 5AAVB 3WTQA 1ERRA 1IE9A 1PCGA 1Z5XU 4WHFA 2AA6A 1ILGA 3GBKA 5DVSA 1NHZA 5KCFA 4PLEA 2P1UA 2ACLB 3VJTA 4M8HA 4M8EA 2XYWA 4IWCA 1Q4XA 3DT3A 5DXMA 5EITA 1X7RA 2I0JA 3A40X 5DX3B 3HLVA 3P89A 2YHDA 3GYTA 3VT4A 4RFWA 2PIPL 1NAXA 2POBA 4RZEA 5KYJA 1R1KA 5G44A 3CS8A 3OKIA 3ADXA 2QW4A 3V49A 5I4VA 4G21A 2Q6RA 4WHGA 4ZNSA 1YOWA 3D90A 1SJ0A 1YUCA 3ILZA 4N1YA 3UU7B 3VT8A 4EM9A 1ZKYA 1OSVA 1GS4A 5G42A 2QSEA 1R20D 2VV4A 2ZK5A 3L3XA 3MNOA 4N73A 4PVUA 2ZKCA 1GWRA 3GWXA 1PQCA 5K13A 3CWDA 1U3RA 2JFAB 1XIUA 4XTAA 3IPSA 3NSQA 3R5MA 4OZRE 5B41A 2PKLA 3K8SA 4P6WA 4YNKA 4IVYA 2Z4BA 3L0LA 2R6WA 4FGYA 2BJ4B 3F5CA 1HG4A 2O9IA 4A2JA 1S9PA 3DZUD 2R40D 4J5XA 3GWSX 3AZ1A 2V7CA 4O8FA 3R8AA 5HJSA 2VV1A 4MG6A 4YMQA 4TV1B 2NW4A 1ILHA 2POGA 4JYGA 4QE8A 4XAOA 1OSHA 1RK3A 1SR7A 3FUGA 4KZIA 4DK8A 5B5BA 3VJSA 5C4SA 2AAXA 2GPOA 3HODA 2YJDA 3W0YA 3X1IA 1XP6A 3WJ5A 1G50A 3CDSA 5EC9A 2OVMA 3R29A 1QKTA 1XV9A 3DY6A 5EJVA 1UOMA 2XHSA 4CI4A 3OMPA 4OZTU 3ZQTA 4IWFA 3L0JA 4G2HA 3SZ1A 4HEEX 4FN9A 3CLDA 4PPSA 4WQPA 5KRFA 1BSXA 3VRUA 1I7IA 3R8IA 2YLQA 5DWEA 1I38A 2GPVA 4QJRA 4QK4A 1TXIA 5G43A 4E4QA 3VN2A 3VTCA 5JJMB 2VSRA 1NQ2A 2H79A 3AURA 2VV2A 1DB1A 3FC6A 2QTUA 1UPWA 2AXAA 1EXAA 1EXXA 4DMAA 3W0HA 4JYHA 5DMCA 3HVLA 4X1FA 3UUDA 3CQVA 1X78A 1E3GA 1XNNA 3K6PA 2QNVA 3VT7A 3E00A 5DU5A 5ACCA 4TUZB 4OEAA 2I0GA 5DIDA 4IA2A 1T73A 4OJ4A 3A2HA 5KRLA 2G0GA 5JI0D 3CTBA 2A3IA 3UVVB 1K74D 1XVPB 1IE8A 5KCCA 1T7MA 2QH6A 3IMYA 5GIEA 1U3QA 1UHLA 2VV3A 4RUJA 5DYDA 1I37A 4ZJRA 4MG8A 2QZOA 5DVVA 4POHA 4RZFA 4PRGA 5E14A 4IV2A 2HVCA 3RUTA 3WWRA 3KYTA 2OUZA 4OC7A 1XDKB 1NUOA 4UDDA 5KRAA 4A4VA 2PJLA 3OLSA 3OOKA 5E0XA 3WT6A 2OVHA 3K23A 1XLSA 4S0SA 2Q61A 2ZK4A 1RKHA 5IAWA 2Q1VA 5AWJA 3VJHA 3VT6A 2I4ZA 4XUHA 5KCEA 2P7ZA 2Q6JA 5DXRA 1M13A 1T65A 4QL8A 1ZAFA 2PITA 2QA8A 5DXEA 3B5RA 2Q7KA 4DK7A 5C4OA 5GT4A 2I4PA 2J7XA 4OLMA 4OKWA 2Q59B 1YINA 2Q70A 1NQ7A 2PIXA 1ZDUA 4IA1A 5KRCA 1FD0A 2ZK1A 2B1ZA 2PIWA 4ZN9A 4IUIA 3B65A 5DV6A 3PBAA 1S9QA 2Q60A 2QR9A 5LGAA 1X7EA 2Q6SA 3JZBA 3MNEA 3V3QA 5IZ0A 4DM8A 3VHWA 5DXPA 2ZVTA 4WLBA 4PP6A 2PRGA 4JGVA 5DXKA 1FCXA 4XHDA 1XLSE 1XP1A 2GPPA 4ZNHA 2BAWA 3FLIA 2ZLCA 4MGDB 3IXPA 3KMGA 4RMCA 1YA3A 5L7HA 3A3ZX 4MGBB 3AFRA 3VTDA 1PDUA 2QE4A 4R06A 1K4WA 3TKCA 4Q0AC 3OMKA 3X1HA 5AAVA 1Z95A 4RAKA 2OZ7A 3AZ2A 1QKNA 2HC4A 2YLOA 4ITEA 3DZYA 3U9QA 2ACLA 1LBDA 4EMAA 2Q5SA 1R1KD 4ITFA 2O4JA 5DSHA 5DWIA 4P6XA 3UP3A 5DX3A 3ZR7A 2AYRA 4B7WA 1PRGA 2QPYA 3VHVA 1H9UA 2IOGA 5E7VA 1S0ZA 3W5TA 4MGAB 4J24A 4ZJWA 1DKFB 2JJ3A 4OJBA 4OILA 2V0VA 2ZBSA 3GN8A 2ZNOA 4MG5A 1SKXA 1T76A 3P8XA 4MG7B 1NAVA 3KWYA 3B0WA 2PIVA 3FEJA 3W0GA 1ZUCA 1Y0XX 3AN4A 4OHAA 5AAUA 3S9SA 3ADVA 3TX7B 2J7YA 1FM9A 4OFUA 1FCYA 1WM0X 2ZK3A 2ZNPA 4K6IA 2HBHA 2ZK6A 3WFFA 5AYGA 1X7JA 3FURA 1G5YA 3OLLA 5APKA 3AN3A 5DTVA 1XJ7A 2P4YA 2BJ4A 2VV0A 3DCTA 4OKBA 3OZJA 2GP7A 4OIUA 3NSPA 3VRVA 3A78A 1KV6A 2ZK2A 3LBDA 4TV1A 3RUUA 2OCFA 1NDEA 5M96A 4YPQA 2AMBA 4ZI1A 3OGTA 3OS9A 1FM6A 5DV3A 1NQ1A 4ONIA 1Y0SA 4ZOMA 4XI3A 3ADTA 5DZ3A 1RDTA 2P15A 4DM6A 4QM0A 3AX8A 5DYBA 5DKGA 3CS6A 4ZNWA 2ZXNA 5G5WA 3OOFA 5DIEA 4QE6A 3WFGA 3ADWA 1NQ0A 1R6GA 3F7DA 1L2JA 1RJKA 4Q13A 3VHUA 4OZRU 5DKSA 4JAZA 5KROA 3TY0A 5KCDA 5DZ1A 3GZ9A 2ZXMA 2W8YA 3OMMA 3BC5A 3KFCA 1T79A 1FBYA 3V9YA 3F5CB 3B3KA 3ET0A 3E00D 3WMHA 4N8RA 3PCUA 5FQVA 4KZMA 2VV1B 1N83A 4Y29A 2AX9A 3FXVA 4LNXA 3W5RA 4JL4A 4DORA 5KCTA 2PIOA 5EI1A 1VJBA 3OLFA 3FALA 5G46A 2YFEA 4TUZA 5DRJA 4XUMA 2Q3YA 4ZO1B 4MG9B 4DQMA 1ZH7A 3ET1A 2FSZA 5H1EA 2Q7LA 5F9BA 5KCUA 2AMAA 4PWLA 4RUPA 3KDUA 1XVPA 4R6SA 1XV9B 4DOSA 1XOWA 4MGCA 2ZNQA 4X1GA 4MDDA 3NOAA 2H77A 5KRMA 4RMEA 2PIUA 3D5FA 4OFRA 4REEA 1UPVA 2HFPA 3PLZA 3P88A 1YYEA 5DUGA 4FHIA 3A9EA 4IU7A 2ZNNA 4G1ZA 2QXSA 5DV8A 4F9MA 5KD9A 5EHJA 5DIGA 4OEDA 3FC6B 5AVIA 4RMDA 1NYXA 3H0AA 3HC5A 2NPAA 4K7AA 2O4RA 3BEJA 2NV7A 3K22A 5C4UA 2VSTA 3WGPA 3W5PA 4IA7A 3Q95A 2HWRA 5KCWA 5HYKA 3B67A 3UUDB 3W0IA 3UP0A 4UDBA 1T63A 2GWXA 3B68A 1N46A 2AM9A 2AA2A 3CDPA 4ZNTA 2QABA 1YOKA 2QXMA 5HJPA 2ZLAA 4OEZA 2LBDA 2ZXZA 5L11A 2ZASA 4E4KA 3V4AA 3G9EA 2FVJA 3UUAA 3IXPD 2P1TA 5DI7A 5DRMA 1P93A 2HARA 2AWHA 3W5QA 4MG8B 2ZK0A 3D57A 2AB2A 2R6YA 4KZJA 3X31A 2ATHA 4L98A 4RWVA 3DZYD 1PQ9A 2I4JA 1OVLA 5E19A 3ERDA 3H52A 4NY9A 4ZNUA 3WJ4A 1ZEOA 3L1BA 2FAIA 3W0AA 3OSAA 5LWPA 2HASA 2G0HA 2EWPA 3CS4A 5DY8A 3V9VA 3MNPA 3D24A 1X76A 4S14A 4PXMA 3UUCA 1XB7A 2XYJA 4PP3A 4WVDA 3M7RA 5DMFA 5EGVA 4CI5A 3HM1A 4ZO1X 1S0XA 1M2ZA 3B1MA 4XT9A 1Y9RA 3RLJA 5KYAA 1Z5XE 3PO9A 4MGAA 3L0EA 4OARA 2QGWA 3SP6A 1LV2A 1FM9D 3DCUA 2B1VA 2HB7A 4IW6A 2Q1HA 5DKEA 2NXXA 3VI8A 3RVFA 3UU7A 1U9EA 2PIQA 5KRJA 3L3ZA 2ZFXA 1E3KA 1XAPA 5E1CA 4JYIA 4OKTA 2J4AA 3X36A 2OM9A 4G20A 4LSJA 4OK1A 1XQCA 5DWJA 3T03A 5DXBB 3A2JA 1TFCA 5IXKA 2YJAB 1YP0A 1FM6D 3FS1A 2JFAA 4G1YA 4S0TA 3AUQA 5C4TA 1N4HA 1PZLA 3LMPA 4IV4A 3P0UA 1RDTD 1XQ3A 2QMVA 5FQTA 3W0JA 1XZXX 3HQ5A 2P1VA 1YIMA 5AZTA 3VSPA 3WT7A 2IOKA 5DKBA 5HCVA 1I7GA 4PPPA 4UDCA 2NXXE 3GYUA 4PP5A 3W0CA 5HZCA 4NQAB 4XLDA 3EYBA 3G0WA 5DZIA 2GTKA 5DVCA 2AA7A 2ZMIA 1T7FA 2YATA 3QT0A 2GPUA 3BQDA 5L7EA 1PK5A 4APUA 1MVCA 3B0QA 2VV4B 5DUHA 1GWQA 3IPQA 2P54A 4OZTE 3ET3A 4ZN7A 3HO0A 3OSIA 4FNEA 5E15A 4CSJA 1L2IA 4J26A 5JJMA 1R20A 2AX7A 3ERTA 1P8DA 2PIRA 2ZMHA 3B0RA 4N5GA 4OH6A 2HCDA 4G1DA 1M7WA 2P7AA 5SYZA 3AUNA 4J5XC 1ZGYA 3L03A 3A2IA 1KNUA 5CJ6A 3AZ3A 5DUEA 3IPUA 2Q7JA 2ABIA 3OMQA 3FEIA 4MG9A 3VTBA 3DZUA 5GICA 4E2JA 1T74A 2AX6A 5G45A 2Q5GA 2R40A 3VSOA 3V9TA 2F4BA 4L96A 2IHQA 1YJEA 4OJ9A 2OAXA 2HWQA 4REFA 1NRLA 5AWKA 3VT9A 3PEQA 3UVVA 2G5OA 3V3EA 3O1EA 3SP9A 4J5WA 2YLYA 1QKUA 3VRWA 5DXQA 3H0AD 4A4WA 2GIUA 4POJA 3RY9A 2E2RA 4J5WC 3WT5A 1T5ZA 3OKHA 2HB8A 4LTWA 5APJA 5ICKA 1XDKA 4NIEA 3D6DA 4OH5A 3ET2A 5ETHA 2PINA 3E7CA 3ZRAA 2AX8A 5APHA 5DK9A 2AA5A 3VJIA 4BCRA 3ADUA 4IW8A 5DLRA 4ZNVA 5KRHA 3FALB 5KRKA 3G8IA 2B50A 1XNXA 1SQNA 1S19A 2G44A 3VT3A 4RZGA 3PRGA 2Q7IA 5DP0A 1RKGA 5L7GA 1MZNA 2Q59A 2Z4JA 1OT7A 4LBDA 5FQRA 1A52A 4PF3A 1HJ1A
chains in the Genus database with same CATH superfamily
4OGHA 3KPZA 4R2UA 3OS8A 3OZ0A 5DZ0A 1K7LA 2B23A 3VRTA 2QGTA 5E0WA 4OIVA 5HYRA 4Q50A 3CJWA 3RLLA 1UHLB 4HLWA 3OS8C 3OAPA 3A9EB 3KMZA 2QZOB 3OSWA 1T7RA 2JF9A 1K74A 3ZRBA 3HC6A 3G8OA 3HZFA 3KMRA 1ZDTA 3N00A 3O1DA 4MGDA 5DWGA 5DXGA 3TKMA 4LNWA 3IA6A 4MGBA 3Q95B 1MV9A 1X7BA 2PNUA 2P7GA 2HAMA 2ZY0A 2REWA 3KBAA 3B66A 5FQPA 5AVLA 4OKXA 5AK2A 2ZL9A 4YT1A 3DR1A 3R5NA 4IS8A 4UDAA 2QA8B 1U3SA 4G2IA 1YY4A 4IA3A 5DZHA 5G3JA 4IQRA 2YLPA 3R8DA 5FQSA 1GWXA 5HJPB 1PQ6A 2J14A 3E94A 4RE8A 3JZCA 3R2AA 5DL4A 3VT5A 1XP9A 4NUFA 1A28A 2GL8A 1KKQA 3UUAB 1G2NA 1QKMA 1DKFA 2Q8SA 4IVWA 4OEYA 3ADSA 1G1UA 2XYXA 3OMOA 2XKWA 4MG7A 5A86A 1EREA 4S15A 2ZMJA 4NB6A 4RUOX 2AO6A 5GIDA 1T7TA 5DWLA 5AZVA 4FHHA 5KR9A 1R5KA 2Q5PA 1OVLB 5KRIA 4WPFA 2QA6A 3KDTA 5DXBA 4PLDA 1XPCA 5JY3A 4K4JA 1YMTA 1FCZA 3GD2A 3B0TA 5AAVB 3WTQA 1ERRA 1IE9A 1PCGA 1Z5XU 4WHFA 2AA6A 1ILGA 3GBKA 5DVSA 1NHZA 5KCFA 4PLEA 2P1UA 2ACLB 3VJTA 4M8HA 4M8EA 2XYWA 4IWCA 1Q4XA 3DT3A 5DXMA 5EITA 1X7RA 2I0JA 3A40X 5DX3B 3HLVA 3P89A 2YHDA 3GYTA 3VT4A 4RFWA 2PIPL 1NAXA 2POBA 4RZEA 5KYJA 1R1KA 5G44A 3CS8A 3OKIA 3ADXA 2QW4A 3V49A 5I4VA 4G21A 2Q6RA 4WHGA 4ZNSA 1YOWA 3D90A 1SJ0A 1YUCA 3ILZA 4N1YA 3UU7B 3VT8A 4EM9A 1ZKYA 1OSVA 1GS4A 5G42A 2QSEA 1R20D 2VV4A 2ZK5A 3L3XA 3MNOA 4N73A 4PVUA 2ZKCA 1GWRA 3GWXA 1PQCA 5K13A 3CWDA 1U3RA 2JFAB 1XIUA 4XTAA 3IPSA 3NSQA 3R5MA 4OZRE 5B41A 2PKLA 3K8SA 4P6WA 4YNKA 4IVYA 2Z4BA 3L0LA 2R6WA 4FGYA 2BJ4B 3F5CA 1HG4A 2O9IA 4A2JA 1S9PA 3DZUD 2R40D 4J5XA 3GWSX 3AZ1A 2V7CA 4O8FA 3R8AA 5HJSA 2VV1A 4MG6A 4YMQA 4TV1B 2NW4A 1ILHA 2POGA 4JYGA 4QE8A 4XAOA 1OSHA 1RK3A 1SR7A 3FUGA 4KZIA 4DK8A 5B5BA 3VJSA 5C4SA 2AAXA 2GPOA 3HODA 2YJDA 3W0YA 3X1IA 1XP6A 3WJ5A 1G50A 3CDSA 5EC9A 2OVMA 3R29A 1QKTA 1XV9A 3DY6A 5EJVA 1UOMA 2XHSA 4CI4A 3OMPA 4OZTU 3ZQTA 4IWFA 3L0JA 4G2HA 3SZ1A 4HEEX 4FN9A 3CLDA 4PPSA 4WQPA 5KRFA 1BSXA 3VRUA 1I7IA 3R8IA 2YLQA 5DWEA 1I38A 2GPVA 4QJRA 4QK4A 1TXIA 5G43A 4E4QA 3VN2A 3VTCA 5JJMB 2VSRA 1NQ2A 2H79A 3AURA 2VV2A 1DB1A 3FC6A 2QTUA 1UPWA 2AXAA 1EXAA 1EXXA 4DMAA 3W0HA 4JYHA 5DMCA 3HVLA 4X1FA 3UUDA 3CQVA 1X78A 1E3GA 1XNNA 3K6PA 2QNVA 3VT7A 3E00A 5DU5A 5ACCA 4TUZB 4OEAA 2I0GA 5DIDA 4IA2A 1T73A 4OJ4A 3A2HA 5KRLA 2G0GA 5JI0D 3CTBA 2A3IA 3UVVB 1K74D 1XVPB 1IE8A 5KCCA 1T7MA 2QH6A 3IMYA 5GIEA 1U3QA 1UHLA 2VV3A 4RUJA 5DYDA 1I37A 4ZJRA 4MG8A 2QZOA 5DVVA 4POHA 4RZFA 4PRGA 5E14A 4IV2A 2HVCA 3RUTA 3WWRA 3KYTA 2OUZA 4OC7A 1XDKB 1NUOA 4UDDA 5KRAA 4A4VA 2PJLA 3OLSA 3OOKA 5E0XA 3WT6A 2OVHA 3K23A 1XLSA 4S0SA 2Q61A 2ZK4A 1RKHA 5IAWA 2Q1VA 5AWJA 3VJHA 3VT6A 2I4ZA 4XUHA 5KCEA 2P7ZA 2Q6JA 5DXRA 1M13A 1T65A 4QL8A 1ZAFA 2PITA 2QA8A 5DXEA 3B5RA 2Q7KA 4DK7A 5C4OA 5GT4A 2I4PA 2J7XA 4OLMA 4OKWA 2Q59B 1YINA 2Q70A 1NQ7A 2PIXA 1ZDUA 4IA1A 5KRCA 1FD0A 2ZK1A 2B1ZA 2PIWA 4ZN9A 4IUIA 3B65A 5DV6A 3PBAA 1S9QA 2Q60A 2QR9A 5LGAA 1X7EA 2Q6SA 3JZBA 3MNEA 3V3QA 5IZ0A 4DM8A 3VHWA 5DXPA 2ZVTA 4WLBA 4PP6A 2PRGA 4JGVA 5DXKA 1FCXA 4XHDA 1XLSE 1XP1A 2GPPA 4ZNHA 2BAWA 3FLIA 2ZLCA 4MGDB 3IXPA 3KMGA 4RMCA 1YA3A 5L7HA 3A3ZX 4MGBB 3AFRA 3VTDA 1PDUA 2QE4A 4R06A 1K4WA 3TKCA 4Q0AC 3OMKA 3X1HA 5AAVA 1Z95A 4RAKA 2OZ7A 3AZ2A 1QKNA 2HC4A 2YLOA 4ITEA 3DZYA 3U9QA 2ACLA 1LBDA 4EMAA 2Q5SA 1R1KD 4ITFA 2O4JA 5DSHA 5DWIA 4P6XA 3UP3A 5DX3A 3ZR7A 2AYRA 4B7WA 1PRGA 2QPYA 3VHVA 1H9UA 2IOGA 5E7VA 1S0ZA 3W5TA 4MGAB 4J24A 4ZJWA 1DKFB 2JJ3A 4OJBA 4OILA 2V0VA 2ZBSA 3GN8A 2ZNOA 4MG5A 1SKXA 1T76A 3P8XA 4MG7B 1NAVA 3KWYA 3B0WA 2PIVA 3FEJA 3W0GA 1ZUCA 1Y0XX 3AN4A 4OHAA 5AAUA 3S9SA 3ADVA 3TX7B 2J7YA 1FM9A 4OFUA 1FCYA 1WM0X 2ZK3A 2ZNPA 4K6IA 2HBHA 2ZK6A 3WFFA 5AYGA 1X7JA 3FURA 1G5YA 3OLLA 5APKA 3AN3A 5DTVA 1XJ7A 2P4YA 2BJ4A 2VV0A 3DCTA 4OKBA 3OZJA 2GP7A 4OIUA 3NSPA 3VRVA 3A78A 1KV6A 2ZK2A 3LBDA 4TV1A 3RUUA 2OCFA 1NDEA 5M96A 4YPQA 2AMBA 4ZI1A 3OGTA 3OS9A 1FM6A 5DV3A 1NQ1A 4ONIA 1Y0SA 4ZOMA 4XI3A 3ADTA 5DZ3A 1RDTA 2P15A 4DM6A 4QM0A 3AX8A 5DYBA 5DKGA 3CS6A 4ZNWA 2ZXNA 5G5WA 3OOFA 5DIEA 4QE6A 3WFGA 3ADWA 1NQ0A 1R6GA 3F7DA 1L2JA 1RJKA 4Q13A 3VHUA 4OZRU 5DKSA 4JAZA 5KROA 3TY0A 5KCDA 5DZ1A 3GZ9A 2ZXMA 2W8YA 3OMMA 3BC5A 3KFCA 1T79A 1FBYA 3V9YA 3F5CB 3B3KA 3ET0A 3E00D 3WMHA 4N8RA 3PCUA 5FQVA 4KZMA 2VV1B 1N83A 4Y29A 2AX9A 3FXVA 4LNXA 3W5RA 4JL4A 4DORA 5KCTA 2PIOA 5EI1A 1VJBA 3OLFA 3FALA 5G46A 2YFEA 4TUZA 5DRJA 4XUMA 2Q3YA 4ZO1B 4MG9B 4DQMA 1ZH7A 3ET1A 2FSZA 5H1EA 2Q7LA 5F9BA 5KCUA 2AMAA 4PWLA 4RUPA 3KDUA 1XVPA 4R6SA 1XV9B 4DOSA 1XOWA 4MGCA 2ZNQA 4X1GA 4MDDA 3NOAA 2H77A 5KRMA 4RMEA 2PIUA 3D5FA 4OFRA 4REEA 1UPVA 2HFPA 3PLZA 3P88A 1YYEA 5DUGA 4FHIA 3A9EA 4IU7A 2ZNNA 4G1ZA 2QXSA 5DV8A 4F9MA 5KD9A 5EHJA 5DIGA 4OEDA 3FC6B 5AVIA 4RMDA 1NYXA 3H0AA 3HC5A 2NPAA 4K7AA 2O4RA 3BEJA 2NV7A 3K22A 5C4UA 2VSTA 3WGPA 3W5PA 4IA7A 3Q95A 2HWRA 5KCWA 5HYKA 3B67A 3UUDB 3W0IA 3UP0A 4UDBA 1T63A 2GWXA 3B68A 1N46A 2AM9A 2AA2A 3CDPA 4ZNTA 2QABA 1YOKA 2QXMA 5HJPA 2ZLAA 4OEZA 2LBDA 2ZXZA 5L11A 2ZASA 4E4KA 3V4AA 3G9EA 2FVJA 3UUAA 3IXPD 2P1TA 5DI7A 5DRMA 1P93A 2HARA 2AWHA 3W5QA 4MG8B 2ZK0A 3D57A 2AB2A 2R6YA 4KZJA 3X31A 2ATHA 4L98A 4RWVA 3DZYD 1PQ9A 2I4JA 1OVLA 5E19A 3ERDA 3H52A 4NY9A 4ZNUA 3WJ4A 1ZEOA 3L1BA 2FAIA 3W0AA 3OSAA 5LWPA 2HASA 2G0HA 2EWPA 3CS4A 5DY8A 3V9VA 3MNPA 3D24A 1X76A 4S14A 4PXMA 3UUCA 1XB7A 2XYJA 4PP3A 4WVDA 3M7RA 5DMFA 5EGVA 4CI5A 3HM1A 4ZO1X 1S0XA 1M2ZA 3B1MA 4XT9A 1Y9RA 3RLJA 5KYAA 1Z5XE 3PO9A 4MGAA 3L0EA 4OARA 2QGWA 3SP6A 1LV2A 1FM9D 3DCUA 2B1VA 2HB7A 4IW6A 2Q1HA 5DKEA 2NXXA 3VI8A 3RVFA 3UU7A 1U9EA 2PIQA 5KRJA 3L3ZA 2ZFXA 1E3KA 1XAPA 5E1CA 4JYIA 4OKTA 2J4AA 3X36A 2OM9A 4G20A 4LSJA 4OK1A 1XQCA 5DWJA 3T03A 5DXBB 3A2JA 1TFCA 5IXKA 2YJAB 1YP0A 1FM6D 3FS1A 2JFAA 4G1YA 4S0TA 3AUQA 5C4TA 1N4HA 1PZLA 3LMPA 4IV4A 3P0UA 1RDTD 1XQ3A 2QMVA 5FQTA 3W0JA 1XZXX 3HQ5A 2P1VA 1YIMA 5AZTA 3VSPA 3WT7A 2IOKA 5DKBA 5HCVA 1I7GA 4PPPA 4UDCA 2NXXE 3GYUA 4PP5A 3W0CA 5HZCA 4NQAB 4XLDA 3EYBA 3G0WA 5DZIA 2GTKA 5DVCA 2AA7A 2ZMIA 1T7FA 2YATA 3QT0A 2GPUA 3BQDA 5L7EA 1PK5A 4APUA 1MVCA 3B0QA 2VV4B 5DUHA 1GWQA 3IPQA 2P54A 4OZTE 3ET3A 4ZN7A 3HO0A 3OSIA 4FNEA 5E15A 4CSJA 1L2IA 4J26A 5JJMA 1R20A 2AX7A 3ERTA 1P8DA 2PIRA 2ZMHA 3B0RA 4N5GA 4OH6A 2HCDA 4G1DA 1M7WA 2P7AA 5SYZA 3AUNA 4J5XC 1ZGYA 3L03A 3A2IA 1KNUA 5CJ6A 3AZ3A 5DUEA 3IPUA 2Q7JA 2ABIA 3OMQA 3FEIA 4MG9A 3VTBA 3DZUA 5GICA 4E2JA 1T74A 2AX6A 5G45A 2Q5GA 2R40A 3VSOA 3V9TA 2F4BA 4L96A 2IHQA 1YJEA 4OJ9A 2OAXA 2HWQA 4REFA 1NRLA 5AWKA 3VT9A 3PEQA 3UVVA 2G5OA 3V3EA 3O1EA 3SP9A 4J5WA 2YLYA 1QKUA 3VRWA 5DXQA 3H0AD 4A4WA 2GIUA 4POJA 3RY9A 2E2RA 4J5WC 3WT5A 1T5ZA 3OKHA 2HB8A 4LTWA 5APJA 5ICKA 1XDKA 4NIEA 3D6DA 4OH5A 3ET2A 5ETHA 2PINA 3E7CA 3ZRAA 2AX8A 5APHA 5DK9A 2AA5A 3VJIA 4BCRA 3ADUA 4IW8A 5DLRA 4ZNVA 5KRHA 3FALB 5KRKA 3G8IA 2B50A 1XNXA 1SQNA 1S19A 2G44A 3VT3A 4RZGA 3PRGA 2Q7IA 5DP0A 1RKGA 5L7GA 1MZNA 2Q59A 2Z4JA 1OT7A 4LBDA 5FQRA 1A52A 4PF3A 1HJ1A
chains in the Genus database with same CATH topology
4OGHA 3KPZA 4R2UA 3OS8A 3OZ0A 5DZ0A 1K7LA 2B23A 3VRTA 2QGTA 5E0WA 4OIVA 5HYRA 4Q50A 3CJWA 3RLLA 1UHLB 4HLWA 3OS8C 3OAPA 3A9EB 3KMZA 2QZOB 3OSWA 1T7RA 2JF9A 1K74A 3ZRBA 3HC6A 3G8OA 3HZFA 3KMRA 1ZDTA 3N00A 3O1DA 4MGDA 5DWGA 5DXGA 3TKMA 4LNWA 3IA6A 4MGBA 3Q95B 1MV9A 1X7BA 2PNUA 2P7GA 2HAMA 2ZY0A 2REWA 3KBAA 3B66A 5FQPA 5AVLA 4OKXA 5AK2A 2ZL9A 4YT1A 3DR1A 3R5NA 4IS8A 4UDAA 2QA8B 1U3SA 4G2IA 1YY4A 4IA3A 5DZHA 5G3JA 4IQRA 2YLPA 3R8DA 5FQSA 1GWXA 5HJPB 1PQ6A 2J14A 3E94A 4RE8A 3JZCA 3R2AA 5DL4A 3VT5A 1XP9A 4NUFA 1A28A 2GL8A 1KKQA 3UUAB 1G2NA 1QKMA 1DKFA 2Q8SA 4IVWA 4OEYA 3ADSA 1G1UA 2XYXA 3OMOA 2XKWA 4MG7A 5A86A 1EREA 4S15A 2ZMJA 4NB6A 4RUOX 2AO6A 5GIDA 1T7TA 5DWLA 5AZVA 4FHHA 5KR9A 1R5KA 2Q5PA 1OVLB 5KRIA 4WPFA 2QA6A 3KDTA 5DXBA 4PLDA 1XPCA 5JY3A 4K4JA 1YMTA 1FCZA 3GD2A 3B0TA 5AAVB 3WTQA 1ERRA 1IE9A 1PCGA 1Z5XU 4WHFA 2AA6A 1ILGA 3GBKA 5DVSA 1NHZA 5KCFA 4PLEA 2P1UA 2ACLB 3VJTA 4M8HA 4M8EA 2XYWA 4IWCA 1Q4XA 3DT3A 5DXMA 5EITA 1X7RA 2I0JA 3A40X 5DX3B 3HLVA 3P89A 2YHDA 3GYTA 3VT4A 4RFWA 2PIPL 1NAXA 2POBA 4RZEA 5KYJA 1R1KA 5G44A 3CS8A 3OKIA 3ADXA 2QW4A 3V49A 5I4VA 4G21A 2Q6RA 4WHGA 4ZNSA 1YOWA 3D90A 1SJ0A 1YUCA 3ILZA 4N1YA 3UU7B 3VT8A 4EM9A 1ZKYA 1OSVA 1GS4A 5G42A 2QSEA 1R20D 2VV4A 2ZK5A 3L3XA 3MNOA 4N73A 4PVUA 2ZKCA 1GWRA 3GWXA 1PQCA 5K13A 3CWDA 1U3RA 2JFAB 1XIUA 4XTAA 3IPSA 3NSQA 3R5MA 4OZRE 5B41A 2PKLA 3K8SA 4P6WA 4YNKA 4IVYA 2Z4BA 3L0LA 2R6WA 4FGYA 2BJ4B 3F5CA 1HG4A 2O9IA 4A2JA 1S9PA 3DZUD 2R40D 4J5XA 3GWSX 3AZ1A 2V7CA 4O8FA 3R8AA 5HJSA 2VV1A 4MG6A 4YMQA 4TV1B 2NW4A 1ILHA 2POGA 4JYGA 4QE8A 4XAOA 1OSHA 1RK3A 1SR7A 3FUGA 4KZIA 4DK8A 5B5BA 3VJSA 5C4SA 2AAXA 2GPOA 3HODA 2YJDA 3W0YA 3X1IA 1XP6A 3WJ5A 1G50A 3CDSA 5EC9A 2OVMA 3R29A 1QKTA 1XV9A 3DY6A 5EJVA 1UOMA 2XHSA 4CI4A 3OMPA 4OZTU 3ZQTA 4IWFA 3L0JA 4G2HA 3SZ1A 4HEEX 4FN9A 3CLDA 4PPSA 4WQPA 5KRFA 1BSXA 3VRUA 1I7IA 3R8IA 2YLQA 5DWEA 1I38A 2GPVA 4QJRA 4QK4A 1TXIA 5G43A 4E4QA 3VN2A 3VTCA 5JJMB 2VSRA 1NQ2A 2H79A 3AURA 2VV2A 1DB1A 3FC6A 2QTUA 1UPWA 2AXAA 1EXAA 1EXXA 4DMAA 3W0HA 4JYHA 5DMCA 3HVLA 4X1FA 3UUDA 3CQVA 1X78A 1E3GA 1XNNA 3K6PA 2QNVA 3VT7A 3E00A 5DU5A 5ACCA 4TUZB 4OEAA 2I0GA 5DIDA 4IA2A 1T73A 4OJ4A 3A2HA 5KRLA 2G0GA 5JI0D 3CTBA 2A3IA 3UVVB 1K74D 1XVPB 1IE8A 5KCCA 1T7MA 2QH6A 3IMYA 5GIEA 1U3QA 1UHLA 2VV3A 4RUJA 5DYDA 1I37A 4ZJRA 4MG8A 2QZOA 5DVVA 4POHA 4RZFA 4PRGA 5E14A 4IV2A 2HVCA 3RUTA 3WWRA 3KYTA 2OUZA 4OC7A 1XDKB 1NUOA 4UDDA 5KRAA 4A4VA 2PJLA 3OLSA 3OOKA 5E0XA 3WT6A 2OVHA 3K23A 1XLSA 4S0SA 2Q61A 2ZK4A 1RKHA 5IAWA 2Q1VA 5AWJA 3VJHA 3VT6A 2I4ZA 4XUHA 5KCEA 2P7ZA 2Q6JA 5DXRA 1M13A 1T65A 4QL8A 1ZAFA 2PITA 2QA8A 5DXEA 3B5RA 2Q7KA 4DK7A 5C4OA 5GT4A 2I4PA 2J7XA 4OLMA 4OKWA 2Q59B 1YINA 2Q70A 1NQ7A 2PIXA 1ZDUA 4IA1A 5KRCA 1FD0A 2ZK1A 2B1ZA 2PIWA 4ZN9A 4IUIA 3B65A 5DV6A 3PBAA 1S9QA 2Q60A 2QR9A 5LGAA 1X7EA 2Q6SA 3JZBA 3MNEA 3V3QA 5IZ0A 4DM8A 3VHWA 5DXPA 2ZVTA 4WLBA 4PP6A 2PRGA 4JGVA 5DXKA 1FCXA 4XHDA 1XLSE 1XP1A 2GPPA 4ZNHA 2BAWA 3FLIA 2ZLCA 4MGDB 3IXPA 3KMGA 4RMCA 1YA3A 5L7HA 3A3ZX 4MGBB 3AFRA 3VTDA 1PDUA 2QE4A 4R06A 1K4WA 3TKCA 4Q0AC 3OMKA 3X1HA 5AAVA 1Z95A 4RAKA 2OZ7A 3AZ2A 1QKNA 2HC4A 2YLOA 4ITEA 3DZYA 3U9QA 2ACLA 1LBDA 4EMAA 2Q5SA 1R1KD 4ITFA 2O4JA 5DSHA 5DWIA 4P6XA 3UP3A 5DX3A 3ZR7A 2AYRA 4B7WA 1PRGA 2QPYA 3VHVA 1H9UA 2IOGA 5E7VA 1S0ZA 3W5TA 4MGAB 4J24A 4ZJWA 1DKFB 2JJ3A 4OJBA 4OILA 2V0VA 2ZBSA 3GN8A 2ZNOA 4MG5A 1SKXA 1T76A 3P8XA 4MG7B 1NAVA 3KWYA 3B0WA 2PIVA 3FEJA 3W0GA 1ZUCA 1Y0XX 3AN4A 4OHAA 5AAUA 3S9SA 3ADVA 3TX7B 2J7YA 1FM9A 4OFUA 1FCYA 1WM0X 2ZK3A 2ZNPA 4K6IA 2HBHA 2ZK6A 3WFFA 5AYGA 1X7JA 3FURA 1G5YA 3OLLA 5APKA 3AN3A 5DTVA 1XJ7A 2P4YA 2BJ4A 2VV0A 3DCTA 4OKBA 3OZJA 2GP7A 4OIUA 3NSPA 3VRVA 3A78A 1KV6A 2ZK2A 3LBDA 4TV1A 3RUUA 2OCFA 1NDEA 5M96A 4YPQA 2AMBA 4ZI1A 3OGTA 3OS9A 1FM6A 5DV3A 1NQ1A 4ONIA 1Y0SA 4ZOMA 4XI3A 3ADTA 5DZ3A 1RDTA 2P15A 4DM6A 4QM0A 3AX8A 5DYBA 5DKGA 3CS6A 4ZNWA 2ZXNA 5G5WA 3OOFA 5DIEA 4QE6A 3WFGA 3ADWA 1NQ0A 1R6GA 3F7DA 1L2JA 1RJKA 4Q13A 3VHUA 4OZRU 5DKSA 4JAZA 5KROA 3TY0A 5KCDA 5DZ1A 3GZ9A 2ZXMA 2W8YA 3OMMA 3BC5A 3KFCA 1T79A 1FBYA 3V9YA 3F5CB 3B3KA 3ET0A 3E00D 3WMHA 4N8RA 3PCUA 5FQVA 4KZMA 2VV1B 1N83A 4Y29A 2AX9A 3FXVA 4LNXA 3W5RA 4JL4A 4DORA 5KCTA 2PIOA 5EI1A 1VJBA 3OLFA 3FALA 5G46A 2YFEA 4TUZA 5DRJA 4XUMA 2Q3YA 4ZO1B 4MG9B 4DQMA 1ZH7A 3ET1A 2FSZA 5H1EA 2Q7LA 5F9BA 5KCUA 2AMAA 4PWLA 4RUPA 3KDUA 1XVPA 4R6SA 1XV9B 4DOSA 1XOWA 4MGCA 2ZNQA 4X1GA 4MDDA 3NOAA 2H77A 5KRMA 4RMEA 2PIUA 3D5FA 4OFRA 4REEA 1UPVA 2HFPA 3PLZA 3P88A 1YYEA 5DUGA 4FHIA 3A9EA 4IU7A 2ZNNA 4G1ZA 2QXSA 5DV8A 4F9MA 5KD9A 5EHJA 5DIGA 4OEDA 3FC6B 5AVIA 4RMDA 1NYXA 3H0AA 3HC5A 2NPAA 4K7AA 2O4RA 3BEJA 2NV7A 3K22A 5C4UA 2VSTA 3WGPA 3W5PA 4IA7A 3Q95A 2HWRA 5KCWA 5HYKA 3B67A 3UUDB 3W0IA 3UP0A 4UDBA 1T63A 2GWXA 3B68A 1N46A 2AM9A 2AA2A 3CDPA 4ZNTA 2QABA 1YOKA 2QXMA 5HJPA 2ZLAA 4OEZA 2LBDA 2ZXZA 5L11A 2ZASA 4E4KA 3V4AA 3G9EA 2FVJA 3UUAA 3IXPD 2P1TA 5DI7A 5DRMA 1P93A 2HARA 2AWHA 3W5QA 4MG8B 2ZK0A 3D57A 2AB2A 2R6YA 4KZJA 3X31A 2ATHA 4L98A 4RWVA 3DZYD 1PQ9A 2I4JA 1OVLA 5E19A 3ERDA 3H52A 4NY9A 4ZNUA 3WJ4A 1ZEOA 3L1BA 2FAIA 3W0AA 3OSAA 5LWPA 2HASA 2G0HA 2EWPA 3CS4A 5DY8A 3V9VA 3MNPA 3D24A 1X76A 4S14A 4PXMA 3UUCA 1XB7A 2XYJA 4PP3A 4WVDA 3M7RA 5DMFA 5EGVA 4CI5A 3HM1A 4ZO1X 1S0XA 1M2ZA 3B1MA 4XT9A 1Y9RA 3RLJA 5KYAA 1Z5XE 3PO9A 4MGAA 3L0EA 4OARA 2QGWA 3SP6A 1LV2A 1FM9D 3DCUA 2B1VA 2HB7A 4IW6A 2Q1HA 5DKEA 2NXXA 3VI8A 3RVFA 3UU7A 1U9EA 2PIQA 5KRJA 3L3ZA 2ZFXA 1E3KA 1XAPA 5E1CA 4JYIA 4OKTA 2J4AA 3X36A 2OM9A 4G20A 4LSJA 4OK1A 1XQCA 5DWJA 3T03A 5DXBB 3A2JA 1TFCA 5IXKA 2YJAB 1YP0A 1FM6D 3FS1A 2JFAA 4G1YA 4S0TA 3AUQA 5C4TA 1N4HA 1PZLA 3LMPA 4IV4A 3P0UA 1RDTD 1XQ3A 2QMVA 5FQTA 3W0JA 1XZXX 3HQ5A 2P1VA 1YIMA 5AZTA 3VSPA 3WT7A 2IOKA 5DKBA 5HCVA 1I7GA 4PPPA 4UDCA 2NXXE 3GYUA 4PP5A 3W0CA 5HZCA 4NQAB 4XLDA 3EYBA 3G0WA 5DZIA 2GTKA 5DVCA 2AA7A 2ZMIA 1T7FA 2YATA 3QT0A 2GPUA 3BQDA 5L7EA 1PK5A 4APUA 1MVCA 3B0QA 2VV4B 5DUHA 1GWQA 3IPQA 2P54A 4OZTE 3ET3A 4ZN7A 3HO0A 3OSIA 4FNEA 5E15A 4CSJA 1L2IA 4J26A 5JJMA 1R20A 2AX7A 3ERTA 1P8DA 2PIRA 2ZMHA 3B0RA 4N5GA 4OH6A 2HCDA 4G1DA 1M7WA 2P7AA 5SYZA 3AUNA 4J5XC 1ZGYA 3L03A 3A2IA 1KNUA 5CJ6A 3AZ3A 5DUEA 3IPUA 2Q7JA 2ABIA 3OMQA 3FEIA 4MG9A 3VTBA 3DZUA 5GICA 4E2JA 1T74A 2AX6A 5G45A 2Q5GA 2R40A 3VSOA 3V9TA 2F4BA 4L96A 2IHQA 1YJEA 4OJ9A 2OAXA 2HWQA 4REFA 1NRLA 5AWKA 3VT9A 3PEQA 3UVVA 2G5OA 3V3EA 3O1EA 3SP9A 4J5WA 2YLYA 1QKUA 3VRWA 5DXQA 3H0AD 4A4WA 2GIUA 4POJA 3RY9A 2E2RA 4J5WC 3WT5A 1T5ZA 3OKHA 2HB8A 4LTWA 5APJA 5ICKA 1XDKA 4NIEA 3D6DA 4OH5A 3ET2A 5ETHA 2PINA 3E7CA 3ZRAA 2AX8A 5APHA 5DK9A 2AA5A 3VJIA 4BCRA 3ADUA 4IW8A 5DLRA 4ZNVA 5KRHA 3FALB 5KRKA 3G8IA 2B50A 1XNXA 1SQNA 1S19A 2G44A 3VT3A 4RZGA 3PRGA 2Q7IA 5DP0A 1RKGA 5L7GA 1MZNA 2Q59A 2Z4JA 1OT7A 4LBDA 5FQRA 1A52A 4PF3A 1HJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGH A;  3KPZ A;  4R2U A;  3OS8 A;  3OZ0 A;  5DZ0 A;  1K7L A;  2B23 A;  3VRT A;  2QGT A;  5E0W A;  4OIV A;  5HYR A;  4Q50 A;  3CJW A;  3RLL A;  1UHL B;  4HLW A;  3OS8 C;  3OAP A;  3A9E B;  3KMZ A;  2QZO B;  3OSW A;  1T7R A;  2JF9 A;  1K74 A;  3ZRB A;  3HC6 A;  3G8O A;  3HZF A;  3KMR A;  1ZDT A;  3N00 A;  3O1D A;  4MGD A;  5DWG A;  5DXG A;  3TKM A;  4LNW A;  3IA6 A;  4MGB A;  3Q95 B;  1MV9 A;  1X7B A;  2PNU A;  2P7G A;  2HAM A;  2ZY0 A;  2REW A;  3KBA A;  3B66 A;  5FQP A;  5AVL A;  4OKX A;  5AK2 A;  2ZL9 A;  4YT1 A;  3DR1 A;  3R5N A;  4IS8 A;  4UDA A;  2QA8 B;  1U3S A;  4G2I A;  1YY4 A;  4IA3 A;  5DZH A;  5G3J A;  4IQR A;  2YLP A;  3R8D A;  5FQS A;  1GWX A;  5HJP B;  1PQ6 A;  2J14 A;  3E94 A;  4RE8 A;  3JZC A;  3R2A A;  5DL4 A;  3VT5 A;  1XP9 A;  4NUF A;  1A28 A;  2GL8 A;  1KKQ A;  3UUA B;  1G2N A;  1QKM A;  1DKF A;  2Q8S A;  4IVW A;  4OEY A;  3ADS A;  1G1U A;  2XYX A;  3OMO A;  2XKW A;  4MG7 A;  5A86 A;  1ERE A;  4S15 A;  2ZMJ A;  4NB6 A;  4RUO X;  2AO6 A;  5GID A;  1T7T A;  5DWL A;  5AZV A;  4FHH A;  5KR9 A;  1R5K A;  2Q5P A;  1OVL B;  5KRI A;  4WPF A;  2QA6 A;  3KDT A;  5DXB A;  4PLD A;  1XPC A;  5JY3 A;  4K4J A;  1YMT A;  1FCZ A;  3GD2 A;  3B0T A;  5AAV B;  3WTQ A;  1ERR A;  1IE9 A;  1PCG A;  1Z5X U;  4WHF A;  2AA6 A;  1ILG A;  3GBK A;  5DVS A;  1NHZ A;  5KCF A;  4PLE A;  2P1U A;  2ACL B;  3VJT A;  4M8H A;  4M8E A;  2XYW A;  4IWC A;  1Q4X A;  3DT3 A;  5DXM A;  5EIT A;  1X7R A;  2I0J A;  3A40 X;  5DX3 B;  3HLV A;  3P89 A;  2YHD A;  3GYT A;  3VT4 A;  4RFW A;  2PIP L;  1NAX A;  2POB A;  4RZE A;  5KYJ A;  1R1K A;  5G44 A;  3CS8 A;  3OKI A;  3ADX A;  2QW4 A;  3V49 A;  5I4V A;  4G21 A;  2Q6R A;  4WHG A;  4ZNS A;  1YOW A;  3D90 A;  1SJ0 A;  1YUC A;  3ILZ A;  4N1Y A;  3UU7 B;  3VT8 A;  4EM9 A;  1ZKY A;  1OSV A;  1GS4 A;  5G42 A;  2QSE A;  1R20 D;  2VV4 A;  2ZK5 A;  3L3X A;  3MNO A;  4N73 A;  4PVU A;  2ZKC A;  1GWR A;  3GWX A;  1PQC A;  5K13 A;  3CWD A;  1U3R A;  2JFA B;  1XIU A;  4XTA A;  3IPS A;  3NSQ A;  3R5M A;  4OZR E;  5B41 A;  2PKL A;  3K8S A;  4P6W A;  4YNK A;  4IVY A;  2Z4B A;  3L0L A;  2R6W A;  4FGY A;  2BJ4 B;  3F5C A;  1HG4 A;  2O9I A;  4A2J A;  1S9P A;  3DZU D;  2R40 D;  4J5X A;  3GWS X;  3AZ1 A;  2V7C A;  4O8F A;  3R8A A;  5HJS A;  2VV1 A;  4MG6 A;  4YMQ A;  4TV1 B;  2NW4 A;  1ILH A;  2POG A;  4JYG A;  4QE8 A;  4XAO A;  1OSH A;  1RK3 A;  1SR7 A;  3FUG A;  4KZI A;  4DK8 A;  5B5B A;  3VJS A;  5C4S A;  2AAX A;  2GPO A;  3HOD A;  2YJD A;  3W0Y A;  3X1I A;  1XP6 A;  3WJ5 A;  1G50 A;  3CDS A;  5EC9 A;  2OVM A;  3R29 A;  1QKT A;  1XV9 A;  3DY6 A;  5EJV A;  1UOM A;  2XHS A;  4CI4 A;  3OMP A;  4OZT U;  3ZQT A;  4IWF A;  3L0J A;  4G2H A;  3SZ1 A;  4HEE X;  4FN9 A;  3CLD A;  4PPS A;  4WQP A;  5KRF A;  1BSX A;  3VRU A;  1I7I A;  3R8I A;  2YLQ A;  5DWE A;  1I38 A;  2GPV A;  4QJR A;  4QK4 A;  1TXI A;  5G43 A;  4E4Q A;  3VN2 A;  3VTC A;  5JJM B;  2VSR A;  1NQ2 A;  2H79 A;  3AUR A;  2VV2 A;  1DB1 A;  3FC6 A;  2QTU A;  1UPW A;  2AXA A;  1EXA A;  1EXX A;  4DMA A;  3W0H A;  4JYH A;  5DMC A;  3HVL A;  4X1F A;  3UUD A;  3CQV A;  1X78 A;  1E3G A;  1XNN A;  3K6P A;  2QNV A;  3VT7 A;  3E00 A;  5DU5 A;  5ACC A;  4TUZ B;  4OEA A;  2I0G A;  5DID A;  4IA2 A;  1T73 A;  4OJ4 A;  3A2H A;  5KRL A;  2G0G A;  5JI0 D;  3CTB A;  2A3I A;  3UVV B;  1K74 D;  1XVP B;  1IE8 A;  5KCC A;  1T7M A;  2QH6 A;  3IMY A;  5GIE A;  1U3Q A;  1UHL A;  2VV3 A;  4RUJ A;  5DYD A;  1I37 A;  4ZJR A;  4MG8 A;  2QZO A;  5DVV A;  4POH A;  4RZF A;  4PRG A;  5E14 A;  4IV2 A;  2HVC A;  3RUT A;  3WWR A;  3KYT A;  2OUZ A;  4OC7 A;  1XDK B;  1NUO A;  4UDD A;  5KRA A;  4A4V A;  2PJL A;  3OLS A;  3OOK A;  5E0X A;  3WT6 A;  2OVH A;  3K23 A;  1XLS A;  4S0S A;  2Q61 A;  2ZK4 A;  1RKH A;  5IAW A;  2Q1V A;  5AWJ A;  3VJH A;  3VT6 A;  2I4Z A;  4XUH A;  5KCE A;  2P7Z A;  2Q6J A;  5DXR A;  1M13 A;  1T65 A;  4QL8 A;  1ZAF A;  2PIT A;  2QA8 A;  5DXE A;  3B5R A;  2Q7K A;  4DK7 A;  5C4O A;  5GT4 A;  2I4P A;  2J7X A;  4OLM A;  4OKW A;  2Q59 B;  1YIN A;  2Q70 A;  1NQ7 A;  2PIX A;  1ZDU A;  4IA1 A;  5KRC A;  1FD0 A;  2ZK1 A;  2B1Z A;  2PIW A;  4ZN9 A;  4IUI A;  3B65 A;  5DV6 A;  3PBA A;  1S9Q A;  2Q60 A;  2QR9 A;  5LGA A;  1X7E A;  2Q6S A;  3JZB A;  3MNE A;  3V3Q A;  5IZ0 A;  4DM8 A;  3VHW A;  5DXP A;  2ZVT A;  4WLB A;  4PP6 A;  2PRG A;  4JGV A;  5DXK A;  1FCX A;  4XHD A;  1XLS E;  1XP1 A;  2GPP A;  4ZNH A;  2BAW A;  3FLI A;  2ZLC A;  4MGD B;  3IXP A;  3KMG A;  4RMC A;  1YA3 A;  5L7H A;  3A3Z X;  4MGB B;  3AFR A;  3VTD A;  1PDU A;  2QE4 A;  4R06 A;  1K4W A;  3TKC A;  4Q0A C;  3OMK A;  3X1H A;  5AAV A;  1Z95 A;  4RAK A;  2OZ7 A;  3AZ2 A;  1QKN A;  2HC4 A;  2YLO A;  4ITE A;  3DZY A;  3U9Q A;  2ACL A;  1LBD A;  4EMA A;  2Q5S A;  1R1K D;  4ITF A;  2O4J A;  5DSH A;  5DWI A;  4P6X A;  3UP3 A;  5DX3 A;  3ZR7 A;  2AYR A;  4B7W A;  1PRG A;  2QPY A;  3VHV A;  1H9U A;  2IOG A;  5E7V A;  1S0Z A;  3W5T A;  4MGA B;  4J24 A;  4ZJW A;  1DKF B;  2JJ3 A;  4OJB A;  4OIL A;  2V0V A;  2ZBS A;  3GN8 A;  2ZNO A;  4MG5 A;  1SKX A;  1T76 A;  3P8X A;  4MG7 B;  1NAV A;  3KWY A;  3B0W A;  2PIV A;  3FEJ A;  3W0G A;  1ZUC A;  1Y0X X;  3AN4 A;  4OHA A;  5AAU A;  3S9S A;  3ADV A;  3TX7 B;  2J7Y A;  1FM9 A;  4OFU A;  1FCY A;  1WM0 X;  2ZK3 A;  2ZNP A;  4K6I A;  2HBH A;  2ZK6 A;  3WFF A;  5AYG A;  1X7J A;  3FUR A;  1G5Y A;  3OLL A;  5APK A;  3AN3 A;  5DTV A;  1XJ7 A;  2P4Y A;  2BJ4 A;  2VV0 A;  3DCT A;  4OKB A;  3OZJ A;  2GP7 A;  4OIU A;  3NSP A;  3VRV A;  3A78 A;  1KV6 A;  2ZK2 A;  3LBD A;  4TV1 A;  3RUU A;  2OCF A;  1NDE A;  5M96 A;  4YPQ A;  2AMB A;  4ZI1 A;  3OGT A;  3OS9 A;  1FM6 A;  5DV3 A;  1NQ1 A;  4ONI A;  1Y0S A;  4ZOM A;  4XI3 A;  3ADT A;  5DZ3 A;  1RDT A;  2P15 A;  4DM6 A;  4QM0 A;  3AX8 A;  5DYB A;  5DKG A;  3CS6 A;  4ZNW A;  2ZXN A;  5G5W A;  3OOF A;  5DIE A;  4QE6 A;  3WFG A;  3ADW A;  1NQ0 A;  1R6G A;  3F7D A;  1L2J A;  1RJK A;  4Q13 A;  3VHU A;  4OZR U;  5DKS A;  4JAZ A;  5KRO A;  3TY0 A;  5KCD A;  5DZ1 A;  3GZ9 A;  2ZXM A;  2W8Y A;  3OMM A;  3BC5 A;  3KFC A;  1T79 A;  1FBY A;  3V9Y A;  3F5C B;  3B3K A;  3ET0 A;  3E00 D;  3WMH A;  4N8R A;  3PCU A;  5FQV A;  4KZM A;  2VV1 B;  1N83 A;  4Y29 A;  2AX9 A;  3FXV A;  4LNX A;  3W5R A;  4JL4 A;  4DOR A;  5KCT A;  2PIO A;  5EI1 A;  1VJB A;  3OLF A;  3FAL A;  5G46 A;  2YFE A;  4TUZ A;  5DRJ A;  4XUM A;  2Q3Y A;  4ZO1 B;  4MG9 B;  4DQM A;  1ZH7 A;  3ET1 A;  2FSZ A;  5H1E A;  2Q7L A;  5F9B A;  5KCU A;  2AMA A;  4PWL A;  4RUP A;  3KDU A;  1XVP A;  4R6S A;  1XV9 B;  4DOS A;  1XOW A;  4MGC A;  2ZNQ A;  4X1G A;  4MDD A;  3NOA A;  2H77 A;  5KRM A;  4RME A;  2PIU A;  3D5F A;  4OFR A;  4REE A;  1UPV A;  2HFP A;  3PLZ A;  3P88 A;  1YYE A;  5DUG A;  4FHI A;  3A9E A;  4IU7 A;  2ZNN A;  4G1Z A;  2QXS A;  5DV8 A;  4F9M A;  5KD9 A;  5EHJ A;  5DIG A;  4OED A;  3FC6 B;  5AVI A;  4RMD A;  1NYX A;  3H0A A;  3HC5 A;  2NPA A;  4K7A A;  2O4R A;  3BEJ A;  2NV7 A;  3K22 A;  5C4U A;  2VST A;  3WGP A;  3W5P A;  4IA7 A;  3Q95 A;  2HWR A;  5KCW A;  5HYK A;  3B67 A;  3UUD B;  3W0I A;  3UP0 A;  4UDB A;  1T63 A;  2GWX A;  3B68 A;  1N46 A;  2AM9 A;  2AA2 A;  3CDP A;  4ZNT A;  2QAB A;  1YOK A;  2QXM A;  5HJP A;  2ZLA A;  4OEZ A;  2LBD A;  2ZXZ A;  5L11 A;  2ZAS A;  4E4K A;  3V4A A;  3G9E A;  2FVJ A;  3UUA A;  3IXP D;  2P1T A;  5DI7 A;  5DRM A;  1P93 A;  2HAR A;  2AWH A;  3W5Q A;  4MG8 B;  2ZK0 A;  3D57 A;  2AB2 A;  2R6Y A;  4KZJ A;  3X31 A;  2ATH A;  4L98 A;  4RWV A;  3DZY D;  1PQ9 A;  2I4J A;  1OVL A;  5E19 A;  3ERD A;  3H52 A;  4NY9 A;  4ZNU A;  3WJ4 A;  1ZEO A;  3L1B A;  2FAI A;  3W0A A;  3OSA A;  5LWP A;  2HAS A;  2G0H A;  2EWP A;  3CS4 A;  5DY8 A;  3V9V A;  3MNP A;  3D24 A;  1X76 A;  4S14 A;  4PXM A;  3UUC A;  1XB7 A;  2XYJ A;  4PP3 A;  4WVD A;  3M7R A;  5DMF A;  5EGV A;  4CI5 A;  3HM1 A;  4ZO1 X;  1S0X A;  1M2Z A;  3B1M A;  4XT9 A;  1Y9R A;  3RLJ A;  5KYA A;  1Z5X E;  3PO9 A;  4MGA A;  3L0E A;  4OAR A;  2QGW A;  3SP6 A;  1LV2 A;  1FM9 D;  3DCU A;  2B1V A;  2HB7 A;  4IW6 A;  2Q1H A;  5DKE A;  2NXX A;  3VI8 A;  3RVF A;  3UU7 A;  1U9E A;  2PIQ A;  5KRJ A;  3L3Z A;  2ZFX A;  1E3K A;  1XAP A;  5E1C A;  4JYI A;  4OKT A;  2J4A A;  3X36 A;  2OM9 A;  4G20 A;  4LSJ A;  4OK1 A;  1XQC A;  5DWJ A;  3T03 A;  5DXB B;  3A2J A;  1TFC A;  5IXK A;  2YJA B;  1YP0 A;  1FM6 D;  3FS1 A;  2JFA A;  4G1Y A;  4S0T A;  3AUQ A;  5C4T A;  1N4H A;  1PZL A;  3LMP A;  4IV4 A;  3P0U A;  1RDT D;  1XQ3 A;  2QMV A;  5FQT A;  3W0J A;  1XZX X;  3HQ5 A;  2P1V A;  1YIM A;  5AZT A;  3VSP A;  3WT7 A;  2IOK A;  5DKB A;  5HCV A;  1I7G A;  4PPP A;  4UDC A;  2NXX E;  3GYU A;  4PP5 A;  3W0C A;  5HZC A;  4NQA B;  4XLD A;  3EYB A;  3G0W A;  5DZI A;  2GTK A;  5DVC A;  2AA7 A;  2ZMI A;  1T7F A;  2YAT A;  3QT0 A;  2GPU A;  3BQD A;  5L7E A;  1PK5 A;  4APU A;  1MVC A;  3B0Q A;  2VV4 B;  5DUH A;  1GWQ A;  3IPQ A;  2P54 A;  4OZT E;  3ET3 A;  4ZN7 A;  3HO0 A;  3OSI A;  4FNE A;  5E15 A;  4CSJ A;  1L2I A;  4J26 A;  5JJM A;  1R20 A;  2AX7 A;  3ERT A;  1P8D A;  2PIR A;  2ZMH A;  3B0R A;  4N5G A;  4OH6 A;  2HCD A;  4G1D A;  1M7W A;  2P7A A;  5SYZ A;  3AUN A;  4J5X C;  1ZGY A;  3L03 A;  3A2I A;  1KNU A;  5CJ6 A;  3AZ3 A;  5DUE A;  3IPU A;  2Q7J A;  2ABI A;  3OMQ A;  3FEI A;  4MG9 A;  3VTB A;  3DZU A;  5GIC A;  4E2J A;  1T74 A;  2AX6 A;  5G45 A;  2Q5G A;  2R40 A;  3VSO A;  3V9T A;  2F4B A;  4L96 A;  2IHQ A;  1YJE A;  4OJ9 A;  2OAX A;  2HWQ A;  4REF A;  1NRL A;  5AWK A;  3VT9 A;  3PEQ A;  3UVV A;  2G5O A;  3V3E A;  3O1E A;  3SP9 A;  4J5W A;  2YLY A;  1QKU A;  3VRW A;  5DXQ A;  3H0A D;  4A4W A;  2GIU A;  4POJ A;  3RY9 A;  2E2R A;  4J5W C;  3WT5 A;  1T5Z A;  3OKH A;  2HB8 A;  4LTW A;  5APJ A;  5ICK A;  1XDK A;  4NIE A;  3D6D A;  4OH5 A;  3ET2 A;  5ETH A;  2PIN A;  3E7C A;  3ZRA A;  2AX8 A;  5APH A;  5DK9 A;  2AA5 A;  3VJI A;  4BCR A;  3ADU A;  4IW8 A;  5DLR A;  4ZNV A;  5KRH A;  3FAL B;  5KRK A;  3G8I A;  2B50 A;  1XNX A;  1SQN A;  1S19 A;  2G44 A;  3VT3 A;  4RZG A;  3PRG A;  2Q7I A;  5DP0 A;  1RKG A;  5L7G A;  1MZN A;  2Q59 A;  2Z4J A;  1OT7 A;  4LBD A;  5FQR A;  1A52 A;  4PF3 A;  1HJ1 A; 
#chains in the Genus database with same CATH topology
 4OGH A;  3KPZ A;  4R2U A;  3OS8 A;  3OZ0 A;  5DZ0 A;  1K7L A;  2B23 A;  3VRT A;  2QGT A;  5E0W A;  4OIV A;  5HYR A;  4Q50 A;  3CJW A;  3RLL A;  1UHL B;  4HLW A;  3OS8 C;  3OAP A;  3A9E B;  3KMZ A;  2QZO B;  3OSW A;  1T7R A;  2JF9 A;  1K74 A;  3ZRB A;  3HC6 A;  3G8O A;  3HZF A;  3KMR A;  1ZDT A;  3N00 A;  3O1D A;  4MGD A;  5DWG A;  5DXG A;  3TKM A;  4LNW A;  3IA6 A;  4MGB A;  3Q95 B;  1MV9 A;  1X7B A;  2PNU A;  2P7G A;  2HAM A;  2ZY0 A;  2REW A;  3KBA A;  3B66 A;  5FQP A;  5AVL A;  4OKX A;  5AK2 A;  2ZL9 A;  4YT1 A;  3DR1 A;  3R5N A;  4IS8 A;  4UDA A;  2QA8 B;  1U3S A;  4G2I A;  1YY4 A;  4IA3 A;  5DZH A;  5G3J A;  4IQR A;  2YLP A;  3R8D A;  5FQS A;  1GWX A;  5HJP B;  1PQ6 A;  2J14 A;  3E94 A;  4RE8 A;  3JZC A;  3R2A A;  5DL4 A;  3VT5 A;  1XP9 A;  4NUF A;  1A28 A;  2GL8 A;  1KKQ A;  3UUA B;  1G2N A;  1QKM A;  1DKF A;  2Q8S A;  4IVW A;  4OEY A;  3ADS A;  1G1U A;  2XYX A;  3OMO A;  2XKW A;  4MG7 A;  5A86 A;  1ERE A;  4S15 A;  2ZMJ A;  4NB6 A;  4RUO X;  2AO6 A;  5GID A;  1T7T A;  5DWL A;  5AZV A;  4FHH A;  5KR9 A;  1R5K A;  2Q5P A;  1OVL B;  5KRI A;  4WPF A;  2QA6 A;  3KDT A;  5DXB A;  4PLD A;  1XPC A;  5JY3 A;  4K4J A;  1YMT A;  1FCZ A;  3GD2 A;  3B0T A;  5AAV B;  3WTQ A;  1ERR A;  1IE9 A;  1PCG A;  1Z5X U;  4WHF A;  2AA6 A;  1ILG A;  3GBK A;  5DVS A;  1NHZ A;  5KCF A;  4PLE A;  2P1U A;  2ACL B;  3VJT A;  4M8H A;  4M8E A;  2XYW A;  4IWC A;  1Q4X A;  3DT3 A;  5DXM A;  5EIT A;  1X7R A;  2I0J A;  3A40 X;  5DX3 B;  3HLV A;  3P89 A;  2YHD A;  3GYT A;  3VT4 A;  4RFW A;  2PIP L;  1NAX A;  2POB A;  4RZE A;  5KYJ A;  1R1K A;  5G44 A;  3CS8 A;  3OKI A;  3ADX A;  2QW4 A;  3V49 A;  5I4V A;  4G21 A;  2Q6R A;  4WHG A;  4ZNS A;  1YOW A;  3D90 A;  1SJ0 A;  1YUC A;  3ILZ A;  4N1Y A;  3UU7 B;  3VT8 A;  4EM9 A;  1ZKY A;  1OSV A;  1GS4 A;  5G42 A;  2QSE A;  1R20 D;  2VV4 A;  2ZK5 A;  3L3X A;  3MNO A;  4N73 A;  4PVU A;  2ZKC A;  1GWR A;  3GWX A;  1PQC A;  5K13 A;  3CWD A;  1U3R A;  2JFA B;  1XIU A;  4XTA A;  3IPS A;  3NSQ A;  3R5M A;  4OZR E;  5B41 A;  2PKL A;  3K8S A;  4P6W A;  4YNK A;  4IVY A;  2Z4B A;  3L0L A;  2R6W A;  4FGY A;  2BJ4 B;  3F5C A;  1HG4 A;  2O9I A;  4A2J A;  1S9P A;  3DZU D;  2R40 D;  4J5X A;  3GWS X;  3AZ1 A;  2V7C A;  4O8F A;  3R8A A;  5HJS A;  2VV1 A;  4MG6 A;  4YMQ A;  4TV1 B;  2NW4 A;  1ILH A;  2POG A;  4JYG A;  4QE8 A;  4XAO A;  1OSH A;  1RK3 A;  1SR7 A;  3FUG A;  4KZI A;  4DK8 A;  5B5B A;  3VJS A;  5C4S A;  2AAX A;  2GPO A;  3HOD A;  2YJD A;  3W0Y A;  3X1I A;  1XP6 A;  3WJ5 A;  1G50 A;  3CDS A;  5EC9 A;  2OVM A;  3R29 A;  1QKT A;  1XV9 A;  3DY6 A;  5EJV A;  1UOM A;  2XHS A;  4CI4 A;  3OMP A;  4OZT U;  3ZQT A;  4IWF A;  3L0J A;  4G2H A;  3SZ1 A;  4HEE X;  4FN9 A;  3CLD A;  4PPS A;  4WQP A;  5KRF A;  1BSX A;  3VRU A;  1I7I A;  3R8I A;  2YLQ A;  5DWE A;  1I38 A;  2GPV A;  4QJR A;  4QK4 A;  1TXI A;  5G43 A;  4E4Q A;  3VN2 A;  3VTC A;  5JJM B;  2VSR A;  1NQ2 A;  2H79 A;  3AUR A;  2VV2 A;  1DB1 A;  3FC6 A;  2QTU A;  1UPW A;  2AXA A;  1EXA A;  1EXX A;  4DMA A;  3W0H A;  4JYH A;  5DMC A;  3HVL A;  4X1F A;  3UUD A;  3CQV A;  1X78 A;  1E3G A;  1XNN A;  3K6P A;  2QNV A;  3VT7 A;  3E00 A;  5DU5 A;  5ACC A;  4TUZ B;  4OEA A;  2I0G A;  5DID A;  4IA2 A;  1T73 A;  4OJ4 A;  3A2H A;  5KRL A;  2G0G A;  5JI0 D;  3CTB A;  2A3I A;  3UVV B;  1K74 D;  1XVP B;  1IE8 A;  5KCC A;  1T7M A;  2QH6 A;  3IMY A;  5GIE A;  1U3Q A;  1UHL A;  2VV3 A;  4RUJ A;  5DYD A;  1I37 A;  4ZJR A;  4MG8 A;  2QZO A;  5DVV A;  4POH A;  4RZF A;  4PRG A;  5E14 A;  4IV2 A;  2HVC A;  3RUT A;  3WWR A;  3KYT A;  2OUZ A;  4OC7 A;  1XDK B;  1NUO A;  4UDD A;  5KRA A;  4A4V A;  2PJL A;  3OLS A;  3OOK A;  5E0X A;  3WT6 A;  2OVH A;  3K23 A;  1XLS A;  4S0S A;  2Q61 A;  2ZK4 A;  1RKH A;  5IAW A;  2Q1V A;  5AWJ A;  3VJH A;  3VT6 A;  2I4Z A;  4XUH A;  5KCE A;  2P7Z A;  2Q6J A;  5DXR A;  1M13 A;  1T65 A;  4QL8 A;  1ZAF A;  2PIT A;  2QA8 A;  5DXE A;  3B5R A;  2Q7K A;  4DK7 A;  5C4O A;  5GT4 A;  2I4P A;  2J7X A;  4OLM A;  4OKW A;  2Q59 B;  1YIN A;  2Q70 A;  1NQ7 A;  2PIX A;  1ZDU A;  4IA1 A;  5KRC A;  1FD0 A;  2ZK1 A;  2B1Z A;  2PIW A;  4ZN9 A;  4IUI A;  3B65 A;  5DV6 A;  3PBA A;  1S9Q A;  2Q60 A;  2QR9 A;  5LGA A;  1X7E A;  2Q6S A;  3JZB A;  3MNE A;  3V3Q A;  5IZ0 A;  4DM8 A;  3VHW A;  5DXP A;  2ZVT A;  4WLB A;  4PP6 A;  2PRG A;  4JGV A;  5DXK A;  1FCX A;  4XHD A;  1XLS E;  1XP1 A;  2GPP A;  4ZNH A;  2BAW A;  3FLI A;  2ZLC A;  4MGD B;  3IXP A;  3KMG A;  4RMC A;  1YA3 A;  5L7H A;  3A3Z X;  4MGB B;  3AFR A;  3VTD A;  1PDU A;  2QE4 A;  4R06 A;  1K4W A;  3TKC A;  4Q0A C;  3OMK A;  3X1H A;  5AAV A;  1Z95 A;  4RAK A;  2OZ7 A;  3AZ2 A;  1QKN A;  2HC4 A;  2YLO A;  4ITE A;  3DZY A;  3U9Q A;  2ACL A;  1LBD A;  4EMA A;  2Q5S A;  1R1K D;  4ITF A;  2O4J A;  5DSH A;  5DWI A;  4P6X A;  3UP3 A;  5DX3 A;  3ZR7 A;  2AYR A;  4B7W A;  1PRG A;  2QPY A;  3VHV A;  1H9U A;  2IOG A;  5E7V A;  1S0Z A;  3W5T A;  4MGA B;  4J24 A;  4ZJW A;  1DKF B;  2JJ3 A;  4OJB A;  4OIL A;  2V0V A;  2ZBS A;  3GN8 A;  2ZNO A;  4MG5 A;  1SKX A;  1T76 A;  3P8X A;  4MG7 B;  1NAV A;  3KWY A;  3B0W A;  2PIV A;  3FEJ A;  3W0G A;  1ZUC A;  1Y0X X;  3AN4 A;  4OHA A;  5AAU A;  3S9S A;  3ADV A;  3TX7 B;  2J7Y A;  1FM9 A;  4OFU A;  1FCY A;  1WM0 X;  2ZK3 A;  2ZNP A;  4K6I A;  2HBH A;  2ZK6 A;  3WFF A;  5AYG A;  1X7J A;  3FUR A;  1G5Y A;  3OLL A;  5APK A;  3AN3 A;  5DTV A;  1XJ7 A;  2P4Y A;  2BJ4 A;  2VV0 A;  3DCT A;  4OKB A;  3OZJ A;  2GP7 A;  4OIU A;  3NSP A;  3VRV A;  3A78 A;  1KV6 A;  2ZK2 A;  3LBD A;  4TV1 A;  3RUU A;  2OCF A;  1NDE A;  5M96 A;  4YPQ A;  2AMB A;  4ZI1 A;  3OGT A;  3OS9 A;  1FM6 A;  5DV3 A;  1NQ1 A;  4ONI A;  1Y0S A;  4ZOM A;  4XI3 A;  3ADT A;  5DZ3 A;  1RDT A;  2P15 A;  4DM6 A;  4QM0 A;  3AX8 A;  5DYB A;  5DKG A;  3CS6 A;  4ZNW A;  2ZXN A;  5G5W A;  3OOF A;  5DIE A;  4QE6 A;  3WFG A;  3ADW A;  1NQ0 A;  1R6G A;  3F7D A;  1L2J A;  1RJK A;  4Q13 A;  3VHU A;  4OZR U;  5DKS A;  4JAZ A;  5KRO A;  3TY0 A;  5KCD A;  5DZ1 A;  3GZ9 A;  2ZXM A;  2W8Y A;  3OMM A;  3BC5 A;  3KFC A;  1T79 A;  1FBY A;  3V9Y A;  3F5C B;  3B3K A;  3ET0 A;  3E00 D;  3WMH A;  4N8R A;  3PCU A;  5FQV A;  4KZM A;  2VV1 B;  1N83 A;  4Y29 A;  2AX9 A;  3FXV A;  4LNX A;  3W5R A;  4JL4 A;  4DOR A;  5KCT A;  2PIO A;  5EI1 A;  1VJB A;  3OLF A;  3FAL A;  5G46 A;  2YFE A;  4TUZ A;  5DRJ A;  4XUM A;  2Q3Y A;  4ZO1 B;  4MG9 B;  4DQM A;  1ZH7 A;  3ET1 A;  2FSZ A;  5H1E A;  2Q7L A;  5F9B A;  5KCU A;  2AMA A;  4PWL A;  4RUP A;  3KDU A;  1XVP A;  4R6S A;  1XV9 B;  4DOS A;  1XOW A;  4MGC A;  2ZNQ A;  4X1G A;  4MDD A;  3NOA A;  2H77 A;  5KRM A;  4RME A;  2PIU A;  3D5F A;  4OFR A;  4REE A;  1UPV A;  2HFP A;  3PLZ A;  3P88 A;  1YYE A;  5DUG A;  4FHI A;  3A9E A;  4IU7 A;  2ZNN A;  4G1Z A;  2QXS A;  5DV8 A;  4F9M A;  5KD9 A;  5EHJ A;  5DIG A;  4OED A;  3FC6 B;  5AVI A;  4RMD A;  1NYX A;  3H0A A;  3HC5 A;  2NPA A;  4K7A A;  2O4R A;  3BEJ A;  2NV7 A;  3K22 A;  5C4U A;  2VST A;  3WGP A;  3W5P A;  4IA7 A;  3Q95 A;  2HWR A;  5KCW A;  5HYK A;  3B67 A;  3UUD B;  3W0I A;  3UP0 A;  4UDB A;  1T63 A;  2GWX A;  3B68 A;  1N46 A;  2AM9 A;  2AA2 A;  3CDP A;  4ZNT A;  2QAB A;  1YOK A;  2QXM A;  5HJP A;  2ZLA A;  4OEZ A;  2LBD A;  2ZXZ A;  5L11 A;  2ZAS A;  4E4K A;  3V4A A;  3G9E A;  2FVJ A;  3UUA A;  3IXP D;  2P1T A;  5DI7 A;  5DRM A;  1P93 A;  2HAR A;  2AWH A;  3W5Q A;  4MG8 B;  2ZK0 A;  3D57 A;  2AB2 A;  2R6Y A;  4KZJ A;  3X31 A;  2ATH A;  4L98 A;  4RWV A;  3DZY D;  1PQ9 A;  2I4J A;  1OVL A;  5E19 A;  3ERD A;  3H52 A;  4NY9 A;  4ZNU A;  3WJ4 A;  1ZEO A;  3L1B A;  2FAI A;  3W0A A;  3OSA A;  5LWP A;  2HAS A;  2G0H A;  2EWP A;  3CS4 A;  5DY8 A;  3V9V A;  3MNP A;  3D24 A;  1X76 A;  4S14 A;  4PXM A;  3UUC A;  1XB7 A;  2XYJ A;  4PP3 A;  4WVD A;  3M7R A;  5DMF A;  5EGV A;  4CI5 A;  3HM1 A;  4ZO1 X;  1S0X A;  1M2Z A;  3B1M A;  4XT9 A;  1Y9R A;  3RLJ A;  5KYA A;  1Z5X E;  3PO9 A;  4MGA A;  3L0E A;  4OAR A;  2QGW A;  3SP6 A;  1LV2 A;  1FM9 D;  3DCU A;  2B1V A;  2HB7 A;  4IW6 A;  2Q1H A;  5DKE A;  2NXX A;  3VI8 A;  3RVF A;  3UU7 A;  1U9E A;  2PIQ A;  5KRJ A;  3L3Z A;  2ZFX A;  1E3K A;  1XAP A;  5E1C A;  4JYI A;  4OKT A;  2J4A A;  3X36 A;  2OM9 A;  4G20 A;  4LSJ A;  4OK1 A;  1XQC A;  5DWJ A;  3T03 A;  5DXB B;  3A2J A;  1TFC A;  5IXK A;  2YJA B;  1YP0 A;  1FM6 D;  3FS1 A;  2JFA A;  4G1Y A;  4S0T A;  3AUQ A;  5C4T A;  1N4H A;  1PZL A;  3LMP A;  4IV4 A;  3P0U A;  1RDT D;  1XQ3 A;  2QMV A;  5FQT A;  3W0J A;  1XZX X;  3HQ5 A;  2P1V A;  1YIM A;  5AZT A;  3VSP A;  3WT7 A;  2IOK A;  5DKB A;  5HCV A;  1I7G A;  4PPP A;  4UDC A;  2NXX E;  3GYU A;  4PP5 A;  3W0C A;  5HZC A;  4NQA B;  4XLD A;  3EYB A;  3G0W A;  5DZI A;  2GTK A;  5DVC A;  2AA7 A;  2ZMI A;  1T7F A;  2YAT A;  3QT0 A;  2GPU A;  3BQD A;  5L7E A;  1PK5 A;  4APU A;  1MVC A;  3B0Q A;  2VV4 B;  5DUH A;  1GWQ A;  3IPQ A;  2P54 A;  4OZT E;  3ET3 A;  4ZN7 A;  3HO0 A;  3OSI A;  4FNE A;  5E15 A;  4CSJ A;  1L2I A;  4J26 A;  5JJM A;  1R20 A;  2AX7 A;  3ERT A;  1P8D A;  2PIR A;  2ZMH A;  3B0R A;  4N5G A;  4OH6 A;  2HCD A;  4G1D A;  1M7W A;  2P7A A;  5SYZ A;  3AUN A;  4J5X C;  1ZGY A;  3L03 A;  3A2I A;  1KNU A;  5CJ6 A;  3AZ3 A;  5DUE A;  3IPU A;  2Q7J A;  2ABI A;  3OMQ A;  3FEI A;  4MG9 A;  3VTB A;  3DZU A;  5GIC A;  4E2J A;  1T74 A;  2AX6 A;  5G45 A;  2Q5G A;  2R40 A;  3VSO A;  3V9T A;  2F4B A;  4L96 A;  2IHQ A;  1YJE A;  4OJ9 A;  2OAX A;  2HWQ A;  4REF A;  1NRL A;  5AWK A;  3VT9 A;  3PEQ A;  3UVV A;  2G5O A;  3V3E A;  3O1E A;  3SP9 A;  4J5W A;  2YLY A;  1QKU A;  3VRW A;  5DXQ A;  3H0A D;  4A4W A;  2GIU A;  4POJ A;  3RY9 A;  2E2R A;  4J5W C;  3WT5 A;  1T5Z A;  3OKH A;  2HB8 A;  4LTW A;  5APJ A;  5ICK A;  1XDK A;  4NIE A;  3D6D A;  4OH5 A;  3ET2 A;  5ETH A;  2PIN A;  3E7C A;  3ZRA A;  2AX8 A;  5APH A;  5DK9 A;  2AA5 A;  3VJI A;  4BCR A;  3ADU A;  4IW8 A;  5DLR A;  4ZNV A;  5KRH A;  3FAL B;  5KRK A;  3G8I A;  2B50 A;  1XNX A;  1SQN A;  1S19 A;  2G44 A;  3VT3 A;  4RZG A;  3PRG A;  2Q7I A;  5DP0 A;  1RKG A;  5L7G A;  1MZN A;  2Q59 A;  2Z4J A;  1OT7 A;  4LBD A;  5FQR A;  1A52 A;  4PF3 A;  1HJ1 A; 
#chains in the Genus database with same CATH homology
 4OGH A;  3KPZ A;  4R2U A;  3OS8 A;  3OZ0 A;  5DZ0 A;  1K7L A;  2B23 A;  3VRT A;  2QGT A;  5E0W A;  4OIV A;  5HYR A;  4Q50 A;  3CJW A;  3RLL A;  1UHL B;  4HLW A;  3OS8 C;  3OAP A;  3A9E B;  3KMZ A;  2QZO B;  3OSW A;  1T7R A;  2JF9 A;  1K74 A;  3ZRB A;  3HC6 A;  3G8O A;  3HZF A;  3KMR A;  1ZDT A;  3N00 A;  3O1D A;  4MGD A;  5DWG A;  5DXG A;  3TKM A;  4LNW A;  3IA6 A;  4MGB A;  3Q95 B;  1MV9 A;  1X7B A;  2PNU A;  2P7G A;  2HAM A;  2ZY0 A;  2REW A;  3KBA A;  3B66 A;  5FQP A;  5AVL A;  4OKX A;  5AK2 A;  2ZL9 A;  4YT1 A;  3DR1 A;  3R5N A;  4IS8 A;  4UDA A;  2QA8 B;  1U3S A;  4G2I A;  1YY4 A;  4IA3 A;  5DZH A;  5G3J A;  4IQR A;  2YLP A;  3R8D A;  5FQS A;  1GWX A;  5HJP B;  1PQ6 A;  2J14 A;  3E94 A;  4RE8 A;  3JZC A;  3R2A A;  5DL4 A;  3VT5 A;  1XP9 A;  4NUF A;  1A28 A;  2GL8 A;  1KKQ A;  3UUA B;  1G2N A;  1QKM A;  1DKF A;  2Q8S A;  4IVW A;  4OEY A;  3ADS A;  1G1U A;  2XYX A;  3OMO A;  2XKW A;  4MG7 A;  5A86 A;  1ERE A;  4S15 A;  2ZMJ A;  4NB6 A;  4RUO X;  2AO6 A;  5GID A;  1T7T A;  5DWL A;  5AZV A;  4FHH A;  5KR9 A;  1R5K A;  2Q5P A;  1OVL B;  5KRI A;  4WPF A;  2QA6 A;  3KDT A;  5DXB A;  4PLD A;  1XPC A;  5JY3 A;  4K4J A;  1YMT A;  1FCZ A;  3GD2 A;  3B0T A;  5AAV B;  3WTQ A;  1ERR A;  1IE9 A;  1PCG A;  1Z5X U;  4WHF A;  2AA6 A;  1ILG A;  3GBK A;  5DVS A;  1NHZ A;  5KCF A;  4PLE A;  2P1U A;  2ACL B;  3VJT A;  4M8H A;  4M8E A;  2XYW A;  4IWC A;  1Q4X A;  3DT3 A;  5DXM A;  5EIT A;  1X7R A;  2I0J A;  3A40 X;  5DX3 B;  3HLV A;  3P89 A;  2YHD A;  3GYT A;  3VT4 A;  4RFW A;  2PIP L;  1NAX A;  2POB A;  4RZE A;  5KYJ A;  1R1K A;  5G44 A;  3CS8 A;  3OKI A;  3ADX A;  2QW4 A;  3V49 A;  5I4V A;  4G21 A;  2Q6R A;  4WHG A;  4ZNS A;  1YOW A;  3D90 A;  1SJ0 A;  1YUC A;  3ILZ A;  4N1Y A;  3UU7 B;  3VT8 A;  4EM9 A;  1ZKY A;  1OSV A;  1GS4 A;  5G42 A;  2QSE A;  1R20 D;  2VV4 A;  2ZK5 A;  3L3X A;  3MNO A;  4N73 A;  4PVU A;  2ZKC A;  1GWR A;  3GWX A;  1PQC A;  5K13 A;  3CWD A;  1U3R A;  2JFA B;  1XIU A;  4XTA A;  3IPS A;  3NSQ A;  3R5M A;  4OZR E;  5B41 A;  2PKL A;  3K8S A;  4P6W A;  4YNK A;  4IVY A;  2Z4B A;  3L0L A;  2R6W A;  4FGY A;  2BJ4 B;  3F5C A;  1HG4 A;  2O9I A;  4A2J A;  1S9P A;  3DZU D;  2R40 D;  4J5X A;  3GWS X;  3AZ1 A;  2V7C A;  4O8F A;  3R8A A;  5HJS A;  2VV1 A;  4MG6 A;  4YMQ A;  4TV1 B;  2NW4 A;  1ILH A;  2POG A;  4JYG A;  4QE8 A;  4XAO A;  1OSH A;  1RK3 A;  1SR7 A;  3FUG A;  4KZI A;  4DK8 A;  5B5B A;  3VJS A;  5C4S A;  2AAX A;  2GPO A;  3HOD A;  2YJD A;  3W0Y A;  3X1I A;  1XP6 A;  3WJ5 A;  1G50 A;  3CDS A;  5EC9 A;  2OVM A;  3R29 A;  1QKT A;  1XV9 A;  3DY6 A;  5EJV A;  1UOM A;  2XHS A;  4CI4 A;  3OMP A;  4OZT U;  3ZQT A;  4IWF A;  3L0J A;  4G2H A;  3SZ1 A;  4HEE X;  4FN9 A;  3CLD A;  4PPS A;  4WQP A;  5KRF A;  1BSX A;  3VRU A;  1I7I A;  3R8I A;  2YLQ A;  5DWE A;  1I38 A;  2GPV A;  4QJR A;  4QK4 A;  1TXI A;  5G43 A;  4E4Q A;  3VN2 A;  3VTC A;  5JJM B;  2VSR A;  1NQ2 A;  2H79 A;  3AUR A;  2VV2 A;  1DB1 A;  3FC6 A;  2QTU A;  1UPW A;  2AXA A;  1EXA A;  1EXX A;  4DMA A;  3W0H A;  4JYH A;  5DMC A;  3HVL A;  4X1F A;  3UUD A;  3CQV A;  1X78 A;  1E3G A;  1XNN A;  3K6P A;  2QNV A;  3VT7 A;  3E00 A;  5DU5 A;  5ACC A;  4TUZ B;  4OEA A;  2I0G A;  5DID A;  4IA2 A;  1T73 A;  4OJ4 A;  3A2H A;  5KRL A;  2G0G A;  5JI0 D;  3CTB A;  2A3I A;  3UVV B;  1K74 D;  1XVP B;  1IE8 A;  5KCC A;  1T7M A;  2QH6 A;  3IMY A;  5GIE A;  1U3Q A;  1UHL A;  2VV3 A;  4RUJ A;  5DYD A;  1I37 A;  4ZJR A;  4MG8 A;  2QZO A;  5DVV A;  4POH A;  4RZF A;  4PRG A;  5E14 A;  4IV2 A;  2HVC A;  3RUT A;  3WWR A;  3KYT A;  2OUZ A;  4OC7 A;  1XDK B;  1NUO A;  4UDD A;  5KRA A;  4A4V A;  2PJL A;  3OLS A;  3OOK A;  5E0X A;  3WT6 A;  2OVH A;  3K23 A;  1XLS A;  4S0S A;  2Q61 A;  2ZK4 A;  1RKH A;  5IAW A;  2Q1V A;  5AWJ A;  3VJH A;  3VT6 A;  2I4Z A;  4XUH A;  5KCE A;  2P7Z A;  2Q6J A;  5DXR A;  1M13 A;  1T65 A;  4QL8 A;  1ZAF A;  2PIT A;  2QA8 A;  5DXE A;  3B5R A;  2Q7K A;  4DK7 A;  5C4O A;  5GT4 A;  2I4P A;  2J7X A;  4OLM A;  4OKW A;  2Q59 B;  1YIN A;  2Q70 A;  1NQ7 A;  2PIX A;  1ZDU A;  4IA1 A;  5KRC A;  1FD0 A;  2ZK1 A;  2B1Z A;  2PIW A;  4ZN9 A;  4IUI A;  3B65 A;  5DV6 A;  3PBA A;  1S9Q A;  2Q60 A;  2QR9 A;  5LGA A;  1X7E A;  2Q6S A;  3JZB A;  3MNE A;  3V3Q A;  5IZ0 A;  4DM8 A;  3VHW A;  5DXP A;  2ZVT A;  4WLB A;  4PP6 A;  2PRG A;  4JGV A;  5DXK A;  1FCX A;  4XHD A;  1XLS E;  1XP1 A;  2GPP A;  4ZNH A;  2BAW A;  3FLI A;  2ZLC A;  4MGD B;  3IXP A;  3KMG A;  4RMC A;  1YA3 A;  5L7H A;  3A3Z X;  4MGB B;  3AFR A;  3VTD A;  1PDU A;  2QE4 A;  4R06 A;  1K4W A;  3TKC A;  4Q0A C;  3OMK A;  3X1H A;  5AAV A;  1Z95 A;  4RAK A;  2OZ7 A;  3AZ2 A;  1QKN A;  2HC4 A;  2YLO A;  4ITE A;  3DZY A;  3U9Q A;  2ACL A;  1LBD A;  4EMA A;  2Q5S A;  1R1K D;  4ITF A;  2O4J A;  5DSH A;  5DWI A;  4P6X A;  3UP3 A;  5DX3 A;  3ZR7 A;  2AYR A;  4B7W A;  1PRG A;  2QPY A;  3VHV A;  1H9U A;  2IOG A;  5E7V A;  1S0Z A;  3W5T A;  4MGA B;  4J24 A;  4ZJW A;  1DKF B;  2JJ3 A;  4OJB A;  4OIL A;  2V0V A;  2ZBS A;  3GN8 A;  2ZNO A;  4MG5 A;  1SKX A;  1T76 A;  3P8X A;  4MG7 B;  1NAV A;  3KWY A;  3B0W A;  2PIV A;  3FEJ A;  3W0G A;  1ZUC A;  1Y0X X;  3AN4 A;  4OHA A;  5AAU A;  3S9S A;  3ADV A;  3TX7 B;  2J7Y A;  1FM9 A;  4OFU A;  1FCY A;  1WM0 X;  2ZK3 A;  2ZNP A;  4K6I A;  2HBH A;  2ZK6 A;  3WFF A;  5AYG A;  1X7J A;  3FUR A;  1G5Y A;  3OLL A;  5APK A;  3AN3 A;  5DTV A;  1XJ7 A;  2P4Y A;  2BJ4 A;  2VV0 A;  3DCT A;  4OKB A;  3OZJ A;  2GP7 A;  4OIU A;  3NSP A;  3VRV A;  3A78 A;  1KV6 A;  2ZK2 A;  3LBD A;  4TV1 A;  3RUU A;  2OCF A;  1NDE A;  5M96 A;  4YPQ A;  2AMB A;  4ZI1 A;  3OGT A;  3OS9 A;  1FM6 A;  5DV3 A;  1NQ1 A;  4ONI A;  1Y0S A;  4ZOM A;  4XI3 A;  3ADT A;  5DZ3 A;  1RDT A;  2P15 A;  4DM6 A;  4QM0 A;  3AX8 A;  5DYB A;  5DKG A;  3CS6 A;  4ZNW A;  2ZXN A;  5G5W A;  3OOF A;  5DIE A;  4QE6 A;  3WFG A;  3ADW A;  1NQ0 A;  1R6G A;  3F7D A;  1L2J A;  1RJK A;  4Q13 A;  3VHU A;  4OZR U;  5DKS A;  4JAZ A;  5KRO A;  3TY0 A;  5KCD A;  5DZ1 A;  3GZ9 A;  2ZXM A;  2W8Y A;  3OMM A;  3BC5 A;  3KFC A;  1T79 A;  1FBY A;  3V9Y A;  3F5C B;  3B3K A;  3ET0 A;  3E00 D;  3WMH A;  4N8R A;  3PCU A;  5FQV A;  4KZM A;  2VV1 B;  1N83 A;  4Y29 A;  2AX9 A;  3FXV A;  4LNX A;  3W5R A;  4JL4 A;  4DOR A;  5KCT A;  2PIO A;  5EI1 A;  1VJB A;  3OLF A;  3FAL A;  5G46 A;  2YFE A;  4TUZ A;  5DRJ A;  4XUM A;  2Q3Y A;  4ZO1 B;  4MG9 B;  4DQM A;  1ZH7 A;  3ET1 A;  2FSZ A;  5H1E A;  2Q7L A;  5F9B A;  5KCU A;  2AMA A;  4PWL A;  4RUP A;  3KDU A;  1XVP A;  4R6S A;  1XV9 B;  4DOS A;  1XOW A;  4MGC A;  2ZNQ A;  4X1G A;  4MDD A;  3NOA A;  2H77 A;  5KRM A;  4RME A;  2PIU A;  3D5F A;  4OFR A;  4REE A;  1UPV A;  2HFP A;  3PLZ A;  3P88 A;  1YYE A;  5DUG A;  4FHI A;  3A9E A;  4IU7 A;  2ZNN A;  4G1Z A;  2QXS A;  5DV8 A;  4F9M A;  5KD9 A;  5EHJ A;  5DIG A;  4OED A;  3FC6 B;  5AVI A;  4RMD A;  1NYX A;  3H0A A;  3HC5 A;  2NPA A;  4K7A A;  2O4R A;  3BEJ A;  2NV7 A;  3K22 A;  5C4U A;  2VST A;  3WGP A;  3W5P A;  4IA7 A;  3Q95 A;  2HWR A;  5KCW A;  5HYK A;  3B67 A;  3UUD B;  3W0I A;  3UP0 A;  4UDB A;  1T63 A;  2GWX A;  3B68 A;  1N46 A;  2AM9 A;  2AA2 A;  3CDP A;  4ZNT A;  2QAB A;  1YOK A;  2QXM A;  5HJP A;  2ZLA A;  4OEZ A;  2LBD A;  2ZXZ A;  5L11 A;  2ZAS A;  4E4K A;  3V4A A;  3G9E A;  2FVJ A;  3UUA A;  3IXP D;  2P1T A;  5DI7 A;  5DRM A;  1P93 A;  2HAR A;  2AWH A;  3W5Q A;  4MG8 B;  2ZK0 A;  3D57 A;  2AB2 A;  2R6Y A;  4KZJ A;  3X31 A;  2ATH A;  4L98 A;  4RWV A;  3DZY D;  1PQ9 A;  2I4J A;  1OVL A;  5E19 A;  3ERD A;  3H52 A;  4NY9 A;  4ZNU A;  3WJ4 A;  1ZEO A;  3L1B A;  2FAI A;  3W0A A;  3OSA A;  5LWP A;  2HAS A;  2G0H A;  2EWP A;  3CS4 A;  5DY8 A;  3V9V A;  3MNP A;  3D24 A;  1X76 A;  4S14 A;  4PXM A;  3UUC A;  1XB7 A;  2XYJ A;  4PP3 A;  4WVD A;  3M7R A;  5DMF A;  5EGV A;  4CI5 A;  3HM1 A;  4ZO1 X;  1S0X A;  1M2Z A;  3B1M A;  4XT9 A;  1Y9R A;  3RLJ A;  5KYA A;  1Z5X E;  3PO9 A;  4MGA A;  3L0E A;  4OAR A;  2QGW A;  3SP6 A;  1LV2 A;  1FM9 D;  3DCU A;  2B1V A;  2HB7 A;  4IW6 A;  2Q1H A;  5DKE A;  2NXX A;  3VI8 A;  3RVF A;  3UU7 A;  1U9E A;  2PIQ A;  5KRJ A;  3L3Z A;  2ZFX A;  1E3K A;  1XAP A;  5E1C A;  4JYI A;  4OKT A;  2J4A A;  3X36 A;  2OM9 A;  4G20 A;  4LSJ A;  4OK1 A;  1XQC A;  5DWJ A;  3T03 A;  5DXB B;  3A2J A;  1TFC A;  5IXK A;  2YJA B;  1YP0 A;  1FM6 D;  3FS1 A;  2JFA A;  4G1Y A;  4S0T A;  3AUQ A;  5C4T A;  1N4H A;  1PZL A;  3LMP A;  4IV4 A;  3P0U A;  1RDT D;  1XQ3 A;  2QMV A;  5FQT A;  3W0J A;  1XZX X;  3HQ5 A;  2P1V A;  1YIM A;  5AZT A;  3VSP A;  3WT7 A;  2IOK A;  5DKB A;  5HCV A;  1I7G A;  4PPP A;  4UDC A;  2NXX E;  3GYU A;  4PP5 A;  3W0C A;  5HZC A;  4NQA B;  4XLD A;  3EYB A;  3G0W A;  5DZI A;  2GTK A;  5DVC A;  2AA7 A;  2ZMI A;  1T7F A;  2YAT A;  3QT0 A;  2GPU A;  3BQD A;  5L7E A;  1PK5 A;  4APU A;  1MVC A;  3B0Q A;  2VV4 B;  5DUH A;  1GWQ A;  3IPQ A;  2P54 A;  4OZT E;  3ET3 A;  4ZN7 A;  3HO0 A;  3OSI A;  4FNE A;  5E15 A;  4CSJ A;  1L2I A;  4J26 A;  5JJM A;  1R20 A;  2AX7 A;  3ERT A;  1P8D A;  2PIR A;  2ZMH A;  3B0R A;  4N5G A;  4OH6 A;  2HCD A;  4G1D A;  1M7W A;  2P7A A;  5SYZ A;  3AUN A;  4J5X C;  1ZGY A;  3L03 A;  3A2I A;  1KNU A;  5CJ6 A;  3AZ3 A;  5DUE A;  3IPU A;  2Q7J A;  2ABI A;  3OMQ A;  3FEI A;  4MG9 A;  3VTB A;  3DZU A;  5GIC A;  4E2J A;  1T74 A;  2AX6 A;  5G45 A;  2Q5G A;  2R40 A;  3VSO A;  3V9T A;  2F4B A;  4L96 A;  2IHQ A;  1YJE A;  4OJ9 A;  2OAX A;  2HWQ A;  4REF A;  1NRL A;  5AWK A;  3VT9 A;  3PEQ A;  3UVV A;  2G5O A;  3V3E A;  3O1E A;  3SP9 A;  4J5W A;  2YLY A;  1QKU A;  3VRW A;  5DXQ A;  3H0A D;  4A4W A;  2GIU A;  4POJ A;  3RY9 A;  2E2R A;  4J5W C;  3WT5 A;  1T5Z A;  3OKH A;  2HB8 A;  4LTW A;  5APJ A;  5ICK A;  1XDK A;  4NIE A;  3D6D A;  4OH5 A;  3ET2 A;  5ETH A;  2PIN A;  3E7C A;  3ZRA A;  2AX8 A;  5APH A;  5DK9 A;  2AA5 A;  3VJI A;  4BCR A;  3ADU A;  4IW8 A;  5DLR A;  4ZNV A;  5KRH A;  3FAL B;  5KRK A;  3G8I A;  2B50 A;  1XNX A;  1SQN A;  1S19 A;  2G44 A;  3VT3 A;  4RZG A;  3PRG A;  2Q7I A;  5DP0 A;  1RKG A;  5L7G A;  1MZN A;  2Q59 A;  2Z4J A;  1OT7 A;  4LBD A;  5FQR A;  1A52 A;  4PF3 A;  1HJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...