5KCFA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with an n-ethyl, 4-methoxybenzyl obhs-n derivative
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
236
Chain Sequence
KNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Full antagonism of the estrogen receptor without a prototypical ligand side chain.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 90
structure length 236
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kcfA00
3B0WA 4WHFA 1MVCA 4JYIA 5GICA 4FNEA 1PK5A 3E00D 5AVLA 3S9SA 4A2JA 3OSWA 4IW8A 1FM6D 2GPVA 2JJ3A 3KDTA 2Q6RA 5DMCA 3W0YA 1XJ7A 3A2HA 3CQVA 3VSPA 5DZ1A 5AAVA 2IOKA 4RZEA 2PRGA 1R6GA 3GWXA 4ZOMA 3IPUA 3OSIA 5GT4A 1Q4XA 3ERTA 4QK4A 5DRJA 4OEAA 1MV9A 2OVMA 5FQTA 1S19A 4IA3A 1P8DA 3ET1A 3ADWA 2V7CA 4TV1B 1X78A 1PRGA 1WM0X 1XP6A 2YLOA 5E0XA 1HJ1A 3IMYA 2AA6A 1YIMA 4OILA 2P4YA 3D24A 5DWIA 1XB7A 3NSPA 5B41A 5DSHA 2NW4A 2Q6SA 3BQDA 1ZH7A 4OEZA 1S0ZA 4MG8B 1S9PA 3OGTA 3QT0A 3R5MA 1FM6A 3CWDA 3PLZA 3O1EA 4NB6A 4PF3A 4RZFA 2OM9A 3VTBA 2ZASA 3FALB 3AX8A 1YYEA 1K4WA 3ZRBA 2I4PA 4ZNUA 5DVSA 5KR9A 3W0JA 2PIUA 2ZXNA 3B0TA 1IE9A 2HCDA 2AX9A 2G0GA 4P6XA 4TUZA 1NQ0A 1TXIA 1T7TA 2AX6A 1M2ZA 3IXPA 1YOWA 1P93A 1Z5XE 2HASA 3ADUA 3DCTA 4OIUA 4N5GA 4R06A 3VJHA 3WWRA 4FN9A 3VT8A 4OKTA 5LWPA 4OARA 1T76A 4POJA 5JY3A 4RZGA 1GS4A 3VHUA 3HM1A 4YT1A 1KKQA 1T5ZA 1MZNA 5AWKA 2GIUA 3H0AD 5KROA 1G5YA 3P89A 4DM6A 2ACLB 1Z95A 3R2AA 4MGBB 3VHWA 2AMBA 5LGAA 1U3QA 2HBHA 2HC4A 2JF9A 4G20A 1UPWA 3WT7A 3L1BA 1FM9A 4ITFA 3D90A 4PPPA 3B67A 4ZNVA 1X7EA 2YFEA 4OFRA 2PNUA 3ADXA 3OMKA 5AAUA 2PIPL 2ZK4A 4L98A 5G43A 5DUHA 2AA5A 3CS6A 2ZK0A 3DT3A 4WQPA 4A4WA 5C4TA 5AVIA 1QKUA 3OLFA 4WPFA 3W5QA 3OMMA 4JYGA 2VV4B 3DZUD 4MG8A 4QL8A 3B68A 5KCEA 2GP7A 5KRJA 3DZYD 4ZNSA 2PIRA 3L3ZA 5DXMA 5FQVA 3PO9A 2VV3A 3GZ9A 3FLIA 4FHIA 1EXXA 2QW4A 3W5TA 3X1HA 2ZNPA 3ADVA 4IUIA 4NUFA 1Y9RA 2HVCA 3R8DA 2Q60A 2QA8B 4OKBA 1G50A 4DM8A 3HO0A 2ZK1A 1IE8A 5IZ0A 3RLJA 1R1KA 4ZN9A 4IV4A 3GYTA 5DL4A 5DWJA 5KRIA 2Q5PA 1PZLA 4OC7A 1RKGA 3VJSA 2AYRA 3ADSA 1N83A 2J7YA 5DYDA 4DOSA 1NHZA 2QXSA 3G8OA 1ILHA 3WJ4A 5KRMA 3LMPA 5K13A 4IQRA 5DIGA 3R5NA 3W5PA 5GIEA 1XDKA 2ZNNA 3TKCA 3G8IA 3VRTA 1FCYA 4UDCA 1XP9A 3DZUA 1L2IA 2ACLA 1Z5XU 1ZEOA 2I4ZA 1Y0XX 3AUQA 3WGPA 4MGBA 1XQCA 4M8HA 4Y29A 4PP3A 3VT3A 2XHSA 3X36A 3DZYA 2QR9A 3D6DA 3KWYA 3MNEA 3AFRA 5APKA 3K23A 5DI7A 1N4HA 2B23A 3O1DA 4IW6A 5DKSA 1KV6A 5E1CA 3ERDA 4E4QA 5L11A 3LBDA 5HYRA 2R6YA 5KCFA 2I4JA 3G9EA 1GWRA 1E3GA 2Q3YA 4LBDA 5C4UA 3A40X 3FURA 3RY9A 3PEQA 3GD2A 2VV4A 2P1VA 4IWFA 2ZXZA 2HWRA 3KYTA 3DR1A 1YUCA 3OZJA 5M96A 2Q59B 2QGTA 1XPCA 1U9EA 1YINA 3E94A 3VRWA 5ACCA 3JZBA 2IOGA 5DLRA 4POHA 1HG4A 5B5BA 1UHLA 4RMDA 4UDAA 2QZOB 1FD0A 1OSVA 2LBDA 5EJVA 3OS8A 3ADTA 3GYUA 4J26A 5DIEA 2QA8A 2NXXA 5DWLA 3WT5A 2XKWA 3KMGA 4ZJRA 2YLQA 1EXAA 3W0CA 3K8SA 1NQ1A 4JYHA 5DZ3A 2G44A 5DV6A 3TX7B 2QPYA 3HVLA 5JI0D 5FQSA 3IXPD 1SR7A 4LNWA 5DXGA 2V0VA 1GWQA 3E7CA 3A2JA 3OS8C 3BC5A 2Q7LA 4PP6A 2P54A 2I0JA 4B7WA 2H77A 4PXMA 5JJMA 3OMOA 3CS4A 2ZMJA 3IPQA 5DK9A 4XTAA 5DZ0A 5EC9A 3UUCA 3UVVB 3ZR7A 1G2NA 2Z4BA 1N46A 2QMVA 3UU7B 3CDSA 2R40D 3NOAA 1K7LA 4MGAA 1E3KA 4E4KA 5DRMA 3SP6A 4ZN7A 4RE8A 1FM9D 3VTDA 4APUA 5EGVA 4YMQA 5KRLA 1ZKYA 5KCDA 3HQ5A 4PLEA 1ZUCA 3NSQA 4ITEA 4CSJA 2NV7A 1RDTD 1ZAFA 5ETHA 3CS8A 4IS8A 4LTWA 1OT7A 1OVLA 4OJ9A 3A78A 3VT4A 2F4BA 2PIVA 4N1YA 3KMRA 3ET0A 4IU7A 5DXBB 2Q59A 3V9YA 4EM9A 2HB8A 4RMEA 2AA2A 1QKTA 2GPPA 4KZMA 2J7XA 4R6SA 4XHDA 3L03A 3CDPA 1NRLA 4ZNWA 2QZOA 1XOWA 3HLVA 2JFAA 4J5WA 4RWVA 3ZRAA 1DB1A 2ZXMA 1U3SA 1XDKB 1X76A 4JGVA 3L0JA 3L3XA 4PRGA 5AYGA 2Q61A 3AZ3A 4PP5A 4XAOA 2OVHA 2VV0A 1YY4A 2R40A 2NPAA 4MDDA 1ZDUA 1R1KD 2REWA 2FAIA 4OK1A 2HARA 3KDUA 3RUTA 4E2JA 1QKNA 4ZNHA 4MG7A 1XNNA 3OOFA 5DWGA 1RDTA 3W0HA 3PBAA 2QNVA 1R20D 4IVYA 3KBAA 5C4OA 2PIWA 5DXRA 3OKIA 3Q95B 3B66A 5G5WA 5DTVA 3R8AA 3UVVA 5G42A 3VRUA 1YJEA 3WJ5A 3V4AA 2PJLA 3VT7A 5G46A 3UU7A 3FEIA 5DY8A 1T73A 3GBKA 4MG5A 4G1DA 2OUZA 1L2JA 5EI1A 2POGA 5AZTA 3CJWA 4N73A 4IVWA 4YPQA 1UHLB 3VHVA 4N8RA 2BAWA 3L0LA 1FBYA 3P8XA 3W0GA 1S0XA 3TKMA 1A28A 2QA6A 2QTUA 4MGCA 3D5FA 4J5XA 5HJPB 2ZLCA 5HYKA 2ZNOA 3GWSX 1X7JA 2ATHA 1SQNA 1R5KA 2YLYA 2ZMIA 3B0RA 3BEJA 3MNPA 5DYBA 5DXBA 2J14A 5EITA 5KCTA 3H52A 4PWLA 2ZVTA 1Y0SA 2HAMA 4RAKA 1ZGYA 2YHDA 5E0WA 1R20A 4K7AA 1OSHA 5DV8A 5E15A 3N00A 4ZI1A 4XLDA 4OHAA 1XVPA 3X1IA 5DKBA 4F9MA 4RFWA 3V9TA 4J5XC 3WMHA 3SP9A 5JJMB 4REEA 4OJBA 3HC6A 2Z4JA 4Q50A 1K74D 5C4SA 1KNUA 5DWEA 2P7AA 2PIQA 4ZJWA 4OIVA 4RUPA 3VJTA 1I7GA 1XLSA 1NDEA 1PQ9A 2GTKA 1T7FA 3M7RA 4MGAB 4JL4A 4O8FA 4S15A 5KCUA 3RLLA 5KRFA 1LBDA 1T65A 4M8EA 2ZLAA 3VTCA 1XQ3A 3ILZA 1RJKA 1H9UA 3A9EB 5APHA 3Q95A 5DVCA 3UUAA 5KYJA 5DUGA 4CI5A 5DXPA 2OZ7A 2OCFA 3FC6A 5A86A 4ZNTA 5SYZA 3U9QA 2ZMHA 1OVLB 1PQ6A 1FCXA 1NQ7A 2AWHA 2GL8A 1EREA 4S14A 4OGHA 2YATA 3V9VA 4P6WA 2PIXA 2AX8A 5IAWA 4HEEX 2P15A 4RUOX 5DVVA 4OEYA 5G45A 1UPVA 3TY0A 2O4RA 3FXVA 2HB7A 2QH6A 3OLSA 1YP0A 2VV1B 2JFAB 2GWXA 3KFCA 5APJA 3VJIA 4MG9B 3T03A 3W5RA 3WFGA 1K74A 4OZTE 1T79A 3OMPA 2Q1HA 2AXAA 5HJPA 5E14A 4QJRA 4NQAB 2NXXE 2Q70A 2AO6A 4XT9A 5GIDA 4G2HA 1XP1A 1DKFA 1T7RA 2YJAB 1S9QA 3AN3A 4K6IA 4MG6A 4WVDA 5DUEA 3B3KA 1VJBA 1ERRA 1XNXA 3G0WA 4J24A 3P0UA 3K6PA 4NIEA 4MG7B 4IA7A 2ZK5A 2YLPA 5HCVA 3V3EA 1XV9A 2Q7IA 3AURA 5H1EA 3GN8A 5FQPA 1SKXA 1PDUA 2B1VA 3B1MA 2B50A 4WHGA 4A4VA 2W8YA 3K22A 4Q13A 3F7DA 5KRCA 4MGDB 3VI8A 2QABA 2ZY0A 3A3ZX 5E19A 2A3IA 3DY6A 3PCUA 1M7WA 3B5RA 3AUNA 5DU5A 1I38A 4X1FA 3A9EA 4G1ZA 4OZRE 1YMTA 3ET3A 3WTQA 1G1UA 2GPUA 3ET2A 1PQCA 3VT9A 2B1ZA 5DZHA 5KRHA 4OKXA 3V3QA 1M13A 1T7MA 3OKHA 2GPOA 2IHQA 5HZCA 2AMAA 2PIOA 2XYXA 3VT5A 1YA3A 4KZIA 5KRKA 3CLDA 1ZDTA 2Q7KA 2ZK3A 3MNOA 3F5CB 3E00A 3AZ2A 3P88A 2VV2A 2ZFXA 2VV1A 5DXEA 3UUDA 4MG9A 3UP0A 3ZQTA 1I7IA 3W0IA 2Q1VA 5E7VA 3HZFA 5L7GA 1XVPB 2PKLA 2AA7A 2ZK2A 5KYAA 1FCZA 4UDBA 5DX3B 3RUUA 4PVUA 2HWQA 2PINA 2AB2A 3OLLA 4OH5A 5AZVA 4BCRA 4DORA 3VN2A 3VT6A 4FHHA 3AZ1A 1XAPA 4J5WC 4OZTU 4R2UA 5L7EA 1T63A 2POBA 4QE8A 4REFA 4DK8A 3EYBA 4Q0AC 5DMFA 5DKGA 1I37A 2HFPA 2Q8SA 3OMQA 4OEDA 3UUAB 5ICKA 1NAXA 3FC6B 3W0AA 5L7HA 3D57A 2QXMA 2O9IA 1A52A 2ZK6A 4ONIA 3UP3A 3VSOA 4MGDA 1GWXA 4K4JA 4LSJA 3WT6A 2XYJA 5CJ6A 2P1UA 3HC5A 3IA6A 4UDDA 2P7ZA 5IXKA 2BJ4B 2QGWA 4DK7A 1NAVA 3HODA 4PLDA 4FGYA 3PRGA 2ZBSA 3AN4A 4OJ4A 4TV1A 4RUJA 3R8IA 3WFFA 4CI4A 2E2RA 3B65A 4XI3A 5I4VA 5DZIA 4L96A 3OZ0A 4G21A 2R6WA 2EWPA 3KPZA 4LNXA 4S0TA 1YOKA 3X31A 4XUMA 2Q7JA 1DKFB 4IWCA 1XZXX 3A2IA 1U3RA 1PCGA 4IA1A 3OS9A 2P7GA 2ZNQA 3F5CA 1ILGA 1QKMA 4OZRU 4RMCA 4YNKA 5DV3A 4DQMA 2J4AA 3L0EA 3IPSA 5KD9A 4HLWA 4G1YA 3FALA 1XV9B 5DXKA 4OH6A 2AAXA 3H0AA 4IV2A 1NUOA 5AWJA 5KCWA 2G5OA 5DX3A 2H79A 5F9BA 5G3JA 3KMZA 1SJ0A 5AAVB 5FQRA 4DMAA 2QSEA 1NYXA 4NY9A 4WLBA 3DCUA 2O4JA 1XLSE 2Q6JA 2FVJA 2ZL9A 4S0SA 4ZO1X 3V49A 2ABIA 5KCCA 4PPSA 1RK3A 3RVFA 2OAXA 3R29A 4JAZA 4X1GA 4ZO1B 1NQ2A 2G0HA 2P1TA 5HJSA 4IA2A 3FEJA 4QE6A 2VSRA 2YJDA 3FS1A 3B0QA 2FSZA 2ZKCA 2Q5SA 3OAPA 3SZ1A 3OSAA 4QM0A 2BJ4A 2PITA 2Q5GA 5DKEA 4OFUA 1X7BA 3JZCA 4G2IA 3UUDB 3CTBA 4OLMA 2AX7A 3FUGA 1LV2A 5DIDA 2AM9A 2VSTA 5AK2A 1XIUA 1X7RA 1T74A 4EMAA 3VRVA 5EHJA 4KZJA 1RKHA 3OOKA 4OKWA 5DP0A 2QE4A 1BSXA 2XYWA 5G44A 5KRAA 4TUZB 5DXQA 1TFCA 2I0GA 1UOMA 4XUHA
chains in the Genus database with same CATH superfamily
3B0WA 4WHFA 1MVCA 4JYIA 5GICA 4FNEA 1PK5A 3E00D 5AVLA 3S9SA 4A2JA 3OSWA 4IW8A 1FM6D 2GPVA 2JJ3A 3KDTA 2Q6RA 5DMCA 3W0YA 1XJ7A 3A2HA 3CQVA 3VSPA 5DZ1A 5AAVA 2IOKA 4RZEA 2PRGA 1R6GA 3GWXA 4ZOMA 3IPUA 3OSIA 5GT4A 1Q4XA 3ERTA 4QK4A 5DRJA 4OEAA 1MV9A 2OVMA 5FQTA 1S19A 4IA3A 1P8DA 3ET1A 3ADWA 2V7CA 4TV1B 1X78A 1PRGA 1WM0X 1XP6A 2YLOA 5E0XA 1HJ1A 3IMYA 2AA6A 1YIMA 4OILA 2P4YA 3D24A 5DWIA 1XB7A 3NSPA 5B41A 5DSHA 2NW4A 2Q6SA 3BQDA 1ZH7A 4OEZA 1S0ZA 4MG8B 1S9PA 3OGTA 3QT0A 3R5MA 1FM6A 3CWDA 3PLZA 3O1EA 4NB6A 4PF3A 4RZFA 2OM9A 3VTBA 2ZASA 3FALB 3AX8A 1YYEA 1K4WA 3ZRBA 2I4PA 4ZNUA 5DVSA 5KR9A 3W0JA 2PIUA 2ZXNA 3B0TA 1IE9A 2HCDA 2AX9A 2G0GA 4P6XA 4TUZA 1NQ0A 1TXIA 1T7TA 2AX6A 1M2ZA 3IXPA 1YOWA 1P93A 1Z5XE 2HASA 3ADUA 3DCTA 4OIUA 4N5GA 4R06A 3VJHA 3WWRA 4FN9A 3VT8A 4OKTA 5LWPA 4OARA 1T76A 4POJA 5JY3A 4RZGA 1GS4A 3VHUA 3HM1A 4YT1A 1KKQA 1T5ZA 1MZNA 5AWKA 2GIUA 3H0AD 5KROA 1G5YA 3P89A 4DM6A 2ACLB 1Z95A 3R2AA 4MGBB 3VHWA 2AMBA 5LGAA 1U3QA 2HBHA 2HC4A 2JF9A 4G20A 1UPWA 3WT7A 3L1BA 1FM9A 4ITFA 3D90A 4PPPA 3B67A 4ZNVA 1X7EA 2YFEA 4OFRA 2PNUA 3ADXA 3OMKA 5AAUA 2PIPL 2ZK4A 4L98A 5G43A 5DUHA 2AA5A 3CS6A 2ZK0A 3DT3A 4WQPA 4A4WA 5C4TA 5AVIA 1QKUA 3OLFA 4WPFA 3W5QA 3OMMA 4JYGA 2VV4B 3DZUD 4MG8A 4QL8A 3B68A 5KCEA 2GP7A 5KRJA 3DZYD 4ZNSA 2PIRA 3L3ZA 5DXMA 5FQVA 3PO9A 2VV3A 3GZ9A 3FLIA 4FHIA 1EXXA 2QW4A 3W5TA 3X1HA 2ZNPA 3ADVA 4IUIA 4NUFA 1Y9RA 2HVCA 3R8DA 2Q60A 2QA8B 4OKBA 1G50A 4DM8A 3HO0A 2ZK1A 1IE8A 5IZ0A 3RLJA 1R1KA 4ZN9A 4IV4A 3GYTA 5DL4A 5DWJA 5KRIA 2Q5PA 1PZLA 4OC7A 1RKGA 3VJSA 2AYRA 3ADSA 1N83A 2J7YA 5DYDA 4DOSA 1NHZA 2QXSA 3G8OA 1ILHA 3WJ4A 5KRMA 3LMPA 5K13A 4IQRA 5DIGA 3R5NA 3W5PA 5GIEA 1XDKA 2ZNNA 3TKCA 3G8IA 3VRTA 1FCYA 4UDCA 1XP9A 3DZUA 1L2IA 2ACLA 1Z5XU 1ZEOA 2I4ZA 1Y0XX 3AUQA 3WGPA 4MGBA 1XQCA 4M8HA 4Y29A 4PP3A 3VT3A 2XHSA 3X36A 3DZYA 2QR9A 3D6DA 3KWYA 3MNEA 3AFRA 5APKA 3K23A 5DI7A 1N4HA 2B23A 3O1DA 4IW6A 5DKSA 1KV6A 5E1CA 3ERDA 4E4QA 5L11A 3LBDA 5HYRA 2R6YA 5KCFA 2I4JA 3G9EA 1GWRA 1E3GA 2Q3YA 4LBDA 5C4UA 3A40X 3FURA 3RY9A 3PEQA 3GD2A 2VV4A 2P1VA 4IWFA 2ZXZA 2HWRA 3KYTA 3DR1A 1YUCA 3OZJA 5M96A 2Q59B 2QGTA 1XPCA 1U9EA 1YINA 3E94A 3VRWA 5ACCA 3JZBA 2IOGA 5DLRA 4POHA 1HG4A 5B5BA 1UHLA 4RMDA 4UDAA 2QZOB 1FD0A 1OSVA 2LBDA 5EJVA 3OS8A 3ADTA 3GYUA 4J26A 5DIEA 2QA8A 2NXXA 5DWLA 3WT5A 2XKWA 3KMGA 4ZJRA 2YLQA 1EXAA 3W0CA 3K8SA 1NQ1A 4JYHA 5DZ3A 2G44A 5DV6A 3TX7B 2QPYA 3HVLA 5JI0D 5FQSA 3IXPD 1SR7A 4LNWA 5DXGA 2V0VA 1GWQA 3E7CA 3A2JA 3OS8C 3BC5A 2Q7LA 4PP6A 2P54A 2I0JA 4B7WA 2H77A 4PXMA 5JJMA 3OMOA 3CS4A 2ZMJA 3IPQA 5DK9A 4XTAA 5DZ0A 5EC9A 3UUCA 3UVVB 3ZR7A 1G2NA 2Z4BA 1N46A 2QMVA 3UU7B 3CDSA 2R40D 3NOAA 1K7LA 4MGAA 1E3KA 4E4KA 5DRMA 3SP6A 4ZN7A 4RE8A 1FM9D 3VTDA 4APUA 5EGVA 4YMQA 5KRLA 1ZKYA 5KCDA 3HQ5A 4PLEA 1ZUCA 3NSQA 4ITEA 4CSJA 2NV7A 1RDTD 1ZAFA 5ETHA 3CS8A 4IS8A 4LTWA 1OT7A 1OVLA 4OJ9A 3A78A 3VT4A 2F4BA 2PIVA 4N1YA 3KMRA 3ET0A 4IU7A 5DXBB 2Q59A 3V9YA 4EM9A 2HB8A 4RMEA 2AA2A 1QKTA 2GPPA 4KZMA 2J7XA 4R6SA 4XHDA 3L03A 3CDPA 1NRLA 4ZNWA 2QZOA 1XOWA 3HLVA 2JFAA 4J5WA 4RWVA 3ZRAA 1DB1A 2ZXMA 1U3SA 1XDKB 1X76A 4JGVA 3L0JA 3L3XA 4PRGA 5AYGA 2Q61A 3AZ3A 4PP5A 4XAOA 2OVHA 2VV0A 1YY4A 2R40A 2NPAA 4MDDA 1ZDUA 1R1KD 2REWA 2FAIA 4OK1A 2HARA 3KDUA 3RUTA 4E2JA 1QKNA 4ZNHA 4MG7A 1XNNA 3OOFA 5DWGA 1RDTA 3W0HA 3PBAA 2QNVA 1R20D 4IVYA 3KBAA 5C4OA 2PIWA 5DXRA 3OKIA 3Q95B 3B66A 5G5WA 5DTVA 3R8AA 3UVVA 5G42A 3VRUA 1YJEA 3WJ5A 3V4AA 2PJLA 3VT7A 5G46A 3UU7A 3FEIA 5DY8A 1T73A 3GBKA 4MG5A 4G1DA 2OUZA 1L2JA 5EI1A 2POGA 5AZTA 3CJWA 4N73A 4IVWA 4YPQA 1UHLB 3VHVA 4N8RA 2BAWA 3L0LA 1FBYA 3P8XA 3W0GA 1S0XA 3TKMA 1A28A 2QA6A 2QTUA 4MGCA 3D5FA 4J5XA 5HJPB 2ZLCA 5HYKA 2ZNOA 3GWSX 1X7JA 2ATHA 1SQNA 1R5KA 2YLYA 2ZMIA 3B0RA 3BEJA 3MNPA 5DYBA 5DXBA 2J14A 5EITA 5KCTA 3H52A 4PWLA 2ZVTA 1Y0SA 2HAMA 4RAKA 1ZGYA 2YHDA 5E0WA 1R20A 4K7AA 1OSHA 5DV8A 5E15A 3N00A 4ZI1A 4XLDA 4OHAA 1XVPA 3X1IA 5DKBA 4F9MA 4RFWA 3V9TA 4J5XC 3WMHA 3SP9A 5JJMB 4REEA 4OJBA 3HC6A 2Z4JA 4Q50A 1K74D 5C4SA 1KNUA 5DWEA 2P7AA 2PIQA 4ZJWA 4OIVA 4RUPA 3VJTA 1I7GA 1XLSA 1NDEA 1PQ9A 2GTKA 1T7FA 3M7RA 4MGAB 4JL4A 4O8FA 4S15A 5KCUA 3RLLA 5KRFA 1LBDA 1T65A 4M8EA 2ZLAA 3VTCA 1XQ3A 3ILZA 1RJKA 1H9UA 3A9EB 5APHA 3Q95A 5DVCA 3UUAA 5KYJA 5DUGA 4CI5A 5DXPA 2OZ7A 2OCFA 3FC6A 5A86A 4ZNTA 5SYZA 3U9QA 2ZMHA 1OVLB 1PQ6A 1FCXA 1NQ7A 2AWHA 2GL8A 1EREA 4S14A 4OGHA 2YATA 3V9VA 4P6WA 2PIXA 2AX8A 5IAWA 4HEEX 2P15A 4RUOX 5DVVA 4OEYA 5G45A 1UPVA 3TY0A 2O4RA 3FXVA 2HB7A 2QH6A 3OLSA 1YP0A 2VV1B 2JFAB 2GWXA 3KFCA 5APJA 3VJIA 4MG9B 3T03A 3W5RA 3WFGA 1K74A 4OZTE 1T79A 3OMPA 2Q1HA 2AXAA 5HJPA 5E14A 4QJRA 4NQAB 2NXXE 2Q70A 2AO6A 4XT9A 5GIDA 4G2HA 1XP1A 1DKFA 1T7RA 2YJAB 1S9QA 3AN3A 4K6IA 4MG6A 4WVDA 5DUEA 3B3KA 1VJBA 1ERRA 1XNXA 3G0WA 4J24A 3P0UA 3K6PA 4NIEA 4MG7B 4IA7A 2ZK5A 2YLPA 5HCVA 3V3EA 1XV9A 2Q7IA 3AURA 5H1EA 3GN8A 5FQPA 1SKXA 1PDUA 2B1VA 3B1MA 2B50A 4WHGA 4A4VA 2W8YA 3K22A 4Q13A 3F7DA 5KRCA 4MGDB 3VI8A 2QABA 2ZY0A 3A3ZX 5E19A 2A3IA 3DY6A 3PCUA 1M7WA 3B5RA 3AUNA 5DU5A 1I38A 4X1FA 3A9EA 4G1ZA 4OZRE 1YMTA 3ET3A 3WTQA 1G1UA 2GPUA 3ET2A 1PQCA 3VT9A 2B1ZA 5DZHA 5KRHA 4OKXA 3V3QA 1M13A 1T7MA 3OKHA 2GPOA 2IHQA 5HZCA 2AMAA 2PIOA 2XYXA 3VT5A 1YA3A 4KZIA 5KRKA 3CLDA 1ZDTA 2Q7KA 2ZK3A 3MNOA 3F5CB 3E00A 3AZ2A 3P88A 2VV2A 2ZFXA 2VV1A 5DXEA 3UUDA 4MG9A 3UP0A 3ZQTA 1I7IA 3W0IA 2Q1VA 5E7VA 3HZFA 5L7GA 1XVPB 2PKLA 2AA7A 2ZK2A 5KYAA 1FCZA 4UDBA 5DX3B 3RUUA 4PVUA 2HWQA 2PINA 2AB2A 3OLLA 4OH5A 5AZVA 4BCRA 4DORA 3VN2A 3VT6A 4FHHA 3AZ1A 1XAPA 4J5WC 4OZTU 4R2UA 5L7EA 1T63A 2POBA 4QE8A 4REFA 4DK8A 3EYBA 4Q0AC 5DMFA 5DKGA 1I37A 2HFPA 2Q8SA 3OMQA 4OEDA 3UUAB 5ICKA 1NAXA 3FC6B 3W0AA 5L7HA 3D57A 2QXMA 2O9IA 1A52A 2ZK6A 4ONIA 3UP3A 3VSOA 4MGDA 1GWXA 4K4JA 4LSJA 3WT6A 2XYJA 5CJ6A 2P1UA 3HC5A 3IA6A 4UDDA 2P7ZA 5IXKA 2BJ4B 2QGWA 4DK7A 1NAVA 3HODA 4PLDA 4FGYA 3PRGA 2ZBSA 3AN4A 4OJ4A 4TV1A 4RUJA 3R8IA 3WFFA 4CI4A 2E2RA 3B65A 4XI3A 5I4VA 5DZIA 4L96A 3OZ0A 4G21A 2R6WA 2EWPA 3KPZA 4LNXA 4S0TA 1YOKA 3X31A 4XUMA 2Q7JA 1DKFB 4IWCA 1XZXX 3A2IA 1U3RA 1PCGA 4IA1A 3OS9A 2P7GA 2ZNQA 3F5CA 1ILGA 1QKMA 4OZRU 4RMCA 4YNKA 5DV3A 4DQMA 2J4AA 3L0EA 3IPSA 5KD9A 4HLWA 4G1YA 3FALA 1XV9B 5DXKA 4OH6A 2AAXA 3H0AA 4IV2A 1NUOA 5AWJA 5KCWA 2G5OA 5DX3A 2H79A 5F9BA 5G3JA 3KMZA 1SJ0A 5AAVB 5FQRA 4DMAA 2QSEA 1NYXA 4NY9A 4WLBA 3DCUA 2O4JA 1XLSE 2Q6JA 2FVJA 2ZL9A 4S0SA 4ZO1X 3V49A 2ABIA 5KCCA 4PPSA 1RK3A 3RVFA 2OAXA 3R29A 4JAZA 4X1GA 4ZO1B 1NQ2A 2G0HA 2P1TA 5HJSA 4IA2A 3FEJA 4QE6A 2VSRA 2YJDA 3FS1A 3B0QA 2FSZA 2ZKCA 2Q5SA 3OAPA 3SZ1A 3OSAA 4QM0A 2BJ4A 2PITA 2Q5GA 5DKEA 4OFUA 1X7BA 3JZCA 4G2IA 3UUDB 3CTBA 4OLMA 2AX7A 3FUGA 1LV2A 5DIDA 2AM9A 2VSTA 5AK2A 1XIUA 1X7RA 1T74A 4EMAA 3VRVA 5EHJA 4KZJA 1RKHA 3OOKA 4OKWA 5DP0A 2QE4A 1BSXA 2XYWA 5G44A 5KRAA 4TUZB 5DXQA 1TFCA 2I0GA 1UOMA 4XUHA
chains in the Genus database with same CATH topology
3B0WA 4WHFA 1MVCA 4JYIA 5GICA 4FNEA 1PK5A 3E00D 5AVLA 3S9SA 4A2JA 3OSWA 4IW8A 1FM6D 2GPVA 2JJ3A 3KDTA 2Q6RA 5DMCA 3W0YA 1XJ7A 3A2HA 3CQVA 3VSPA 5DZ1A 5AAVA 2IOKA 4RZEA 2PRGA 1R6GA 3GWXA 4ZOMA 3IPUA 3OSIA 5GT4A 1Q4XA 3ERTA 4QK4A 5DRJA 4OEAA 1MV9A 2OVMA 5FQTA 1S19A 4IA3A 1P8DA 3ET1A 3ADWA 2V7CA 4TV1B 1X78A 1PRGA 1WM0X 1XP6A 2YLOA 5E0XA 1HJ1A 3IMYA 2AA6A 1YIMA 4OILA 2P4YA 3D24A 5DWIA 1XB7A 3NSPA 5B41A 5DSHA 2NW4A 2Q6SA 3BQDA 1ZH7A 4OEZA 1S0ZA 4MG8B 1S9PA 3OGTA 3QT0A 3R5MA 1FM6A 3CWDA 3PLZA 3O1EA 4NB6A 4PF3A 4RZFA 2OM9A 3VTBA 2ZASA 3FALB 3AX8A 1YYEA 1K4WA 3ZRBA 2I4PA 4ZNUA 5DVSA 5KR9A 3W0JA 2PIUA 2ZXNA 3B0TA 1IE9A 2HCDA 2AX9A 2G0GA 4P6XA 4TUZA 1NQ0A 1TXIA 1T7TA 2AX6A 1M2ZA 3IXPA 1YOWA 1P93A 1Z5XE 2HASA 3ADUA 3DCTA 4OIUA 4N5GA 4R06A 3VJHA 3WWRA 4FN9A 3VT8A 4OKTA 5LWPA 4OARA 1T76A 4POJA 5JY3A 4RZGA 1GS4A 3VHUA 3HM1A 4YT1A 1KKQA 1T5ZA 1MZNA 5AWKA 2GIUA 3H0AD 5KROA 1G5YA 3P89A 4DM6A 2ACLB 1Z95A 3R2AA 4MGBB 3VHWA 2AMBA 5LGAA 1U3QA 2HBHA 2HC4A 2JF9A 4G20A 1UPWA 3WT7A 3L1BA 1FM9A 4ITFA 3D90A 4PPPA 3B67A 4ZNVA 1X7EA 2YFEA 4OFRA 2PNUA 3ADXA 3OMKA 5AAUA 2PIPL 2ZK4A 4L98A 5G43A 5DUHA 2AA5A 3CS6A 2ZK0A 3DT3A 4WQPA 4A4WA 5C4TA 5AVIA 1QKUA 3OLFA 4WPFA 3W5QA 3OMMA 4JYGA 2VV4B 3DZUD 4MG8A 4QL8A 3B68A 5KCEA 2GP7A 5KRJA 3DZYD 4ZNSA 2PIRA 3L3ZA 5DXMA 5FQVA 3PO9A 2VV3A 3GZ9A 3FLIA 4FHIA 1EXXA 2QW4A 3W5TA 3X1HA 2ZNPA 3ADVA 4IUIA 4NUFA 1Y9RA 2HVCA 3R8DA 2Q60A 2QA8B 4OKBA 1G50A 4DM8A 3HO0A 2ZK1A 1IE8A 5IZ0A 3RLJA 1R1KA 4ZN9A 4IV4A 3GYTA 5DL4A 5DWJA 5KRIA 2Q5PA 1PZLA 4OC7A 1RKGA 3VJSA 2AYRA 3ADSA 1N83A 2J7YA 5DYDA 4DOSA 1NHZA 2QXSA 3G8OA 1ILHA 3WJ4A 5KRMA 3LMPA 5K13A 4IQRA 5DIGA 3R5NA 3W5PA 5GIEA 1XDKA 2ZNNA 3TKCA 3G8IA 3VRTA 1FCYA 4UDCA 1XP9A 3DZUA 1L2IA 2ACLA 1Z5XU 1ZEOA 2I4ZA 1Y0XX 3AUQA 3WGPA 4MGBA 1XQCA 4M8HA 4Y29A 4PP3A 3VT3A 2XHSA 3X36A 3DZYA 2QR9A 3D6DA 3KWYA 3MNEA 3AFRA 5APKA 3K23A 5DI7A 1N4HA 2B23A 3O1DA 4IW6A 5DKSA 1KV6A 5E1CA 3ERDA 4E4QA 5L11A 3LBDA 5HYRA 2R6YA 5KCFA 2I4JA 3G9EA 1GWRA 1E3GA 2Q3YA 4LBDA 5C4UA 3A40X 3FURA 3RY9A 3PEQA 3GD2A 2VV4A 2P1VA 4IWFA 2ZXZA 2HWRA 3KYTA 3DR1A 1YUCA 3OZJA 5M96A 2Q59B 2QGTA 1XPCA 1U9EA 1YINA 3E94A 3VRWA 5ACCA 3JZBA 2IOGA 5DLRA 4POHA 1HG4A 5B5BA 1UHLA 4RMDA 4UDAA 2QZOB 1FD0A 1OSVA 2LBDA 5EJVA 3OS8A 3ADTA 3GYUA 4J26A 5DIEA 2QA8A 2NXXA 5DWLA 3WT5A 2XKWA 3KMGA 4ZJRA 2YLQA 1EXAA 3W0CA 3K8SA 1NQ1A 4JYHA 5DZ3A 2G44A 5DV6A 3TX7B 2QPYA 3HVLA 5JI0D 5FQSA 3IXPD 1SR7A 4LNWA 5DXGA 2V0VA 1GWQA 3E7CA 3A2JA 3OS8C 3BC5A 2Q7LA 4PP6A 2P54A 2I0JA 4B7WA 2H77A 4PXMA 5JJMA 3OMOA 3CS4A 2ZMJA 3IPQA 5DK9A 4XTAA 5DZ0A 5EC9A 3UUCA 3UVVB 3ZR7A 1G2NA 2Z4BA 1N46A 2QMVA 3UU7B 3CDSA 2R40D 3NOAA 1K7LA 4MGAA 1E3KA 4E4KA 5DRMA 3SP6A 4ZN7A 4RE8A 1FM9D 3VTDA 4APUA 5EGVA 4YMQA 5KRLA 1ZKYA 5KCDA 3HQ5A 4PLEA 1ZUCA 3NSQA 4ITEA 4CSJA 2NV7A 1RDTD 1ZAFA 5ETHA 3CS8A 4IS8A 4LTWA 1OT7A 1OVLA 4OJ9A 3A78A 3VT4A 2F4BA 2PIVA 4N1YA 3KMRA 3ET0A 4IU7A 5DXBB 2Q59A 3V9YA 4EM9A 2HB8A 4RMEA 2AA2A 1QKTA 2GPPA 4KZMA 2J7XA 4R6SA 4XHDA 3L03A 3CDPA 1NRLA 4ZNWA 2QZOA 1XOWA 3HLVA 2JFAA 4J5WA 4RWVA 3ZRAA 1DB1A 2ZXMA 1U3SA 1XDKB 1X76A 4JGVA 3L0JA 3L3XA 4PRGA 5AYGA 2Q61A 3AZ3A 4PP5A 4XAOA 2OVHA 2VV0A 1YY4A 2R40A 2NPAA 4MDDA 1ZDUA 1R1KD 2REWA 2FAIA 4OK1A 2HARA 3KDUA 3RUTA 4E2JA 1QKNA 4ZNHA 4MG7A 1XNNA 3OOFA 5DWGA 1RDTA 3W0HA 3PBAA 2QNVA 1R20D 4IVYA 3KBAA 5C4OA 2PIWA 5DXRA 3OKIA 3Q95B 3B66A 5G5WA 5DTVA 3R8AA 3UVVA 5G42A 3VRUA 1YJEA 3WJ5A 3V4AA 2PJLA 3VT7A 5G46A 3UU7A 3FEIA 5DY8A 1T73A 3GBKA 4MG5A 4G1DA 2OUZA 1L2JA 5EI1A 2POGA 5AZTA 3CJWA 4N73A 4IVWA 4YPQA 1UHLB 3VHVA 4N8RA 2BAWA 3L0LA 1FBYA 3P8XA 3W0GA 1S0XA 3TKMA 1A28A 2QA6A 2QTUA 4MGCA 3D5FA 4J5XA 5HJPB 2ZLCA 5HYKA 2ZNOA 3GWSX 1X7JA 2ATHA 1SQNA 1R5KA 2YLYA 2ZMIA 3B0RA 3BEJA 3MNPA 5DYBA 5DXBA 2J14A 5EITA 5KCTA 3H52A 4PWLA 2ZVTA 1Y0SA 2HAMA 4RAKA 1ZGYA 2YHDA 5E0WA 1R20A 4K7AA 1OSHA 5DV8A 5E15A 3N00A 4ZI1A 4XLDA 4OHAA 1XVPA 3X1IA 5DKBA 4F9MA 4RFWA 3V9TA 4J5XC 3WMHA 3SP9A 5JJMB 4REEA 4OJBA 3HC6A 2Z4JA 4Q50A 1K74D 5C4SA 1KNUA 5DWEA 2P7AA 2PIQA 4ZJWA 4OIVA 4RUPA 3VJTA 1I7GA 1XLSA 1NDEA 1PQ9A 2GTKA 1T7FA 3M7RA 4MGAB 4JL4A 4O8FA 4S15A 5KCUA 3RLLA 5KRFA 1LBDA 1T65A 4M8EA 2ZLAA 3VTCA 1XQ3A 3ILZA 1RJKA 1H9UA 3A9EB 5APHA 3Q95A 5DVCA 3UUAA 5KYJA 5DUGA 4CI5A 5DXPA 2OZ7A 2OCFA 3FC6A 5A86A 4ZNTA 5SYZA 3U9QA 2ZMHA 1OVLB 1PQ6A 1FCXA 1NQ7A 2AWHA 2GL8A 1EREA 4S14A 4OGHA 2YATA 3V9VA 4P6WA 2PIXA 2AX8A 5IAWA 4HEEX 2P15A 4RUOX 5DVVA 4OEYA 5G45A 1UPVA 3TY0A 2O4RA 3FXVA 2HB7A 2QH6A 3OLSA 1YP0A 2VV1B 2JFAB 2GWXA 3KFCA 5APJA 3VJIA 4MG9B 3T03A 3W5RA 3WFGA 1K74A 4OZTE 1T79A 3OMPA 2Q1HA 2AXAA 5HJPA 5E14A 4QJRA 4NQAB 2NXXE 2Q70A 2AO6A 4XT9A 5GIDA 4G2HA 1XP1A 1DKFA 1T7RA 2YJAB 1S9QA 3AN3A 4K6IA 4MG6A 4WVDA 5DUEA 3B3KA 1VJBA 1ERRA 1XNXA 3G0WA 4J24A 3P0UA 3K6PA 4NIEA 4MG7B 4IA7A 2ZK5A 2YLPA 5HCVA 3V3EA 1XV9A 2Q7IA 3AURA 5H1EA 3GN8A 5FQPA 1SKXA 1PDUA 2B1VA 3B1MA 2B50A 4WHGA 4A4VA 2W8YA 3K22A 4Q13A 3F7DA 5KRCA 4MGDB 3VI8A 2QABA 2ZY0A 3A3ZX 5E19A 2A3IA 3DY6A 3PCUA 1M7WA 3B5RA 3AUNA 5DU5A 1I38A 4X1FA 3A9EA 4G1ZA 4OZRE 1YMTA 3ET3A 3WTQA 1G1UA 2GPUA 3ET2A 1PQCA 3VT9A 2B1ZA 5DZHA 5KRHA 4OKXA 3V3QA 1M13A 1T7MA 3OKHA 2GPOA 2IHQA 5HZCA 2AMAA 2PIOA 2XYXA 3VT5A 1YA3A 4KZIA 5KRKA 3CLDA 1ZDTA 2Q7KA 2ZK3A 3MNOA 3F5CB 3E00A 3AZ2A 3P88A 2VV2A 2ZFXA 2VV1A 5DXEA 3UUDA 4MG9A 3UP0A 3ZQTA 1I7IA 3W0IA 2Q1VA 5E7VA 3HZFA 5L7GA 1XVPB 2PKLA 2AA7A 2ZK2A 5KYAA 1FCZA 4UDBA 5DX3B 3RUUA 4PVUA 2HWQA 2PINA 2AB2A 3OLLA 4OH5A 5AZVA 4BCRA 4DORA 3VN2A 3VT6A 4FHHA 3AZ1A 1XAPA 4J5WC 4OZTU 4R2UA 5L7EA 1T63A 2POBA 4QE8A 4REFA 4DK8A 3EYBA 4Q0AC 5DMFA 5DKGA 1I37A 2HFPA 2Q8SA 3OMQA 4OEDA 3UUAB 5ICKA 1NAXA 3FC6B 3W0AA 5L7HA 3D57A 2QXMA 2O9IA 1A52A 2ZK6A 4ONIA 3UP3A 3VSOA 4MGDA 1GWXA 4K4JA 4LSJA 3WT6A 2XYJA 5CJ6A 2P1UA 3HC5A 3IA6A 4UDDA 2P7ZA 5IXKA 2BJ4B 2QGWA 4DK7A 1NAVA 3HODA 4PLDA 4FGYA 3PRGA 2ZBSA 3AN4A 4OJ4A 4TV1A 4RUJA 3R8IA 3WFFA 4CI4A 2E2RA 3B65A 4XI3A 5I4VA 5DZIA 4L96A 3OZ0A 4G21A 2R6WA 2EWPA 3KPZA 4LNXA 4S0TA 1YOKA 3X31A 4XUMA 2Q7JA 1DKFB 4IWCA 1XZXX 3A2IA 1U3RA 1PCGA 4IA1A 3OS9A 2P7GA 2ZNQA 3F5CA 1ILGA 1QKMA 4OZRU 4RMCA 4YNKA 5DV3A 4DQMA 2J4AA 3L0EA 3IPSA 5KD9A 4HLWA 4G1YA 3FALA 1XV9B 5DXKA 4OH6A 2AAXA 3H0AA 4IV2A 1NUOA 5AWJA 5KCWA 2G5OA 5DX3A 2H79A 5F9BA 5G3JA 3KMZA 1SJ0A 5AAVB 5FQRA 4DMAA 2QSEA 1NYXA 4NY9A 4WLBA 3DCUA 2O4JA 1XLSE 2Q6JA 2FVJA 2ZL9A 4S0SA 4ZO1X 3V49A 2ABIA 5KCCA 4PPSA 1RK3A 3RVFA 2OAXA 3R29A 4JAZA 4X1GA 4ZO1B 1NQ2A 2G0HA 2P1TA 5HJSA 4IA2A 3FEJA 4QE6A 2VSRA 2YJDA 3FS1A 3B0QA 2FSZA 2ZKCA 2Q5SA 3OAPA 3SZ1A 3OSAA 4QM0A 2BJ4A 2PITA 2Q5GA 5DKEA 4OFUA 1X7BA 3JZCA 4G2IA 3UUDB 3CTBA 4OLMA 2AX7A 3FUGA 1LV2A 5DIDA 2AM9A 2VSTA 5AK2A 1XIUA 1X7RA 1T74A 4EMAA 3VRVA 5EHJA 4KZJA 1RKHA 3OOKA 4OKWA 5DP0A 2QE4A 1BSXA 2XYWA 5G44A 5KRAA 4TUZB 5DXQA 1TFCA 2I0GA 1UOMA 4XUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0W A;  4WHF A;  1MVC A;  4JYI A;  5GIC A;  4FNE A;  1PK5 A;  3E00 D;  5AVL A;  3S9S A;  4A2J A;  3OSW A;  4IW8 A;  1FM6 D;  2GPV A;  2JJ3 A;  3KDT A;  2Q6R A;  5DMC A;  3W0Y A;  1XJ7 A;  3A2H A;  3CQV A;  3VSP A;  5DZ1 A;  5AAV A;  2IOK A;  4RZE A;  2PRG A;  1R6G A;  3GWX A;  4ZOM A;  3IPU A;  3OSI A;  5GT4 A;  1Q4X A;  3ERT A;  4QK4 A;  5DRJ A;  4OEA A;  1MV9 A;  2OVM A;  5FQT A;  1S19 A;  4IA3 A;  1P8D A;  3ET1 A;  3ADW A;  2V7C A;  4TV1 B;  1X78 A;  1PRG A;  1WM0 X;  1XP6 A;  2YLO A;  5E0X A;  1HJ1 A;  3IMY A;  2AA6 A;  1YIM A;  4OIL A;  2P4Y A;  3D24 A;  5DWI A;  1XB7 A;  3NSP A;  5B41 A;  5DSH A;  2NW4 A;  2Q6S A;  3BQD A;  1ZH7 A;  4OEZ A;  1S0Z A;  4MG8 B;  1S9P A;  3OGT A;  3QT0 A;  3R5M A;  1FM6 A;  3CWD A;  3PLZ A;  3O1E A;  4NB6 A;  4PF3 A;  4RZF A;  2OM9 A;  3VTB A;  2ZAS A;  3FAL B;  3AX8 A;  1YYE A;  1K4W A;  3ZRB A;  2I4P A;  4ZNU A;  5DVS A;  5KR9 A;  3W0J A;  2PIU A;  2ZXN A;  3B0T A;  1IE9 A;  2HCD A;  2AX9 A;  2G0G A;  4P6X A;  4TUZ A;  1NQ0 A;  1TXI A;  1T7T A;  2AX6 A;  1M2Z A;  3IXP A;  1YOW A;  1P93 A;  1Z5X E;  2HAS A;  3ADU A;  3DCT A;  4OIU A;  4N5G A;  4R06 A;  3VJH A;  3WWR A;  4FN9 A;  3VT8 A;  4OKT A;  5LWP A;  4OAR A;  1T76 A;  4POJ A;  5JY3 A;  4RZG A;  1GS4 A;  3VHU A;  3HM1 A;  4YT1 A;  1KKQ A;  1T5Z A;  1MZN A;  5AWK A;  2GIU A;  3H0A D;  5KRO A;  1G5Y A;  3P89 A;  4DM6 A;  2ACL B;  1Z95 A;  3R2A A;  4MGB B;  3VHW A;  2AMB A;  5LGA A;  1U3Q A;  2HBH A;  2HC4 A;  2JF9 A;  4G20 A;  1UPW A;  3WT7 A;  3L1B A;  1FM9 A;  4ITF A;  3D90 A;  4PPP A;  3B67 A;  4ZNV A;  1X7E A;  2YFE A;  4OFR A;  2PNU A;  3ADX A;  3OMK A;  5AAU A;  2PIP L;  2ZK4 A;  4L98 A;  5G43 A;  5DUH A;  2AA5 A;  3CS6 A;  2ZK0 A;  3DT3 A;  4WQP A;  4A4W A;  5C4T A;  5AVI A;  1QKU A;  3OLF A;  4WPF A;  3W5Q A;  3OMM A;  4JYG A;  2VV4 B;  3DZU D;  4MG8 A;  4QL8 A;  3B68 A;  5KCE A;  2GP7 A;  5KRJ A;  3DZY D;  4ZNS A;  2PIR A;  3L3Z A;  5DXM A;  5FQV A;  3PO9 A;  2VV3 A;  3GZ9 A;  3FLI A;  4FHI A;  1EXX A;  2QW4 A;  3W5T A;  3X1H A;  2ZNP A;  3ADV A;  4IUI A;  4NUF A;  1Y9R A;  2HVC A;  3R8D A;  2Q60 A;  2QA8 B;  4OKB A;  1G50 A;  4DM8 A;  3HO0 A;  2ZK1 A;  1IE8 A;  5IZ0 A;  3RLJ A;  1R1K A;  4ZN9 A;  4IV4 A;  3GYT A;  5DL4 A;  5DWJ A;  5KRI A;  2Q5P A;  1PZL A;  4OC7 A;  1RKG A;  3VJS A;  2AYR A;  3ADS A;  1N83 A;  2J7Y A;  5DYD A;  4DOS A;  1NHZ A;  2QXS A;  3G8O A;  1ILH A;  3WJ4 A;  5KRM A;  3LMP A;  5K13 A;  4IQR A;  5DIG A;  3R5N A;  3W5P A;  5GIE A;  1XDK A;  2ZNN A;  3TKC A;  3G8I A;  3VRT A;  1FCY A;  4UDC A;  1XP9 A;  3DZU A;  1L2I A;  2ACL A;  1Z5X U;  1ZEO A;  2I4Z A;  1Y0X X;  3AUQ A;  3WGP A;  4MGB A;  1XQC A;  4M8H A;  4Y29 A;  4PP3 A;  3VT3 A;  2XHS A;  3X36 A;  3DZY A;  2QR9 A;  3D6D A;  3KWY A;  3MNE A;  3AFR A;  5APK A;  3K23 A;  5DI7 A;  1N4H A;  2B23 A;  3O1D A;  4IW6 A;  5DKS A;  1KV6 A;  5E1C A;  3ERD A;  4E4Q A;  5L11 A;  3LBD A;  5HYR A;  2R6Y A;  5KCF A;  2I4J A;  3G9E A;  1GWR A;  1E3G A;  2Q3Y A;  4LBD A;  5C4U A;  3A40 X;  3FUR A;  3RY9 A;  3PEQ A;  3GD2 A;  2VV4 A;  2P1V A;  4IWF A;  2ZXZ A;  2HWR A;  3KYT A;  3DR1 A;  1YUC A;  3OZJ A;  5M96 A;  2Q59 B;  2QGT A;  1XPC A;  1U9E A;  1YIN A;  3E94 A;  3VRW A;  5ACC A;  3JZB A;  2IOG A;  5DLR A;  4POH A;  1HG4 A;  5B5B A;  1UHL A;  4RMD A;  4UDA A;  2QZO B;  1FD0 A;  1OSV A;  2LBD A;  5EJV A;  3OS8 A;  3ADT A;  3GYU A;  4J26 A;  5DIE A;  2QA8 A;  2NXX A;  5DWL A;  3WT5 A;  2XKW A;  3KMG A;  4ZJR A;  2YLQ A;  1EXA A;  3W0C A;  3K8S A;  1NQ1 A;  4JYH A;  5DZ3 A;  2G44 A;  5DV6 A;  3TX7 B;  2QPY A;  3HVL A;  5JI0 D;  5FQS A;  3IXP D;  1SR7 A;  4LNW A;  5DXG A;  2V0V A;  1GWQ A;  3E7C A;  3A2J A;  3OS8 C;  3BC5 A;  2Q7L A;  4PP6 A;  2P54 A;  2I0J A;  4B7W A;  2H77 A;  4PXM A;  5JJM A;  3OMO A;  3CS4 A;  2ZMJ A;  3IPQ A;  5DK9 A;  4XTA A;  5DZ0 A;  5EC9 A;  3UUC A;  3UVV B;  3ZR7 A;  1G2N A;  2Z4B A;  1N46 A;  2QMV A;  3UU7 B;  3CDS A;  2R40 D;  3NOA A;  1K7L A;  4MGA A;  1E3K A;  4E4K A;  5DRM A;  3SP6 A;  4ZN7 A;  4RE8 A;  1FM9 D;  3VTD A;  4APU A;  5EGV A;  4YMQ A;  5KRL A;  1ZKY A;  5KCD A;  3HQ5 A;  4PLE A;  1ZUC A;  3NSQ A;  4ITE A;  4CSJ A;  2NV7 A;  1RDT D;  1ZAF A;  5ETH A;  3CS8 A;  4IS8 A;  4LTW A;  1OT7 A;  1OVL A;  4OJ9 A;  3A78 A;  3VT4 A;  2F4B A;  2PIV A;  4N1Y A;  3KMR A;  3ET0 A;  4IU7 A;  5DXB B;  2Q59 A;  3V9Y A;  4EM9 A;  2HB8 A;  4RME A;  2AA2 A;  1QKT A;  2GPP A;  4KZM A;  2J7X A;  4R6S A;  4XHD A;  3L03 A;  3CDP A;  1NRL A;  4ZNW A;  2QZO A;  1XOW A;  3HLV A;  2JFA A;  4J5W A;  4RWV A;  3ZRA A;  1DB1 A;  2ZXM A;  1U3S A;  1XDK B;  1X76 A;  4JGV A;  3L0J A;  3L3X A;  4PRG A;  5AYG A;  2Q61 A;  3AZ3 A;  4PP5 A;  4XAO A;  2OVH A;  2VV0 A;  1YY4 A;  2R40 A;  2NPA A;  4MDD A;  1ZDU A;  1R1K D;  2REW A;  2FAI A;  4OK1 A;  2HAR A;  3KDU A;  3RUT A;  4E2J A;  1QKN A;  4ZNH A;  4MG7 A;  1XNN A;  3OOF A;  5DWG A;  1RDT A;  3W0H A;  3PBA A;  2QNV A;  1R20 D;  4IVY A;  3KBA A;  5C4O A;  2PIW A;  5DXR A;  3OKI A;  3Q95 B;  3B66 A;  5G5W A;  5DTV A;  3R8A A;  3UVV A;  5G42 A;  3VRU A;  1YJE A;  3WJ5 A;  3V4A A;  2PJL A;  3VT7 A;  5G46 A;  3UU7 A;  3FEI A;  5DY8 A;  1T73 A;  3GBK A;  4MG5 A;  4G1D A;  2OUZ A;  1L2J A;  5EI1 A;  2POG A;  5AZT A;  3CJW A;  4N73 A;  4IVW A;  4YPQ A;  1UHL B;  3VHV A;  4N8R A;  2BAW A;  3L0L A;  1FBY A;  3P8X A;  3W0G A;  1S0X A;  3TKM A;  1A28 A;  2QA6 A;  2QTU A;  4MGC A;  3D5F A;  4J5X A;  5HJP B;  2ZLC A;  5HYK A;  2ZNO A;  3GWS X;  1X7J A;  2ATH A;  1SQN A;  1R5K A;  2YLY A;  2ZMI A;  3B0R A;  3BEJ A;  3MNP A;  5DYB A;  5DXB A;  2J14 A;  5EIT A;  5KCT A;  3H52 A;  4PWL A;  2ZVT A;  1Y0S A;  2HAM A;  4RAK A;  1ZGY A;  2YHD A;  5E0W A;  1R20 A;  4K7A A;  1OSH A;  5DV8 A;  5E15 A;  3N00 A;  4ZI1 A;  4XLD A;  4OHA A;  1XVP A;  3X1I A;  5DKB A;  4F9M A;  4RFW A;  3V9T A;  4J5X C;  3WMH A;  3SP9 A;  5JJM B;  4REE A;  4OJB A;  3HC6 A;  2Z4J A;  4Q50 A;  1K74 D;  5C4S A;  1KNU A;  5DWE A;  2P7A A;  2PIQ A;  4ZJW A;  4OIV A;  4RUP A;  3VJT A;  1I7G A;  1XLS A;  1NDE A;  1PQ9 A;  2GTK A;  1T7F A;  3M7R A;  4MGA B;  4JL4 A;  4O8F A;  4S15 A;  5KCU A;  3RLL A;  5KRF A;  1LBD A;  1T65 A;  4M8E A;  2ZLA A;  3VTC A;  1XQ3 A;  3ILZ A;  1RJK A;  1H9U A;  3A9E B;  5APH A;  3Q95 A;  5DVC A;  3UUA A;  5KYJ A;  5DUG A;  4CI5 A;  5DXP A;  2OZ7 A;  2OCF A;  3FC6 A;  5A86 A;  4ZNT A;  5SYZ A;  3U9Q A;  2ZMH A;  1OVL B;  1PQ6 A;  1FCX A;  1NQ7 A;  2AWH A;  2GL8 A;  1ERE A;  4S14 A;  4OGH A;  2YAT A;  3V9V A;  4P6W A;  2PIX A;  2AX8 A;  5IAW A;  4HEE X;  2P15 A;  4RUO X;  5DVV A;  4OEY A;  5G45 A;  1UPV A;  3TY0 A;  2O4R A;  3FXV A;  2HB7 A;  2QH6 A;  3OLS A;  1YP0 A;  2VV1 B;  2JFA B;  2GWX A;  3KFC A;  5APJ A;  3VJI A;  4MG9 B;  3T03 A;  3W5R A;  3WFG A;  1K74 A;  4OZT E;  1T79 A;  3OMP A;  2Q1H A;  2AXA A;  5HJP A;  5E14 A;  4QJR A;  4NQA B;  2NXX E;  2Q70 A;  2AO6 A;  4XT9 A;  5GID A;  4G2H A;  1XP1 A;  1DKF A;  1T7R A;  2YJA B;  1S9Q A;  3AN3 A;  4K6I A;  4MG6 A;  4WVD A;  5DUE A;  3B3K A;  1VJB A;  1ERR A;  1XNX A;  3G0W A;  4J24 A;  3P0U A;  3K6P A;  4NIE A;  4MG7 B;  4IA7 A;  2ZK5 A;  2YLP A;  5HCV A;  3V3E A;  1XV9 A;  2Q7I A;  3AUR A;  5H1E A;  3GN8 A;  5FQP A;  1SKX A;  1PDU A;  2B1V A;  3B1M A;  2B50 A;  4WHG A;  4A4V A;  2W8Y A;  3K22 A;  4Q13 A;  3F7D A;  5KRC A;  4MGD B;  3VI8 A;  2QAB A;  2ZY0 A;  3A3Z X;  5E19 A;  2A3I A;  3DY6 A;  3PCU A;  1M7W A;  3B5R A;  3AUN A;  5DU5 A;  1I38 A;  4X1F A;  3A9E A;  4G1Z A;  4OZR E;  1YMT A;  3ET3 A;  3WTQ A;  1G1U A;  2GPU A;  3ET2 A;  1PQC A;  3VT9 A;  2B1Z A;  5DZH A;  5KRH A;  4OKX A;  3V3Q A;  1M13 A;  1T7M A;  3OKH A;  2GPO A;  2IHQ A;  5HZC A;  2AMA A;  2PIO A;  2XYX A;  3VT5 A;  1YA3 A;  4KZI A;  5KRK A;  3CLD A;  1ZDT A;  2Q7K A;  2ZK3 A;  3MNO A;  3F5C B;  3E00 A;  3AZ2 A;  3P88 A;  2VV2 A;  2ZFX A;  2VV1 A;  5DXE A;  3UUD A;  4MG9 A;  3UP0 A;  3ZQT A;  1I7I A;  3W0I A;  2Q1V A;  5E7V A;  3HZF A;  5L7G A;  1XVP B;  2PKL A;  2AA7 A;  2ZK2 A;  5KYA A;  1FCZ A;  4UDB A;  5DX3 B;  3RUU A;  4PVU A;  2HWQ A;  2PIN A;  2AB2 A;  3OLL A;  4OH5 A;  5AZV A;  4BCR A;  4DOR A;  3VN2 A;  3VT6 A;  4FHH A;  3AZ1 A;  1XAP A;  4J5W C;  4OZT U;  4R2U A;  5L7E A;  1T63 A;  2POB A;  4QE8 A;  4REF A;  4DK8 A;  3EYB A;  4Q0A C;  5DMF A;  5DKG A;  1I37 A;  2HFP A;  2Q8S A;  3OMQ A;  4OED A;  3UUA B;  5ICK A;  1NAX A;  3FC6 B;  3W0A A;  5L7H A;  3D57 A;  2QXM A;  2O9I A;  1A52 A;  2ZK6 A;  4ONI A;  3UP3 A;  3VSO A;  4MGD A;  1GWX A;  4K4J A;  4LSJ A;  3WT6 A;  2XYJ A;  5CJ6 A;  2P1U A;  3HC5 A;  3IA6 A;  4UDD A;  2P7Z A;  5IXK A;  2BJ4 B;  2QGW A;  4DK7 A;  1NAV A;  3HOD A;  4PLD A;  4FGY A;  3PRG A;  2ZBS A;  3AN4 A;  4OJ4 A;  4TV1 A;  4RUJ A;  3R8I A;  3WFF A;  4CI4 A;  2E2R A;  3B65 A;  4XI3 A;  5I4V A;  5DZI A;  4L96 A;  3OZ0 A;  4G21 A;  2R6W A;  2EWP A;  3KPZ A;  4LNX A;  4S0T A;  1YOK A;  3X31 A;  4XUM A;  2Q7J A;  1DKF B;  4IWC A;  1XZX X;  3A2I A;  1U3R A;  1PCG A;  4IA1 A;  3OS9 A;  2P7G A;  2ZNQ A;  3F5C A;  1ILG A;  1QKM A;  4OZR U;  4RMC A;  4YNK A;  5DV3 A;  4DQM A;  2J4A A;  3L0E A;  3IPS A;  5KD9 A;  4HLW A;  4G1Y A;  3FAL A;  1XV9 B;  5DXK A;  4OH6 A;  2AAX A;  3H0A A;  4IV2 A;  1NUO A;  5AWJ A;  5KCW A;  2G5O A;  5DX3 A;  2H79 A;  5F9B A;  5G3J A;  3KMZ A;  1SJ0 A;  5AAV B;  5FQR A;  4DMA A;  2QSE A;  1NYX A;  4NY9 A;  4WLB A;  3DCU A;  2O4J A;  1XLS E;  2Q6J A;  2FVJ A;  2ZL9 A;  4S0S A;  4ZO1 X;  3V49 A;  2ABI A;  5KCC A;  4PPS A;  1RK3 A;  3RVF A;  2OAX A;  3R29 A;  4JAZ A;  4X1G A;  4ZO1 B;  1NQ2 A;  2G0H A;  2P1T A;  5HJS A;  4IA2 A;  3FEJ A;  4QE6 A;  2VSR A;  2YJD A;  3FS1 A;  3B0Q A;  2FSZ A;  2ZKC A;  2Q5S A;  3OAP A;  3SZ1 A;  3OSA A;  4QM0 A;  2BJ4 A;  2PIT A;  2Q5G A;  5DKE A;  4OFU A;  1X7B A;  3JZC A;  4G2I A;  3UUD B;  3CTB A;  4OLM A;  2AX7 A;  3FUG A;  1LV2 A;  5DID A;  2AM9 A;  2VST A;  5AK2 A;  1XIU A;  1X7R A;  1T74 A;  4EMA A;  3VRV A;  5EHJ A;  4KZJ A;  1RKH A;  3OOK A;  4OKW A;  5DP0 A;  2QE4 A;  1BSX A;  2XYW A;  5G44 A;  5KRA A;  4TUZ B;  5DXQ A;  1TFC A;  2I0G A;  1UOM A;  4XUH A; 
#chains in the Genus database with same CATH topology
 3B0W A;  4WHF A;  1MVC A;  4JYI A;  5GIC A;  4FNE A;  1PK5 A;  3E00 D;  5AVL A;  3S9S A;  4A2J A;  3OSW A;  4IW8 A;  1FM6 D;  2GPV A;  2JJ3 A;  3KDT A;  2Q6R A;  5DMC A;  3W0Y A;  1XJ7 A;  3A2H A;  3CQV A;  3VSP A;  5DZ1 A;  5AAV A;  2IOK A;  4RZE A;  2PRG A;  1R6G A;  3GWX A;  4ZOM A;  3IPU A;  3OSI A;  5GT4 A;  1Q4X A;  3ERT A;  4QK4 A;  5DRJ A;  4OEA A;  1MV9 A;  2OVM A;  5FQT A;  1S19 A;  4IA3 A;  1P8D A;  3ET1 A;  3ADW A;  2V7C A;  4TV1 B;  1X78 A;  1PRG A;  1WM0 X;  1XP6 A;  2YLO A;  5E0X A;  1HJ1 A;  3IMY A;  2AA6 A;  1YIM A;  4OIL A;  2P4Y A;  3D24 A;  5DWI A;  1XB7 A;  3NSP A;  5B41 A;  5DSH A;  2NW4 A;  2Q6S A;  3BQD A;  1ZH7 A;  4OEZ A;  1S0Z A;  4MG8 B;  1S9P A;  3OGT A;  3QT0 A;  3R5M A;  1FM6 A;  3CWD A;  3PLZ A;  3O1E A;  4NB6 A;  4PF3 A;  4RZF A;  2OM9 A;  3VTB A;  2ZAS A;  3FAL B;  3AX8 A;  1YYE A;  1K4W A;  3ZRB A;  2I4P A;  4ZNU A;  5DVS A;  5KR9 A;  3W0J A;  2PIU A;  2ZXN A;  3B0T A;  1IE9 A;  2HCD A;  2AX9 A;  2G0G A;  4P6X A;  4TUZ A;  1NQ0 A;  1TXI A;  1T7T A;  2AX6 A;  1M2Z A;  3IXP A;  1YOW A;  1P93 A;  1Z5X E;  2HAS A;  3ADU A;  3DCT A;  4OIU A;  4N5G A;  4R06 A;  3VJH A;  3WWR A;  4FN9 A;  3VT8 A;  4OKT A;  5LWP A;  4OAR A;  1T76 A;  4POJ A;  5JY3 A;  4RZG A;  1GS4 A;  3VHU A;  3HM1 A;  4YT1 A;  1KKQ A;  1T5Z A;  1MZN A;  5AWK A;  2GIU A;  3H0A D;  5KRO A;  1G5Y A;  3P89 A;  4DM6 A;  2ACL B;  1Z95 A;  3R2A A;  4MGB B;  3VHW A;  2AMB A;  5LGA A;  1U3Q A;  2HBH A;  2HC4 A;  2JF9 A;  4G20 A;  1UPW A;  3WT7 A;  3L1B A;  1FM9 A;  4ITF A;  3D90 A;  4PPP A;  3B67 A;  4ZNV A;  1X7E A;  2YFE A;  4OFR A;  2PNU A;  3ADX A;  3OMK A;  5AAU A;  2PIP L;  2ZK4 A;  4L98 A;  5G43 A;  5DUH A;  2AA5 A;  3CS6 A;  2ZK0 A;  3DT3 A;  4WQP A;  4A4W A;  5C4T A;  5AVI A;  1QKU A;  3OLF A;  4WPF A;  3W5Q A;  3OMM A;  4JYG A;  2VV4 B;  3DZU D;  4MG8 A;  4QL8 A;  3B68 A;  5KCE A;  2GP7 A;  5KRJ A;  3DZY D;  4ZNS A;  2PIR A;  3L3Z A;  5DXM A;  5FQV A;  3PO9 A;  2VV3 A;  3GZ9 A;  3FLI A;  4FHI A;  1EXX A;  2QW4 A;  3W5T A;  3X1H A;  2ZNP A;  3ADV A;  4IUI A;  4NUF A;  1Y9R A;  2HVC A;  3R8D A;  2Q60 A;  2QA8 B;  4OKB A;  1G50 A;  4DM8 A;  3HO0 A;  2ZK1 A;  1IE8 A;  5IZ0 A;  3RLJ A;  1R1K A;  4ZN9 A;  4IV4 A;  3GYT A;  5DL4 A;  5DWJ A;  5KRI A;  2Q5P A;  1PZL A;  4OC7 A;  1RKG A;  3VJS A;  2AYR A;  3ADS A;  1N83 A;  2J7Y A;  5DYD A;  4DOS A;  1NHZ A;  2QXS A;  3G8O A;  1ILH A;  3WJ4 A;  5KRM A;  3LMP A;  5K13 A;  4IQR A;  5DIG A;  3R5N A;  3W5P A;  5GIE A;  1XDK A;  2ZNN A;  3TKC A;  3G8I A;  3VRT A;  1FCY A;  4UDC A;  1XP9 A;  3DZU A;  1L2I A;  2ACL A;  1Z5X U;  1ZEO A;  2I4Z A;  1Y0X X;  3AUQ A;  3WGP A;  4MGB A;  1XQC A;  4M8H A;  4Y29 A;  4PP3 A;  3VT3 A;  2XHS A;  3X36 A;  3DZY A;  2QR9 A;  3D6D A;  3KWY A;  3MNE A;  3AFR A;  5APK A;  3K23 A;  5DI7 A;  1N4H A;  2B23 A;  3O1D A;  4IW6 A;  5DKS A;  1KV6 A;  5E1C A;  3ERD A;  4E4Q A;  5L11 A;  3LBD A;  5HYR A;  2R6Y A;  5KCF A;  2I4J A;  3G9E A;  1GWR A;  1E3G A;  2Q3Y A;  4LBD A;  5C4U A;  3A40 X;  3FUR A;  3RY9 A;  3PEQ A;  3GD2 A;  2VV4 A;  2P1V A;  4IWF A;  2ZXZ A;  2HWR A;  3KYT A;  3DR1 A;  1YUC A;  3OZJ A;  5M96 A;  2Q59 B;  2QGT A;  1XPC A;  1U9E A;  1YIN A;  3E94 A;  3VRW A;  5ACC A;  3JZB A;  2IOG A;  5DLR A;  4POH A;  1HG4 A;  5B5B A;  1UHL A;  4RMD A;  4UDA A;  2QZO B;  1FD0 A;  1OSV A;  2LBD A;  5EJV A;  3OS8 A;  3ADT A;  3GYU A;  4J26 A;  5DIE A;  2QA8 A;  2NXX A;  5DWL A;  3WT5 A;  2XKW A;  3KMG A;  4ZJR A;  2YLQ A;  1EXA A;  3W0C A;  3K8S A;  1NQ1 A;  4JYH A;  5DZ3 A;  2G44 A;  5DV6 A;  3TX7 B;  2QPY A;  3HVL A;  5JI0 D;  5FQS A;  3IXP D;  1SR7 A;  4LNW A;  5DXG A;  2V0V A;  1GWQ A;  3E7C A;  3A2J A;  3OS8 C;  3BC5 A;  2Q7L A;  4PP6 A;  2P54 A;  2I0J A;  4B7W A;  2H77 A;  4PXM A;  5JJM A;  3OMO A;  3CS4 A;  2ZMJ A;  3IPQ A;  5DK9 A;  4XTA A;  5DZ0 A;  5EC9 A;  3UUC A;  3UVV B;  3ZR7 A;  1G2N A;  2Z4B A;  1N46 A;  2QMV A;  3UU7 B;  3CDS A;  2R40 D;  3NOA A;  1K7L A;  4MGA A;  1E3K A;  4E4K A;  5DRM A;  3SP6 A;  4ZN7 A;  4RE8 A;  1FM9 D;  3VTD A;  4APU A;  5EGV A;  4YMQ A;  5KRL A;  1ZKY A;  5KCD A;  3HQ5 A;  4PLE A;  1ZUC A;  3NSQ A;  4ITE A;  4CSJ A;  2NV7 A;  1RDT D;  1ZAF A;  5ETH A;  3CS8 A;  4IS8 A;  4LTW A;  1OT7 A;  1OVL A;  4OJ9 A;  3A78 A;  3VT4 A;  2F4B A;  2PIV A;  4N1Y A;  3KMR A;  3ET0 A;  4IU7 A;  5DXB B;  2Q59 A;  3V9Y A;  4EM9 A;  2HB8 A;  4RME A;  2AA2 A;  1QKT A;  2GPP A;  4KZM A;  2J7X A;  4R6S A;  4XHD A;  3L03 A;  3CDP A;  1NRL A;  4ZNW A;  2QZO A;  1XOW A;  3HLV A;  2JFA A;  4J5W A;  4RWV A;  3ZRA A;  1DB1 A;  2ZXM A;  1U3S A;  1XDK B;  1X76 A;  4JGV A;  3L0J A;  3L3X A;  4PRG A;  5AYG A;  2Q61 A;  3AZ3 A;  4PP5 A;  4XAO A;  2OVH A;  2VV0 A;  1YY4 A;  2R40 A;  2NPA A;  4MDD A;  1ZDU A;  1R1K D;  2REW A;  2FAI A;  4OK1 A;  2HAR A;  3KDU A;  3RUT A;  4E2J A;  1QKN A;  4ZNH A;  4MG7 A;  1XNN A;  3OOF A;  5DWG A;  1RDT A;  3W0H A;  3PBA A;  2QNV A;  1R20 D;  4IVY A;  3KBA A;  5C4O A;  2PIW A;  5DXR A;  3OKI A;  3Q95 B;  3B66 A;  5G5W A;  5DTV A;  3R8A A;  3UVV A;  5G42 A;  3VRU A;  1YJE A;  3WJ5 A;  3V4A A;  2PJL A;  3VT7 A;  5G46 A;  3UU7 A;  3FEI A;  5DY8 A;  1T73 A;  3GBK A;  4MG5 A;  4G1D A;  2OUZ A;  1L2J A;  5EI1 A;  2POG A;  5AZT A;  3CJW A;  4N73 A;  4IVW A;  4YPQ A;  1UHL B;  3VHV A;  4N8R A;  2BAW A;  3L0L A;  1FBY A;  3P8X A;  3W0G A;  1S0X A;  3TKM A;  1A28 A;  2QA6 A;  2QTU A;  4MGC A;  3D5F A;  4J5X A;  5HJP B;  2ZLC A;  5HYK A;  2ZNO A;  3GWS X;  1X7J A;  2ATH A;  1SQN A;  1R5K A;  2YLY A;  2ZMI A;  3B0R A;  3BEJ A;  3MNP A;  5DYB A;  5DXB A;  2J14 A;  5EIT A;  5KCT A;  3H52 A;  4PWL A;  2ZVT A;  1Y0S A;  2HAM A;  4RAK A;  1ZGY A;  2YHD A;  5E0W A;  1R20 A;  4K7A A;  1OSH A;  5DV8 A;  5E15 A;  3N00 A;  4ZI1 A;  4XLD A;  4OHA A;  1XVP A;  3X1I A;  5DKB A;  4F9M A;  4RFW A;  3V9T A;  4J5X C;  3WMH A;  3SP9 A;  5JJM B;  4REE A;  4OJB A;  3HC6 A;  2Z4J A;  4Q50 A;  1K74 D;  5C4S A;  1KNU A;  5DWE A;  2P7A A;  2PIQ A;  4ZJW A;  4OIV A;  4RUP A;  3VJT A;  1I7G A;  1XLS A;  1NDE A;  1PQ9 A;  2GTK A;  1T7F A;  3M7R A;  4MGA B;  4JL4 A;  4O8F A;  4S15 A;  5KCU A;  3RLL A;  5KRF A;  1LBD A;  1T65 A;  4M8E A;  2ZLA A;  3VTC A;  1XQ3 A;  3ILZ A;  1RJK A;  1H9U A;  3A9E B;  5APH A;  3Q95 A;  5DVC A;  3UUA A;  5KYJ A;  5DUG A;  4CI5 A;  5DXP A;  2OZ7 A;  2OCF A;  3FC6 A;  5A86 A;  4ZNT A;  5SYZ A;  3U9Q A;  2ZMH A;  1OVL B;  1PQ6 A;  1FCX A;  1NQ7 A;  2AWH A;  2GL8 A;  1ERE A;  4S14 A;  4OGH A;  2YAT A;  3V9V A;  4P6W A;  2PIX A;  2AX8 A;  5IAW A;  4HEE X;  2P15 A;  4RUO X;  5DVV A;  4OEY A;  5G45 A;  1UPV A;  3TY0 A;  2O4R A;  3FXV A;  2HB7 A;  2QH6 A;  3OLS A;  1YP0 A;  2VV1 B;  2JFA B;  2GWX A;  3KFC A;  5APJ A;  3VJI A;  4MG9 B;  3T03 A;  3W5R A;  3WFG A;  1K74 A;  4OZT E;  1T79 A;  3OMP A;  2Q1H A;  2AXA A;  5HJP A;  5E14 A;  4QJR A;  4NQA B;  2NXX E;  2Q70 A;  2AO6 A;  4XT9 A;  5GID A;  4G2H A;  1XP1 A;  1DKF A;  1T7R A;  2YJA B;  1S9Q A;  3AN3 A;  4K6I A;  4MG6 A;  4WVD A;  5DUE A;  3B3K A;  1VJB A;  1ERR A;  1XNX A;  3G0W A;  4J24 A;  3P0U A;  3K6P A;  4NIE A;  4MG7 B;  4IA7 A;  2ZK5 A;  2YLP A;  5HCV A;  3V3E A;  1XV9 A;  2Q7I A;  3AUR A;  5H1E A;  3GN8 A;  5FQP A;  1SKX A;  1PDU A;  2B1V A;  3B1M A;  2B50 A;  4WHG A;  4A4V A;  2W8Y A;  3K22 A;  4Q13 A;  3F7D A;  5KRC A;  4MGD B;  3VI8 A;  2QAB A;  2ZY0 A;  3A3Z X;  5E19 A;  2A3I A;  3DY6 A;  3PCU A;  1M7W A;  3B5R A;  3AUN A;  5DU5 A;  1I38 A;  4X1F A;  3A9E A;  4G1Z A;  4OZR E;  1YMT A;  3ET3 A;  3WTQ A;  1G1U A;  2GPU A;  3ET2 A;  1PQC A;  3VT9 A;  2B1Z A;  5DZH A;  5KRH A;  4OKX A;  3V3Q A;  1M13 A;  1T7M A;  3OKH A;  2GPO A;  2IHQ A;  5HZC A;  2AMA A;  2PIO A;  2XYX A;  3VT5 A;  1YA3 A;  4KZI A;  5KRK A;  3CLD A;  1ZDT A;  2Q7K A;  2ZK3 A;  3MNO A;  3F5C B;  3E00 A;  3AZ2 A;  3P88 A;  2VV2 A;  2ZFX A;  2VV1 A;  5DXE A;  3UUD A;  4MG9 A;  3UP0 A;  3ZQT A;  1I7I A;  3W0I A;  2Q1V A;  5E7V A;  3HZF A;  5L7G A;  1XVP B;  2PKL A;  2AA7 A;  2ZK2 A;  5KYA A;  1FCZ A;  4UDB A;  5DX3 B;  3RUU A;  4PVU A;  2HWQ A;  2PIN A;  2AB2 A;  3OLL A;  4OH5 A;  5AZV A;  4BCR A;  4DOR A;  3VN2 A;  3VT6 A;  4FHH A;  3AZ1 A;  1XAP A;  4J5W C;  4OZT U;  4R2U A;  5L7E A;  1T63 A;  2POB A;  4QE8 A;  4REF A;  4DK8 A;  3EYB A;  4Q0A C;  5DMF A;  5DKG A;  1I37 A;  2HFP A;  2Q8S A;  3OMQ A;  4OED A;  3UUA B;  5ICK A;  1NAX A;  3FC6 B;  3W0A A;  5L7H A;  3D57 A;  2QXM A;  2O9I A;  1A52 A;  2ZK6 A;  4ONI A;  3UP3 A;  3VSO A;  4MGD A;  1GWX A;  4K4J A;  4LSJ A;  3WT6 A;  2XYJ A;  5CJ6 A;  2P1U A;  3HC5 A;  3IA6 A;  4UDD A;  2P7Z A;  5IXK A;  2BJ4 B;  2QGW A;  4DK7 A;  1NAV A;  3HOD A;  4PLD A;  4FGY A;  3PRG A;  2ZBS A;  3AN4 A;  4OJ4 A;  4TV1 A;  4RUJ A;  3R8I A;  3WFF A;  4CI4 A;  2E2R A;  3B65 A;  4XI3 A;  5I4V A;  5DZI A;  4L96 A;  3OZ0 A;  4G21 A;  2R6W A;  2EWP A;  3KPZ A;  4LNX A;  4S0T A;  1YOK A;  3X31 A;  4XUM A;  2Q7J A;  1DKF B;  4IWC A;  1XZX X;  3A2I A;  1U3R A;  1PCG A;  4IA1 A;  3OS9 A;  2P7G A;  2ZNQ A;  3F5C A;  1ILG A;  1QKM A;  4OZR U;  4RMC A;  4YNK A;  5DV3 A;  4DQM A;  2J4A A;  3L0E A;  3IPS A;  5KD9 A;  4HLW A;  4G1Y A;  3FAL A;  1XV9 B;  5DXK A;  4OH6 A;  2AAX A;  3H0A A;  4IV2 A;  1NUO A;  5AWJ A;  5KCW A;  2G5O A;  5DX3 A;  2H79 A;  5F9B A;  5G3J A;  3KMZ A;  1SJ0 A;  5AAV B;  5FQR A;  4DMA A;  2QSE A;  1NYX A;  4NY9 A;  4WLB A;  3DCU A;  2O4J A;  1XLS E;  2Q6J A;  2FVJ A;  2ZL9 A;  4S0S A;  4ZO1 X;  3V49 A;  2ABI A;  5KCC A;  4PPS A;  1RK3 A;  3RVF A;  2OAX A;  3R29 A;  4JAZ A;  4X1G A;  4ZO1 B;  1NQ2 A;  2G0H A;  2P1T A;  5HJS A;  4IA2 A;  3FEJ A;  4QE6 A;  2VSR A;  2YJD A;  3FS1 A;  3B0Q A;  2FSZ A;  2ZKC A;  2Q5S A;  3OAP A;  3SZ1 A;  3OSA A;  4QM0 A;  2BJ4 A;  2PIT A;  2Q5G A;  5DKE A;  4OFU A;  1X7B A;  3JZC A;  4G2I A;  3UUD B;  3CTB A;  4OLM A;  2AX7 A;  3FUG A;  1LV2 A;  5DID A;  2AM9 A;  2VST A;  5AK2 A;  1XIU A;  1X7R A;  1T74 A;  4EMA A;  3VRV A;  5EHJ A;  4KZJ A;  1RKH A;  3OOK A;  4OKW A;  5DP0 A;  2QE4 A;  1BSX A;  2XYW A;  5G44 A;  5KRA A;  4TUZ B;  5DXQ A;  1TFC A;  2I0G A;  1UOM A;  4XUH A; 
#chains in the Genus database with same CATH homology
 3B0W A;  4WHF A;  1MVC A;  4JYI A;  5GIC A;  4FNE A;  1PK5 A;  3E00 D;  5AVL A;  3S9S A;  4A2J A;  3OSW A;  4IW8 A;  1FM6 D;  2GPV A;  2JJ3 A;  3KDT A;  2Q6R A;  5DMC A;  3W0Y A;  1XJ7 A;  3A2H A;  3CQV A;  3VSP A;  5DZ1 A;  5AAV A;  2IOK A;  4RZE A;  2PRG A;  1R6G A;  3GWX A;  4ZOM A;  3IPU A;  3OSI A;  5GT4 A;  1Q4X A;  3ERT A;  4QK4 A;  5DRJ A;  4OEA A;  1MV9 A;  2OVM A;  5FQT A;  1S19 A;  4IA3 A;  1P8D A;  3ET1 A;  3ADW A;  2V7C A;  4TV1 B;  1X78 A;  1PRG A;  1WM0 X;  1XP6 A;  2YLO A;  5E0X A;  1HJ1 A;  3IMY A;  2AA6 A;  1YIM A;  4OIL A;  2P4Y A;  3D24 A;  5DWI A;  1XB7 A;  3NSP A;  5B41 A;  5DSH A;  2NW4 A;  2Q6S A;  3BQD A;  1ZH7 A;  4OEZ A;  1S0Z A;  4MG8 B;  1S9P A;  3OGT A;  3QT0 A;  3R5M A;  1FM6 A;  3CWD A;  3PLZ A;  3O1E A;  4NB6 A;  4PF3 A;  4RZF A;  2OM9 A;  3VTB A;  2ZAS A;  3FAL B;  3AX8 A;  1YYE A;  1K4W A;  3ZRB A;  2I4P A;  4ZNU A;  5DVS A;  5KR9 A;  3W0J A;  2PIU A;  2ZXN A;  3B0T A;  1IE9 A;  2HCD A;  2AX9 A;  2G0G A;  4P6X A;  4TUZ A;  1NQ0 A;  1TXI A;  1T7T A;  2AX6 A;  1M2Z A;  3IXP A;  1YOW A;  1P93 A;  1Z5X E;  2HAS A;  3ADU A;  3DCT A;  4OIU A;  4N5G A;  4R06 A;  3VJH A;  3WWR A;  4FN9 A;  3VT8 A;  4OKT A;  5LWP A;  4OAR A;  1T76 A;  4POJ A;  5JY3 A;  4RZG A;  1GS4 A;  3VHU A;  3HM1 A;  4YT1 A;  1KKQ A;  1T5Z A;  1MZN A;  5AWK A;  2GIU A;  3H0A D;  5KRO A;  1G5Y A;  3P89 A;  4DM6 A;  2ACL B;  1Z95 A;  3R2A A;  4MGB B;  3VHW A;  2AMB A;  5LGA A;  1U3Q A;  2HBH A;  2HC4 A;  2JF9 A;  4G20 A;  1UPW A;  3WT7 A;  3L1B A;  1FM9 A;  4ITF A;  3D90 A;  4PPP A;  3B67 A;  4ZNV A;  1X7E A;  2YFE A;  4OFR A;  2PNU A;  3ADX A;  3OMK A;  5AAU A;  2PIP L;  2ZK4 A;  4L98 A;  5G43 A;  5DUH A;  2AA5 A;  3CS6 A;  2ZK0 A;  3DT3 A;  4WQP A;  4A4W A;  5C4T A;  5AVI A;  1QKU A;  3OLF A;  4WPF A;  3W5Q A;  3OMM A;  4JYG A;  2VV4 B;  3DZU D;  4MG8 A;  4QL8 A;  3B68 A;  5KCE A;  2GP7 A;  5KRJ A;  3DZY D;  4ZNS A;  2PIR A;  3L3Z A;  5DXM A;  5FQV A;  3PO9 A;  2VV3 A;  3GZ9 A;  3FLI A;  4FHI A;  1EXX A;  2QW4 A;  3W5T A;  3X1H A;  2ZNP A;  3ADV A;  4IUI A;  4NUF A;  1Y9R A;  2HVC A;  3R8D A;  2Q60 A;  2QA8 B;  4OKB A;  1G50 A;  4DM8 A;  3HO0 A;  2ZK1 A;  1IE8 A;  5IZ0 A;  3RLJ A;  1R1K A;  4ZN9 A;  4IV4 A;  3GYT A;  5DL4 A;  5DWJ A;  5KRI A;  2Q5P A;  1PZL A;  4OC7 A;  1RKG A;  3VJS A;  2AYR A;  3ADS A;  1N83 A;  2J7Y A;  5DYD A;  4DOS A;  1NHZ A;  2QXS A;  3G8O A;  1ILH A;  3WJ4 A;  5KRM A;  3LMP A;  5K13 A;  4IQR A;  5DIG A;  3R5N A;  3W5P A;  5GIE A;  1XDK A;  2ZNN A;  3TKC A;  3G8I A;  3VRT A;  1FCY A;  4UDC A;  1XP9 A;  3DZU A;  1L2I A;  2ACL A;  1Z5X U;  1ZEO A;  2I4Z A;  1Y0X X;  3AUQ A;  3WGP A;  4MGB A;  1XQC A;  4M8H A;  4Y29 A;  4PP3 A;  3VT3 A;  2XHS A;  3X36 A;  3DZY A;  2QR9 A;  3D6D A;  3KWY A;  3MNE A;  3AFR A;  5APK A;  3K23 A;  5DI7 A;  1N4H A;  2B23 A;  3O1D A;  4IW6 A;  5DKS A;  1KV6 A;  5E1C A;  3ERD A;  4E4Q A;  5L11 A;  3LBD A;  5HYR A;  2R6Y A;  5KCF A;  2I4J A;  3G9E A;  1GWR A;  1E3G A;  2Q3Y A;  4LBD A;  5C4U A;  3A40 X;  3FUR A;  3RY9 A;  3PEQ A;  3GD2 A;  2VV4 A;  2P1V A;  4IWF A;  2ZXZ A;  2HWR A;  3KYT A;  3DR1 A;  1YUC A;  3OZJ A;  5M96 A;  2Q59 B;  2QGT A;  1XPC A;  1U9E A;  1YIN A;  3E94 A;  3VRW A;  5ACC A;  3JZB A;  2IOG A;  5DLR A;  4POH A;  1HG4 A;  5B5B A;  1UHL A;  4RMD A;  4UDA A;  2QZO B;  1FD0 A;  1OSV A;  2LBD A;  5EJV A;  3OS8 A;  3ADT A;  3GYU A;  4J26 A;  5DIE A;  2QA8 A;  2NXX A;  5DWL A;  3WT5 A;  2XKW A;  3KMG A;  4ZJR A;  2YLQ A;  1EXA A;  3W0C A;  3K8S A;  1NQ1 A;  4JYH A;  5DZ3 A;  2G44 A;  5DV6 A;  3TX7 B;  2QPY A;  3HVL A;  5JI0 D;  5FQS A;  3IXP D;  1SR7 A;  4LNW A;  5DXG A;  2V0V A;  1GWQ A;  3E7C A;  3A2J A;  3OS8 C;  3BC5 A;  2Q7L A;  4PP6 A;  2P54 A;  2I0J A;  4B7W A;  2H77 A;  4PXM A;  5JJM A;  3OMO A;  3CS4 A;  2ZMJ A;  3IPQ A;  5DK9 A;  4XTA A;  5DZ0 A;  5EC9 A;  3UUC A;  3UVV B;  3ZR7 A;  1G2N A;  2Z4B A;  1N46 A;  2QMV A;  3UU7 B;  3CDS A;  2R40 D;  3NOA A;  1K7L A;  4MGA A;  1E3K A;  4E4K A;  5DRM A;  3SP6 A;  4ZN7 A;  4RE8 A;  1FM9 D;  3VTD A;  4APU A;  5EGV A;  4YMQ A;  5KRL A;  1ZKY A;  5KCD A;  3HQ5 A;  4PLE A;  1ZUC A;  3NSQ A;  4ITE A;  4CSJ A;  2NV7 A;  1RDT D;  1ZAF A;  5ETH A;  3CS8 A;  4IS8 A;  4LTW A;  1OT7 A;  1OVL A;  4OJ9 A;  3A78 A;  3VT4 A;  2F4B A;  2PIV A;  4N1Y A;  3KMR A;  3ET0 A;  4IU7 A;  5DXB B;  2Q59 A;  3V9Y A;  4EM9 A;  2HB8 A;  4RME A;  2AA2 A;  1QKT A;  2GPP A;  4KZM A;  2J7X A;  4R6S A;  4XHD A;  3L03 A;  3CDP A;  1NRL A;  4ZNW A;  2QZO A;  1XOW A;  3HLV A;  2JFA A;  4J5W A;  4RWV A;  3ZRA A;  1DB1 A;  2ZXM A;  1U3S A;  1XDK B;  1X76 A;  4JGV A;  3L0J A;  3L3X A;  4PRG A;  5AYG A;  2Q61 A;  3AZ3 A;  4PP5 A;  4XAO A;  2OVH A;  2VV0 A;  1YY4 A;  2R40 A;  2NPA A;  4MDD A;  1ZDU A;  1R1K D;  2REW A;  2FAI A;  4OK1 A;  2HAR A;  3KDU A;  3RUT A;  4E2J A;  1QKN A;  4ZNH A;  4MG7 A;  1XNN A;  3OOF A;  5DWG A;  1RDT A;  3W0H A;  3PBA A;  2QNV A;  1R20 D;  4IVY A;  3KBA A;  5C4O A;  2PIW A;  5DXR A;  3OKI A;  3Q95 B;  3B66 A;  5G5W A;  5DTV A;  3R8A A;  3UVV A;  5G42 A;  3VRU A;  1YJE A;  3WJ5 A;  3V4A A;  2PJL A;  3VT7 A;  5G46 A;  3UU7 A;  3FEI A;  5DY8 A;  1T73 A;  3GBK A;  4MG5 A;  4G1D A;  2OUZ A;  1L2J A;  5EI1 A;  2POG A;  5AZT A;  3CJW A;  4N73 A;  4IVW A;  4YPQ A;  1UHL B;  3VHV A;  4N8R A;  2BAW A;  3L0L A;  1FBY A;  3P8X A;  3W0G A;  1S0X A;  3TKM A;  1A28 A;  2QA6 A;  2QTU A;  4MGC A;  3D5F A;  4J5X A;  5HJP B;  2ZLC A;  5HYK A;  2ZNO A;  3GWS X;  1X7J A;  2ATH A;  1SQN A;  1R5K A;  2YLY A;  2ZMI A;  3B0R A;  3BEJ A;  3MNP A;  5DYB A;  5DXB A;  2J14 A;  5EIT A;  5KCT A;  3H52 A;  4PWL A;  2ZVT A;  1Y0S A;  2HAM A;  4RAK A;  1ZGY A;  2YHD A;  5E0W A;  1R20 A;  4K7A A;  1OSH A;  5DV8 A;  5E15 A;  3N00 A;  4ZI1 A;  4XLD A;  4OHA A;  1XVP A;  3X1I A;  5DKB A;  4F9M A;  4RFW A;  3V9T A;  4J5X C;  3WMH A;  3SP9 A;  5JJM B;  4REE A;  4OJB A;  3HC6 A;  2Z4J A;  4Q50 A;  1K74 D;  5C4S A;  1KNU A;  5DWE A;  2P7A A;  2PIQ A;  4ZJW A;  4OIV A;  4RUP A;  3VJT A;  1I7G A;  1XLS A;  1NDE A;  1PQ9 A;  2GTK A;  1T7F A;  3M7R A;  4MGA B;  4JL4 A;  4O8F A;  4S15 A;  5KCU A;  3RLL A;  5KRF A;  1LBD A;  1T65 A;  4M8E A;  2ZLA A;  3VTC A;  1XQ3 A;  3ILZ A;  1RJK A;  1H9U A;  3A9E B;  5APH A;  3Q95 A;  5DVC A;  3UUA A;  5KYJ A;  5DUG A;  4CI5 A;  5DXP A;  2OZ7 A;  2OCF A;  3FC6 A;  5A86 A;  4ZNT A;  5SYZ A;  3U9Q A;  2ZMH A;  1OVL B;  1PQ6 A;  1FCX A;  1NQ7 A;  2AWH A;  2GL8 A;  1ERE A;  4S14 A;  4OGH A;  2YAT A;  3V9V A;  4P6W A;  2PIX A;  2AX8 A;  5IAW A;  4HEE X;  2P15 A;  4RUO X;  5DVV A;  4OEY A;  5G45 A;  1UPV A;  3TY0 A;  2O4R A;  3FXV A;  2HB7 A;  2QH6 A;  3OLS A;  1YP0 A;  2VV1 B;  2JFA B;  2GWX A;  3KFC A;  5APJ A;  3VJI A;  4MG9 B;  3T03 A;  3W5R A;  3WFG A;  1K74 A;  4OZT E;  1T79 A;  3OMP A;  2Q1H A;  2AXA A;  5HJP A;  5E14 A;  4QJR A;  4NQA B;  2NXX E;  2Q70 A;  2AO6 A;  4XT9 A;  5GID A;  4G2H A;  1XP1 A;  1DKF A;  1T7R A;  2YJA B;  1S9Q A;  3AN3 A;  4K6I A;  4MG6 A;  4WVD A;  5DUE A;  3B3K A;  1VJB A;  1ERR A;  1XNX A;  3G0W A;  4J24 A;  3P0U A;  3K6P A;  4NIE A;  4MG7 B;  4IA7 A;  2ZK5 A;  2YLP A;  5HCV A;  3V3E A;  1XV9 A;  2Q7I A;  3AUR A;  5H1E A;  3GN8 A;  5FQP A;  1SKX A;  1PDU A;  2B1V A;  3B1M A;  2B50 A;  4WHG A;  4A4V A;  2W8Y A;  3K22 A;  4Q13 A;  3F7D A;  5KRC A;  4MGD B;  3VI8 A;  2QAB A;  2ZY0 A;  3A3Z X;  5E19 A;  2A3I A;  3DY6 A;  3PCU A;  1M7W A;  3B5R A;  3AUN A;  5DU5 A;  1I38 A;  4X1F A;  3A9E A;  4G1Z A;  4OZR E;  1YMT A;  3ET3 A;  3WTQ A;  1G1U A;  2GPU A;  3ET2 A;  1PQC A;  3VT9 A;  2B1Z A;  5DZH A;  5KRH A;  4OKX A;  3V3Q A;  1M13 A;  1T7M A;  3OKH A;  2GPO A;  2IHQ A;  5HZC A;  2AMA A;  2PIO A;  2XYX A;  3VT5 A;  1YA3 A;  4KZI A;  5KRK A;  3CLD A;  1ZDT A;  2Q7K A;  2ZK3 A;  3MNO A;  3F5C B;  3E00 A;  3AZ2 A;  3P88 A;  2VV2 A;  2ZFX A;  2VV1 A;  5DXE A;  3UUD A;  4MG9 A;  3UP0 A;  3ZQT A;  1I7I A;  3W0I A;  2Q1V A;  5E7V A;  3HZF A;  5L7G A;  1XVP B;  2PKL A;  2AA7 A;  2ZK2 A;  5KYA A;  1FCZ A;  4UDB A;  5DX3 B;  3RUU A;  4PVU A;  2HWQ A;  2PIN A;  2AB2 A;  3OLL A;  4OH5 A;  5AZV A;  4BCR A;  4DOR A;  3VN2 A;  3VT6 A;  4FHH A;  3AZ1 A;  1XAP A;  4J5W C;  4OZT U;  4R2U A;  5L7E A;  1T63 A;  2POB A;  4QE8 A;  4REF A;  4DK8 A;  3EYB A;  4Q0A C;  5DMF A;  5DKG A;  1I37 A;  2HFP A;  2Q8S A;  3OMQ A;  4OED A;  3UUA B;  5ICK A;  1NAX A;  3FC6 B;  3W0A A;  5L7H A;  3D57 A;  2QXM A;  2O9I A;  1A52 A;  2ZK6 A;  4ONI A;  3UP3 A;  3VSO A;  4MGD A;  1GWX A;  4K4J A;  4LSJ A;  3WT6 A;  2XYJ A;  5CJ6 A;  2P1U A;  3HC5 A;  3IA6 A;  4UDD A;  2P7Z A;  5IXK A;  2BJ4 B;  2QGW A;  4DK7 A;  1NAV A;  3HOD A;  4PLD A;  4FGY A;  3PRG A;  2ZBS A;  3AN4 A;  4OJ4 A;  4TV1 A;  4RUJ A;  3R8I A;  3WFF A;  4CI4 A;  2E2R A;  3B65 A;  4XI3 A;  5I4V A;  5DZI A;  4L96 A;  3OZ0 A;  4G21 A;  2R6W A;  2EWP A;  3KPZ A;  4LNX A;  4S0T A;  1YOK A;  3X31 A;  4XUM A;  2Q7J A;  1DKF B;  4IWC A;  1XZX X;  3A2I A;  1U3R A;  1PCG A;  4IA1 A;  3OS9 A;  2P7G A;  2ZNQ A;  3F5C A;  1ILG A;  1QKM A;  4OZR U;  4RMC A;  4YNK A;  5DV3 A;  4DQM A;  2J4A A;  3L0E A;  3IPS A;  5KD9 A;  4HLW A;  4G1Y A;  3FAL A;  1XV9 B;  5DXK A;  4OH6 A;  2AAX A;  3H0A A;  4IV2 A;  1NUO A;  5AWJ A;  5KCW A;  2G5O A;  5DX3 A;  2H79 A;  5F9B A;  5G3J A;  3KMZ A;  1SJ0 A;  5AAV B;  5FQR A;  4DMA A;  2QSE A;  1NYX A;  4NY9 A;  4WLB A;  3DCU A;  2O4J A;  1XLS E;  2Q6J A;  2FVJ A;  2ZL9 A;  4S0S A;  4ZO1 X;  3V49 A;  2ABI A;  5KCC A;  4PPS A;  1RK3 A;  3RVF A;  2OAX A;  3R29 A;  4JAZ A;  4X1G A;  4ZO1 B;  1NQ2 A;  2G0H A;  2P1T A;  5HJS A;  4IA2 A;  3FEJ A;  4QE6 A;  2VSR A;  2YJD A;  3FS1 A;  3B0Q A;  2FSZ A;  2ZKC A;  2Q5S A;  3OAP A;  3SZ1 A;  3OSA A;  4QM0 A;  2BJ4 A;  2PIT A;  2Q5G A;  5DKE A;  4OFU A;  1X7B A;  3JZC A;  4G2I A;  3UUD B;  3CTB A;  4OLM A;  2AX7 A;  3FUG A;  1LV2 A;  5DID A;  2AM9 A;  2VST A;  5AK2 A;  1XIU A;  1X7R A;  1T74 A;  4EMA A;  3VRV A;  5EHJ A;  4KZJ A;  1RKH A;  3OOK A;  4OKW A;  5DP0 A;  2QE4 A;  1BSX A;  2XYW A;  5G44 A;  5KRA A;  4TUZ B;  5DXQ A;  1TFC A;  2I0G A;  1UOM A;  4XUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...