3UUAA

Crystal structure of hera-lbd (y537s) in complex with bisphenol-af
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
244
structure length
241
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into bisphenols action provide guidelines for risk assessment and discovery of bisphenol A substitutes.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Hormone receptor
source organism Homo sapiens
total genus 87
structure length 241
sequence length 244
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3uuaA00
2QZOB 1ILHA 2P1TA 1HG4A 4L98A 4XAOA 5DXMA 4ZNVA 5F9BA 5DIDA 5FQRA 3ET1A 3W0HA 1PQ6A 4ITEA 3TKCA 3GBKA 4ZJWA 5DWEA 5DY8A 3TKMA 4KZJA 2QPYA 2VSRA 4Q0AC 4RMCA 5HJSA 3R8DA 3PO9A 4DOSA 1XP6A 3FS1A 4OH6A 3OOFA 2NPAA 1KV6A 1XV9A 1PRGA 1YP0A 4JAZA 4B7WA 4G2HA 2Z4JA 1R20D 2HC4A 1OSVA 3HZFA 3MNOA 5DXBB 4ZI1A 4WHFA 4IWCA 3OMMA 5HZCA 5IAWA 5AZVA 1L2JA 2QSEA 5HJPA 3OS9A 3VJSA 5AVLA 1WM0X 4X1FA 5E14A 4JL4A 5AAVA 2P7ZA 5DX3B 2VSTA 5E7VA 5FQVA 4E4QA 5DI7A 1I38A 1NQ7A 1OT7A 3NOAA 4A4VA 2G5OA 5APHA 2AA6A 3VRVA 3HVLA 2PIXA 4M8EA 4OZRU 3FURA 5SYZA 1XNXA 3ADSA 1A52A 2PKLA 3AFRA 3IPUA 4J24A 3VT3A 3X1HA 3HC5A 2QA6A 5KRLA 5DKBA 3CLDA 5DTVA 5DXRA 3ERTA 4G2IA 5L11A 3E00A 2ZMJA 1R1KA 5L7EA 1UOMA 4IUIA 4OEYA 5KCUA 3V3QA 3WT6A 4WQPA 3PLZA 4G1YA 4NIEA 1XB7A 3KMRA 2G0HA 2Q60A 2YLPA 5DV8A 3W0AA 2AYRA 5HCVA 1XP1A 4PF3A 4ZOMA 1T7FA 4EMAA 2NXXE 4MGBA 3DCUA 5DV6A 4OK1A 2VV0A 3VJTA 1PK5A 1PCGA 1DKFB 2P7AA 1G5YA 2P1VA 3HC6A 4HLWA 2Q6RA 1NYXA 2Q8SA 2YJDA 4K6IA 4L96A 5DXGA 2QW4A 5DWIA 2GIUA 3DZUA 3ZRAA 3ZRBA 3GZ9A 1ILGA 3DZYA 5DSHA 5G3JA 3K6PA 3W0YA 3ET0A 4NQAB 3L0JA 1NQ0A 4PVUA 4MG9B 3IXPD 3CDSA 1YINA 3FALB 1X7RA 3OSWA 1MZNA 5DVSA 2VV4A 2ACLA 5KRHA 4TV1B 3L1BA 2NW4A 1T7MA 2XHSA 5KROA 2FSZA 5DXPA 3JZCA 1X7EA 3W5RA 2GWXA 2OM9A 2Q5GA 3KDTA 1Y0SA 5EITA 4RZGA 5KCCA 5FQTA 3AURA 2GPUA 2HARA 2P54A 4IA3A 3D6DA 1R20A 5KCFA 4QJRA 3ILZA 2AWHA 4PXMA 3VRUA 5ETHA 1Z5XU 4MGCA 2Q7JA 4PWLA 1YA3A 4ZNHA 2XYWA 4IU7A 1EREA 2GPPA 3D24A 3VSPA 2QA8B 5K13A 1ZEOA 2JFAB 2VV1B 1HJ1A 1U9EA 2ZLAA 3FALA 4G1ZA 4R6SA 4CI4A 1EXAA 1QKNA 5DIEA 3B65A 2AX9A 1RDTA 4IW8A 5JJMA 3G8IA 1TFCA 4J5XA 1OSHA 2Q59B 4TV1A 5DRJA 3UP3A 1XLSE 4EM9A 4ZN9A 5DK9A 2G0GA 4K7AA 5ICKA 4OKXA 4OJBA 4MG5A 4PP3A 2QABA 2OAXA 3CS4A 4PRGA 1GS4A 4R2UA 3P8XA 1QKUA 3VRWA 3IPSA 3B68A 2QR9A 4JYIA 4APUA 1Q4XA 5G45A 5KYJA 3OLLA 4E2JA 2R6YA 3M7RA 3OKIA 5AYGA 5KRFA 3PRGA 4ZNSA 4IW6A 2QA8A 2QMVA 2Q7KA 2I0GA 2HBHA 3VT4A 1T76A 4J5XC 4QE6A 3W5PA 4O8FA 3HODA 5LGAA 5DZHA 3RUTA 2Q1HA 5KR9A 2B1ZA 4HEEX 2HASA 1R1KD 2Q61A 4RFWA 1GWXA 4UDBA 3T03A 1ZGYA 4OJ9A 1RKGA 2HB7A 3D5FA 3AUQA 3R5MA 3UVVA 3EYBA 2ZK0A 4XUMA 3E94A 5HYRA 4DM6A 1UPVA 3A2HA 1DB1A 2AAXA 3OLSA 2QXSA 2GL8A 2PINA 4OZTU 5DZIA 1M2ZA 1T7RA 2ZVTA 2QNVA 3AZ1A 1T63A 3OMOA 1I7IA 2Q7IA 2GTKA 3AZ3A 5AZTA 4RWVA 3VTBA 3PEQA 5DL4A 3X36A 5HJPB 3DZYD 1S9QA 3LBDA 5B5BA 1S0ZA 3ADUA 3AX8A 5AAVB 1BSXA 2V7CA 5JI0D 3L3XA 5KRCA 1XVPA 1Y0XX 1UHLA 3FC6A 4KZMA 4LBDA 3O1DA 2AX7A 3B1MA 3VHVA 1QKTA 5DIGA 5DKSA 4MG7A 3GWXA 3V49A 2FVJA 4RUOX 1M7WA 4MDDA 4ZO1X 3W5QA 1OVLA 4N5GA 1T73A 4IWFA 3CJWA 2HAMA 3RLJA 4DK7A 5DUHA 4XUHA 2J7XA 4A4WA 1YUCA 3G0WA 2POGA 4OGHA 3KFCA 4QE8A 4ZO1B 5DWJA 5DV3A 5E0XA 5GIEA 3RLLA 3VHUA 2EWPA 2ZNPA 3GYTA 2HB8A 5G43A 3ET3A 3VJIA 3OKHA 4OHAA 4MGBB 4NY9A 4OKWA 1ZAFA 4UDAA 1RDTD 1NQ2A 3V9YA 2IOKA 3R5NA 1RJKA 4DK8A 3WFFA 2HFPA 3OSIA 4MGAA 2GP7A 2PIOA 2REWA 4MG6A 5AK2A 3D57A 5E1CA 3UUAB 2YLYA 2IHQA 2VV2A 1ZH7A 2VV4B 2ACLB 3KBAA 3KYTA 1G1UA 3ADVA 4MGDA 1LBDA 3W0IA 2B50A 3F5CB 4XTAA 1G50A 2ZBSA 4RMDA 4RZEA 3TY0A 1XIUA 5APKA 1QKMA 2OUZA 5EGVA 1I7GA 1M13A 1Y9RA 3BEJA 3W0JA 3X1IA 2NXXA 2YFEA 2AMBA 5EJVA 3VT6A 2GPOA 3ERDA 4WPFA 4POJA 1PZLA 1A28A 1P8DA 2OVHA 3OMQA 3WMHA 1T7TA 3KPZA 4OLMA 5DYDA 5DZ3A 5APJA 5CJ6A 2AM9A 2ZL9A 2Q70A 3SP6A 3WWRA 4DMAA 3UP0A 5DRMA 1XPCA 4OEZA 3UUAA 2P1UA 5JJMB 2PIPL 3WT5A 3IPQA 3F5CA 4IS8A 2PIVA 2ZASA 1YYEA 1FD0A 3VJHA 1GWQA 1PQ9A 2QTUA 1FM9A 2VV3A 2HVCA 2B23A 3HM1A 2R40D 3KMZA 4OILA 5GICA 3A9EB 3F7DA 1H9UA 3DZUD 2JF9A 2BJ4A 2HCDA 1T79A 1K74A 2YJAB 4Q13A 4XHDA 5DZ1A 4OFRA 5DMCA 5DVCA 3JZBA 4REEA 3BC5A 3ADTA 1XDKA 3E7CA 3X31A 5C4OA 2NV7A 4ZNWA 2ZK3A 4IV4A 4QM0A 3OGTA 5ACCA 1X76A 1P93A 2I4JA 5E19A 4YT1A 2F4BA 1U3SA 1G2NA 3GD2A 5DWLA 5E0WA 2J14A 2I0JA 2OCFA 2PITA 4MG8A 1XLSA 4XI3A 3B5RA 3W0GA 2QH6A 2ZKCA 3A9EA 1L2IA 3K23A 5DYBA 1XAPA 3AUNA 4FHHA 3V9TA 2B1VA 2Z4BA 3UVVB 4TUZA 2AXAA 3B0WA 4WLBA 2AMAA 4RUPA 4S0TA 1NUOA 4M8HA 3V9VA 1N4HA 2Q3YA 4OEAA 3WTQA 1SJ0A 1ZDUA 3L0LA 2ABIA 2PRGA 2IOGA 2Q6SA 3MNEA 3OLFA 1YY4A 4OARA 3R29A 5G42A 5L7HA 4S15A 1NAXA 2Q1VA 1YOWA 3ADWA 1ZKYA 1Z95A 4OZRE 1XVPB 3FC6B 1UHLB 3CTBA 4CI5A 4PPSA 5G46A 3K22A 3B0QA 3VT7A 1FCXA 5EI1A 4FNEA 2ATHA 4MG7B 4PP5A 2H79A 4N73A 2PIRA 4P6XA 4S0SA 3VTCA 1OVLB 2E2RA 2R6WA 2YHDA 4OC7A 1K4WA 3VT8A 1GWRA 5KCEA 2POBA 1YOKA 2R40A 3GYUA 3B3KA 3OSAA 5KCWA 1XJ7A 5GT4A 2PIQA 5DXQA 4OIVA 1MVCA 1KNUA 2J7YA 3HO0A 3CQVA 3RVFA 4DQMA 5DKEA 2XKWA 3DT3A 3SZ1A 3HQ5A 3VTDA 4ITFA 1R5KA 3GN8A 1NHZA 2ZK6A 3UU7A 2XYXA 4MGAB 1FM9D 4J5WA 2QGWA 1S0XA 5KRMA 3R2AA 4NUFA 2P15A 3NSPA 3LMPA 2ZNOA 1K74D 2G44A 5E15A 2ZXZA 3OS8A 4ZNUA 3O1EA 5C4UA 4MGDB 3AN3A 1N83A 2HWQA 5AWJA 3NSQA 2PIUA 4Q50A 3P88A 3P0UA 1PQCA 4NB6A 3V3EA 3H52A 3VRTA 5KCDA 3CS6A 3KDUA 5DWGA 4F9MA 4ZJRA 1E3KA 1Z5XE 3B67A 1YIMA 2QXMA 2PJLA 1SR7A 5M96A 5IXKA 3WFGA 4FHIA 3RY9A 3WJ4A 2BAWA 1ZUCA 1FM6A 2I4PA 4OKBA 4J5WC 2OZ7A 5DVVA 5DUEA 4A2JA 5DLRA 5G44A 5FQPA 3L3ZA 1XOWA 3OS8C 4IQRA 1TXIA 4LTWA 1EXXA 2ZXMA 3BQDA 2I4ZA 4JYHA 2ZK5A 4REFA 3VHWA 2W8YA 2QZOA 2HWRA 3DY6A 1XQ3A 4IVWA 3B66A 2AB2A 3A78A 4XT9A 1T65A 5DP0A 4LNWA 2O4RA 3DR1A 5C4TA 4FGYA 5DMFA 2BJ4B 3Q95B 4OKTA 4YMQA 3R8AA 2PIWA 2AA2A 2QE4A 3VI8A 4G1DA 2YATA 2JJ3A 1XDKB 3FLIA 4YPQA 1T74A 5DXEA 1S19A 2H77A 2YLQA 3L0EA 3N00A 3U9QA 3P89A 5DXBA 3OZ0A 1NDEA 2AA7A 1SQNA 3HLVA 4QL8A 3FEJA 5H1EA 3FUGA 1NAVA 4YNKA 1U3RA 4MG8B 2ZMHA 3CWDA 5DX3A 1VJBA 1FBYA 3FEIA 4Y29A 4OH5A 1MV9A 4DM8A 3A40X 3Q95A 1FCYA 1KKQA 4RAKA 4OZTE 4K4JA 5KRAA 4PP6A 1LV2A 4TUZB 3V4AA 2PNUA 3G9EA 5AVIA 4E4KA 2P4YA 5EC9A 3ZR7A 3WGPA 1XNNA 2LBDA 1T5ZA 3R8IA 2AX6A 1XP9A 3H0AD 4OEDA 1ERRA 5IZ0A 2ZK1A 2O4JA 4PPPA 2ZXNA 3IMYA 4WVDA 5GIDA 5A86A 4CSJA 4JGVA 4R06A 1FCZA 3IA6A 5AAUA 3ET2A 3QT0A 5L7GA 4WHGA 3UUDB 4IA7A 4G20A 4POHA 5LWPA 1DKFA 5DXKA 3ZQTA 4DORA 5KRIA 2ZK2A 2YLOA 2ZMIA 3A2JA 1SKXA 5JY3A 5KRJA 5B41A 5HYKA 3PBAA 4IA2A 1X7JA 4OJ4A 4UDCA 5I4VA 2Q6JA 5KRKA 3L03A 3CS8A 5KD9A 4MG9A 3B0TA 3VN2A 3S9SA 1IE8A 1YMTA 4IVYA 2ZK4A 5EHJA 3PCUA 1XZXX 4KZIA 1FM6D 1NRLA 2Q7LA 1PDUA 2OVMA 2ZY0A 3FXVA 4S14A 5C4SA 5KYAA 2FAIA 3DCTA 3VT9A 4ZN7A 4ONIA 1N46A 4RMEA 3OMPA 1U3QA 4N1YA 4P6WA 3UUDA 2GPVA 4QK4A 1E3GA 3VSOA 1UPWA 2ZLCA 3MNPA 4N8RA 2XYJA 1X78A 3A3ZX 3GWSX 4XLDA 5DUGA 3VT5A 3AN4A 4PLDA 2Q5SA 1YJEA 4PLEA 2AX8A 1R6GA 3UU7B 5KCTA 3OAPA 5DZ0A 5G5WA 3ADXA 2ZFXA 4IA1A 1S9PA 1I37A 2JFAA 2VV1A 4LNXA 4OIUA 4ZNTA 3TX7B 1RKHA 5DU5A 1ZDTA 4RZFA 2J4AA 2QGTA 2Q59A 2V0VA 4BCRA 3SP9A 3KWYA 3E00D 3W0CA 1X7BA 2Q5PA 3UUCA 4G21A 3W5TA 2ZNQA 1RK3A 1NQ1A 4FN9A 4RE8A 3WT7A 3RUUA 3AZ2A 3IXPA 5AWKA 3OZJA 2ZNNA 4IV2A 4J26A 3D90A 2O9IA 3H0AA 4UDDA 5FQSA 2A3IA 2AA5A 4LSJA 4RUJA 2P7GA 3OOKA 4OFUA 3B0RA 3WJ5A 1XV9B 4JYGA 1K7LA 3A2IA 3OMKA 3K8SA 5DKGA 3CDPA 3KMGA 1IE9A 4X1GA 1XQCA 3G8OA 2AO6A
chains in the Genus database with same CATH superfamily
2QZOB 1ILHA 2P1TA 1HG4A 4L98A 4XAOA 5DXMA 4ZNVA 5F9BA 5DIDA 5FQRA 3ET1A 3W0HA 1PQ6A 4ITEA 3TKCA 3GBKA 4ZJWA 5DWEA 5DY8A 3TKMA 4KZJA 2QPYA 2VSRA 4Q0AC 4RMCA 5HJSA 3R8DA 3PO9A 4DOSA 1XP6A 3FS1A 4OH6A 3OOFA 2NPAA 1KV6A 1XV9A 1PRGA 1YP0A 4JAZA 4B7WA 4G2HA 2Z4JA 1R20D 2HC4A 1OSVA 3HZFA 3MNOA 5DXBB 4ZI1A 4WHFA 4IWCA 3OMMA 5HZCA 5IAWA 5AZVA 1L2JA 2QSEA 5HJPA 3OS9A 3VJSA 5AVLA 1WM0X 4X1FA 5E14A 4JL4A 5AAVA 2P7ZA 5DX3B 2VSTA 5E7VA 5FQVA 4E4QA 5DI7A 1I38A 1NQ7A 1OT7A 3NOAA 4A4VA 2G5OA 5APHA 2AA6A 3VRVA 3HVLA 2PIXA 4M8EA 4OZRU 3FURA 5SYZA 1XNXA 3ADSA 1A52A 2PKLA 3AFRA 3IPUA 4J24A 3VT3A 3X1HA 3HC5A 2QA6A 5KRLA 5DKBA 3CLDA 5DTVA 5DXRA 3ERTA 4G2IA 5L11A 3E00A 2ZMJA 1R1KA 5L7EA 1UOMA 4IUIA 4OEYA 5KCUA 3V3QA 3WT6A 4WQPA 3PLZA 4G1YA 4NIEA 1XB7A 3KMRA 2G0HA 2Q60A 2YLPA 5DV8A 3W0AA 2AYRA 5HCVA 1XP1A 4PF3A 4ZOMA 1T7FA 4EMAA 2NXXE 4MGBA 3DCUA 5DV6A 4OK1A 2VV0A 3VJTA 1PK5A 1PCGA 1DKFB 2P7AA 1G5YA 2P1VA 3HC6A 4HLWA 2Q6RA 1NYXA 2Q8SA 2YJDA 4K6IA 4L96A 5DXGA 2QW4A 5DWIA 2GIUA 3DZUA 3ZRAA 3ZRBA 3GZ9A 1ILGA 3DZYA 5DSHA 5G3JA 3K6PA 3W0YA 3ET0A 4NQAB 3L0JA 1NQ0A 4PVUA 4MG9B 3IXPD 3CDSA 1YINA 3FALB 1X7RA 3OSWA 1MZNA 5DVSA 2VV4A 2ACLA 5KRHA 4TV1B 3L1BA 2NW4A 1T7MA 2XHSA 5KROA 2FSZA 5DXPA 3JZCA 1X7EA 3W5RA 2GWXA 2OM9A 2Q5GA 3KDTA 1Y0SA 5EITA 4RZGA 5KCCA 5FQTA 3AURA 2GPUA 2HARA 2P54A 4IA3A 3D6DA 1R20A 5KCFA 4QJRA 3ILZA 2AWHA 4PXMA 3VRUA 5ETHA 1Z5XU 4MGCA 2Q7JA 4PWLA 1YA3A 4ZNHA 2XYWA 4IU7A 1EREA 2GPPA 3D24A 3VSPA 2QA8B 5K13A 1ZEOA 2JFAB 2VV1B 1HJ1A 1U9EA 2ZLAA 3FALA 4G1ZA 4R6SA 4CI4A 1EXAA 1QKNA 5DIEA 3B65A 2AX9A 1RDTA 4IW8A 5JJMA 3G8IA 1TFCA 4J5XA 1OSHA 2Q59B 4TV1A 5DRJA 3UP3A 1XLSE 4EM9A 4ZN9A 5DK9A 2G0GA 4K7AA 5ICKA 4OKXA 4OJBA 4MG5A 4PP3A 2QABA 2OAXA 3CS4A 4PRGA 1GS4A 4R2UA 3P8XA 1QKUA 3VRWA 3IPSA 3B68A 2QR9A 4JYIA 4APUA 1Q4XA 5G45A 5KYJA 3OLLA 4E2JA 2R6YA 3M7RA 3OKIA 5AYGA 5KRFA 3PRGA 4ZNSA 4IW6A 2QA8A 2QMVA 2Q7KA 2I0GA 2HBHA 3VT4A 1T76A 4J5XC 4QE6A 3W5PA 4O8FA 3HODA 5LGAA 5DZHA 3RUTA 2Q1HA 5KR9A 2B1ZA 4HEEX 2HASA 1R1KD 2Q61A 4RFWA 1GWXA 4UDBA 3T03A 1ZGYA 4OJ9A 1RKGA 2HB7A 3D5FA 3AUQA 3R5MA 3UVVA 3EYBA 2ZK0A 4XUMA 3E94A 5HYRA 4DM6A 1UPVA 3A2HA 1DB1A 2AAXA 3OLSA 2QXSA 2GL8A 2PINA 4OZTU 5DZIA 1M2ZA 1T7RA 2ZVTA 2QNVA 3AZ1A 1T63A 3OMOA 1I7IA 2Q7IA 2GTKA 3AZ3A 5AZTA 4RWVA 3VTBA 3PEQA 5DL4A 3X36A 5HJPB 3DZYD 1S9QA 3LBDA 5B5BA 1S0ZA 3ADUA 3AX8A 5AAVB 1BSXA 2V7CA 5JI0D 3L3XA 5KRCA 1XVPA 1Y0XX 1UHLA 3FC6A 4KZMA 4LBDA 3O1DA 2AX7A 3B1MA 3VHVA 1QKTA 5DIGA 5DKSA 4MG7A 3GWXA 3V49A 2FVJA 4RUOX 1M7WA 4MDDA 4ZO1X 3W5QA 1OVLA 4N5GA 1T73A 4IWFA 3CJWA 2HAMA 3RLJA 4DK7A 5DUHA 4XUHA 2J7XA 4A4WA 1YUCA 3G0WA 2POGA 4OGHA 3KFCA 4QE8A 4ZO1B 5DWJA 5DV3A 5E0XA 5GIEA 3RLLA 3VHUA 2EWPA 2ZNPA 3GYTA 2HB8A 5G43A 3ET3A 3VJIA 3OKHA 4OHAA 4MGBB 4NY9A 4OKWA 1ZAFA 4UDAA 1RDTD 1NQ2A 3V9YA 2IOKA 3R5NA 1RJKA 4DK8A 3WFFA 2HFPA 3OSIA 4MGAA 2GP7A 2PIOA 2REWA 4MG6A 5AK2A 3D57A 5E1CA 3UUAB 2YLYA 2IHQA 2VV2A 1ZH7A 2VV4B 2ACLB 3KBAA 3KYTA 1G1UA 3ADVA 4MGDA 1LBDA 3W0IA 2B50A 3F5CB 4XTAA 1G50A 2ZBSA 4RMDA 4RZEA 3TY0A 1XIUA 5APKA 1QKMA 2OUZA 5EGVA 1I7GA 1M13A 1Y9RA 3BEJA 3W0JA 3X1IA 2NXXA 2YFEA 2AMBA 5EJVA 3VT6A 2GPOA 3ERDA 4WPFA 4POJA 1PZLA 1A28A 1P8DA 2OVHA 3OMQA 3WMHA 1T7TA 3KPZA 4OLMA 5DYDA 5DZ3A 5APJA 5CJ6A 2AM9A 2ZL9A 2Q70A 3SP6A 3WWRA 4DMAA 3UP0A 5DRMA 1XPCA 4OEZA 3UUAA 2P1UA 5JJMB 2PIPL 3WT5A 3IPQA 3F5CA 4IS8A 2PIVA 2ZASA 1YYEA 1FD0A 3VJHA 1GWQA 1PQ9A 2QTUA 1FM9A 2VV3A 2HVCA 2B23A 3HM1A 2R40D 3KMZA 4OILA 5GICA 3A9EB 3F7DA 1H9UA 3DZUD 2JF9A 2BJ4A 2HCDA 1T79A 1K74A 2YJAB 4Q13A 4XHDA 5DZ1A 4OFRA 5DMCA 5DVCA 3JZBA 4REEA 3BC5A 3ADTA 1XDKA 3E7CA 3X31A 5C4OA 2NV7A 4ZNWA 2ZK3A 4IV4A 4QM0A 3OGTA 5ACCA 1X76A 1P93A 2I4JA 5E19A 4YT1A 2F4BA 1U3SA 1G2NA 3GD2A 5DWLA 5E0WA 2J14A 2I0JA 2OCFA 2PITA 4MG8A 1XLSA 4XI3A 3B5RA 3W0GA 2QH6A 2ZKCA 3A9EA 1L2IA 3K23A 5DYBA 1XAPA 3AUNA 4FHHA 3V9TA 2B1VA 2Z4BA 3UVVB 4TUZA 2AXAA 3B0WA 4WLBA 2AMAA 4RUPA 4S0TA 1NUOA 4M8HA 3V9VA 1N4HA 2Q3YA 4OEAA 3WTQA 1SJ0A 1ZDUA 3L0LA 2ABIA 2PRGA 2IOGA 2Q6SA 3MNEA 3OLFA 1YY4A 4OARA 3R29A 5G42A 5L7HA 4S15A 1NAXA 2Q1VA 1YOWA 3ADWA 1ZKYA 1Z95A 4OZRE 1XVPB 3FC6B 1UHLB 3CTBA 4CI5A 4PPSA 5G46A 3K22A 3B0QA 3VT7A 1FCXA 5EI1A 4FNEA 2ATHA 4MG7B 4PP5A 2H79A 4N73A 2PIRA 4P6XA 4S0SA 3VTCA 1OVLB 2E2RA 2R6WA 2YHDA 4OC7A 1K4WA 3VT8A 1GWRA 5KCEA 2POBA 1YOKA 2R40A 3GYUA 3B3KA 3OSAA 5KCWA 1XJ7A 5GT4A 2PIQA 5DXQA 4OIVA 1MVCA 1KNUA 2J7YA 3HO0A 3CQVA 3RVFA 4DQMA 5DKEA 2XKWA 3DT3A 3SZ1A 3HQ5A 3VTDA 4ITFA 1R5KA 3GN8A 1NHZA 2ZK6A 3UU7A 2XYXA 4MGAB 1FM9D 4J5WA 2QGWA 1S0XA 5KRMA 3R2AA 4NUFA 2P15A 3NSPA 3LMPA 2ZNOA 1K74D 2G44A 5E15A 2ZXZA 3OS8A 4ZNUA 3O1EA 5C4UA 4MGDB 3AN3A 1N83A 2HWQA 5AWJA 3NSQA 2PIUA 4Q50A 3P88A 3P0UA 1PQCA 4NB6A 3V3EA 3H52A 3VRTA 5KCDA 3CS6A 3KDUA 5DWGA 4F9MA 4ZJRA 1E3KA 1Z5XE 3B67A 1YIMA 2QXMA 2PJLA 1SR7A 5M96A 5IXKA 3WFGA 4FHIA 3RY9A 3WJ4A 2BAWA 1ZUCA 1FM6A 2I4PA 4OKBA 4J5WC 2OZ7A 5DVVA 5DUEA 4A2JA 5DLRA 5G44A 5FQPA 3L3ZA 1XOWA 3OS8C 4IQRA 1TXIA 4LTWA 1EXXA 2ZXMA 3BQDA 2I4ZA 4JYHA 2ZK5A 4REFA 3VHWA 2W8YA 2QZOA 2HWRA 3DY6A 1XQ3A 4IVWA 3B66A 2AB2A 3A78A 4XT9A 1T65A 5DP0A 4LNWA 2O4RA 3DR1A 5C4TA 4FGYA 5DMFA 2BJ4B 3Q95B 4OKTA 4YMQA 3R8AA 2PIWA 2AA2A 2QE4A 3VI8A 4G1DA 2YATA 2JJ3A 1XDKB 3FLIA 4YPQA 1T74A 5DXEA 1S19A 2H77A 2YLQA 3L0EA 3N00A 3U9QA 3P89A 5DXBA 3OZ0A 1NDEA 2AA7A 1SQNA 3HLVA 4QL8A 3FEJA 5H1EA 3FUGA 1NAVA 4YNKA 1U3RA 4MG8B 2ZMHA 3CWDA 5DX3A 1VJBA 1FBYA 3FEIA 4Y29A 4OH5A 1MV9A 4DM8A 3A40X 3Q95A 1FCYA 1KKQA 4RAKA 4OZTE 4K4JA 5KRAA 4PP6A 1LV2A 4TUZB 3V4AA 2PNUA 3G9EA 5AVIA 4E4KA 2P4YA 5EC9A 3ZR7A 3WGPA 1XNNA 2LBDA 1T5ZA 3R8IA 2AX6A 1XP9A 3H0AD 4OEDA 1ERRA 5IZ0A 2ZK1A 2O4JA 4PPPA 2ZXNA 3IMYA 4WVDA 5GIDA 5A86A 4CSJA 4JGVA 4R06A 1FCZA 3IA6A 5AAUA 3ET2A 3QT0A 5L7GA 4WHGA 3UUDB 4IA7A 4G20A 4POHA 5LWPA 1DKFA 5DXKA 3ZQTA 4DORA 5KRIA 2ZK2A 2YLOA 2ZMIA 3A2JA 1SKXA 5JY3A 5KRJA 5B41A 5HYKA 3PBAA 4IA2A 1X7JA 4OJ4A 4UDCA 5I4VA 2Q6JA 5KRKA 3L03A 3CS8A 5KD9A 4MG9A 3B0TA 3VN2A 3S9SA 1IE8A 1YMTA 4IVYA 2ZK4A 5EHJA 3PCUA 1XZXX 4KZIA 1FM6D 1NRLA 2Q7LA 1PDUA 2OVMA 2ZY0A 3FXVA 4S14A 5C4SA 5KYAA 2FAIA 3DCTA 3VT9A 4ZN7A 4ONIA 1N46A 4RMEA 3OMPA 1U3QA 4N1YA 4P6WA 3UUDA 2GPVA 4QK4A 1E3GA 3VSOA 1UPWA 2ZLCA 3MNPA 4N8RA 2XYJA 1X78A 3A3ZX 3GWSX 4XLDA 5DUGA 3VT5A 3AN4A 4PLDA 2Q5SA 1YJEA 4PLEA 2AX8A 1R6GA 3UU7B 5KCTA 3OAPA 5DZ0A 5G5WA 3ADXA 2ZFXA 4IA1A 1S9PA 1I37A 2JFAA 2VV1A 4LNXA 4OIUA 4ZNTA 3TX7B 1RKHA 5DU5A 1ZDTA 4RZFA 2J4AA 2QGTA 2Q59A 2V0VA 4BCRA 3SP9A 3KWYA 3E00D 3W0CA 1X7BA 2Q5PA 3UUCA 4G21A 3W5TA 2ZNQA 1RK3A 1NQ1A 4FN9A 4RE8A 3WT7A 3RUUA 3AZ2A 3IXPA 5AWKA 3OZJA 2ZNNA 4IV2A 4J26A 3D90A 2O9IA 3H0AA 4UDDA 5FQSA 2A3IA 2AA5A 4LSJA 4RUJA 2P7GA 3OOKA 4OFUA 3B0RA 3WJ5A 1XV9B 4JYGA 1K7LA 3A2IA 3OMKA 3K8SA 5DKGA 3CDPA 3KMGA 1IE9A 4X1GA 1XQCA 3G8OA 2AO6A
chains in the Genus database with same CATH topology
2QZOB 1ILHA 2P1TA 1HG4A 4L98A 4XAOA 5DXMA 4ZNVA 5F9BA 5DIDA 5FQRA 3ET1A 3W0HA 1PQ6A 4ITEA 3TKCA 3GBKA 4ZJWA 5DWEA 5DY8A 3TKMA 4KZJA 2QPYA 2VSRA 4Q0AC 4RMCA 5HJSA 3R8DA 3PO9A 4DOSA 1XP6A 3FS1A 4OH6A 3OOFA 2NPAA 1KV6A 1XV9A 1PRGA 1YP0A 4JAZA 4B7WA 4G2HA 2Z4JA 1R20D 2HC4A 1OSVA 3HZFA 3MNOA 5DXBB 4ZI1A 4WHFA 4IWCA 3OMMA 5HZCA 5IAWA 5AZVA 1L2JA 2QSEA 5HJPA 3OS9A 3VJSA 5AVLA 1WM0X 4X1FA 5E14A 4JL4A 5AAVA 2P7ZA 5DX3B 2VSTA 5E7VA 5FQVA 4E4QA 5DI7A 1I38A 1NQ7A 1OT7A 3NOAA 4A4VA 2G5OA 5APHA 2AA6A 3VRVA 3HVLA 2PIXA 4M8EA 4OZRU 3FURA 5SYZA 1XNXA 3ADSA 1A52A 2PKLA 3AFRA 3IPUA 4J24A 3VT3A 3X1HA 3HC5A 2QA6A 5KRLA 5DKBA 3CLDA 5DTVA 5DXRA 3ERTA 4G2IA 5L11A 3E00A 2ZMJA 1R1KA 5L7EA 1UOMA 4IUIA 4OEYA 5KCUA 3V3QA 3WT6A 4WQPA 3PLZA 4G1YA 4NIEA 1XB7A 3KMRA 2G0HA 2Q60A 2YLPA 5DV8A 3W0AA 2AYRA 5HCVA 1XP1A 4PF3A 4ZOMA 1T7FA 4EMAA 2NXXE 4MGBA 3DCUA 5DV6A 4OK1A 2VV0A 3VJTA 1PK5A 1PCGA 1DKFB 2P7AA 1G5YA 2P1VA 3HC6A 4HLWA 2Q6RA 1NYXA 2Q8SA 2YJDA 4K6IA 4L96A 5DXGA 2QW4A 5DWIA 2GIUA 3DZUA 3ZRAA 3ZRBA 3GZ9A 1ILGA 3DZYA 5DSHA 5G3JA 3K6PA 3W0YA 3ET0A 4NQAB 3L0JA 1NQ0A 4PVUA 4MG9B 3IXPD 3CDSA 1YINA 3FALB 1X7RA 3OSWA 1MZNA 5DVSA 2VV4A 2ACLA 5KRHA 4TV1B 3L1BA 2NW4A 1T7MA 2XHSA 5KROA 2FSZA 5DXPA 3JZCA 1X7EA 3W5RA 2GWXA 2OM9A 2Q5GA 3KDTA 1Y0SA 5EITA 4RZGA 5KCCA 5FQTA 3AURA 2GPUA 2HARA 2P54A 4IA3A 3D6DA 1R20A 5KCFA 4QJRA 3ILZA 2AWHA 4PXMA 3VRUA 5ETHA 1Z5XU 4MGCA 2Q7JA 4PWLA 1YA3A 4ZNHA 2XYWA 4IU7A 1EREA 2GPPA 3D24A 3VSPA 2QA8B 5K13A 1ZEOA 2JFAB 2VV1B 1HJ1A 1U9EA 2ZLAA 3FALA 4G1ZA 4R6SA 4CI4A 1EXAA 1QKNA 5DIEA 3B65A 2AX9A 1RDTA 4IW8A 5JJMA 3G8IA 1TFCA 4J5XA 1OSHA 2Q59B 4TV1A 5DRJA 3UP3A 1XLSE 4EM9A 4ZN9A 5DK9A 2G0GA 4K7AA 5ICKA 4OKXA 4OJBA 4MG5A 4PP3A 2QABA 2OAXA 3CS4A 4PRGA 1GS4A 4R2UA 3P8XA 1QKUA 3VRWA 3IPSA 3B68A 2QR9A 4JYIA 4APUA 1Q4XA 5G45A 5KYJA 3OLLA 4E2JA 2R6YA 3M7RA 3OKIA 5AYGA 5KRFA 3PRGA 4ZNSA 4IW6A 2QA8A 2QMVA 2Q7KA 2I0GA 2HBHA 3VT4A 1T76A 4J5XC 4QE6A 3W5PA 4O8FA 3HODA 5LGAA 5DZHA 3RUTA 2Q1HA 5KR9A 2B1ZA 4HEEX 2HASA 1R1KD 2Q61A 4RFWA 1GWXA 4UDBA 3T03A 1ZGYA 4OJ9A 1RKGA 2HB7A 3D5FA 3AUQA 3R5MA 3UVVA 3EYBA 2ZK0A 4XUMA 3E94A 5HYRA 4DM6A 1UPVA 3A2HA 1DB1A 2AAXA 3OLSA 2QXSA 2GL8A 2PINA 4OZTU 5DZIA 1M2ZA 1T7RA 2ZVTA 2QNVA 3AZ1A 1T63A 3OMOA 1I7IA 2Q7IA 2GTKA 3AZ3A 5AZTA 4RWVA 3VTBA 3PEQA 5DL4A 3X36A 5HJPB 3DZYD 1S9QA 3LBDA 5B5BA 1S0ZA 3ADUA 3AX8A 5AAVB 1BSXA 2V7CA 5JI0D 3L3XA 5KRCA 1XVPA 1Y0XX 1UHLA 3FC6A 4KZMA 4LBDA 3O1DA 2AX7A 3B1MA 3VHVA 1QKTA 5DIGA 5DKSA 4MG7A 3GWXA 3V49A 2FVJA 4RUOX 1M7WA 4MDDA 4ZO1X 3W5QA 1OVLA 4N5GA 1T73A 4IWFA 3CJWA 2HAMA 3RLJA 4DK7A 5DUHA 4XUHA 2J7XA 4A4WA 1YUCA 3G0WA 2POGA 4OGHA 3KFCA 4QE8A 4ZO1B 5DWJA 5DV3A 5E0XA 5GIEA 3RLLA 3VHUA 2EWPA 2ZNPA 3GYTA 2HB8A 5G43A 3ET3A 3VJIA 3OKHA 4OHAA 4MGBB 4NY9A 4OKWA 1ZAFA 4UDAA 1RDTD 1NQ2A 3V9YA 2IOKA 3R5NA 1RJKA 4DK8A 3WFFA 2HFPA 3OSIA 4MGAA 2GP7A 2PIOA 2REWA 4MG6A 5AK2A 3D57A 5E1CA 3UUAB 2YLYA 2IHQA 2VV2A 1ZH7A 2VV4B 2ACLB 3KBAA 3KYTA 1G1UA 3ADVA 4MGDA 1LBDA 3W0IA 2B50A 3F5CB 4XTAA 1G50A 2ZBSA 4RMDA 4RZEA 3TY0A 1XIUA 5APKA 1QKMA 2OUZA 5EGVA 1I7GA 1M13A 1Y9RA 3BEJA 3W0JA 3X1IA 2NXXA 2YFEA 2AMBA 5EJVA 3VT6A 2GPOA 3ERDA 4WPFA 4POJA 1PZLA 1A28A 1P8DA 2OVHA 3OMQA 3WMHA 1T7TA 3KPZA 4OLMA 5DYDA 5DZ3A 5APJA 5CJ6A 2AM9A 2ZL9A 2Q70A 3SP6A 3WWRA 4DMAA 3UP0A 5DRMA 1XPCA 4OEZA 3UUAA 2P1UA 5JJMB 2PIPL 3WT5A 3IPQA 3F5CA 4IS8A 2PIVA 2ZASA 1YYEA 1FD0A 3VJHA 1GWQA 1PQ9A 2QTUA 1FM9A 2VV3A 2HVCA 2B23A 3HM1A 2R40D 3KMZA 4OILA 5GICA 3A9EB 3F7DA 1H9UA 3DZUD 2JF9A 2BJ4A 2HCDA 1T79A 1K74A 2YJAB 4Q13A 4XHDA 5DZ1A 4OFRA 5DMCA 5DVCA 3JZBA 4REEA 3BC5A 3ADTA 1XDKA 3E7CA 3X31A 5C4OA 2NV7A 4ZNWA 2ZK3A 4IV4A 4QM0A 3OGTA 5ACCA 1X76A 1P93A 2I4JA 5E19A 4YT1A 2F4BA 1U3SA 1G2NA 3GD2A 5DWLA 5E0WA 2J14A 2I0JA 2OCFA 2PITA 4MG8A 1XLSA 4XI3A 3B5RA 3W0GA 2QH6A 2ZKCA 3A9EA 1L2IA 3K23A 5DYBA 1XAPA 3AUNA 4FHHA 3V9TA 2B1VA 2Z4BA 3UVVB 4TUZA 2AXAA 3B0WA 4WLBA 2AMAA 4RUPA 4S0TA 1NUOA 4M8HA 3V9VA 1N4HA 2Q3YA 4OEAA 3WTQA 1SJ0A 1ZDUA 3L0LA 2ABIA 2PRGA 2IOGA 2Q6SA 3MNEA 3OLFA 1YY4A 4OARA 3R29A 5G42A 5L7HA 4S15A 1NAXA 2Q1VA 1YOWA 3ADWA 1ZKYA 1Z95A 4OZRE 1XVPB 3FC6B 1UHLB 3CTBA 4CI5A 4PPSA 5G46A 3K22A 3B0QA 3VT7A 1FCXA 5EI1A 4FNEA 2ATHA 4MG7B 4PP5A 2H79A 4N73A 2PIRA 4P6XA 4S0SA 3VTCA 1OVLB 2E2RA 2R6WA 2YHDA 4OC7A 1K4WA 3VT8A 1GWRA 5KCEA 2POBA 1YOKA 2R40A 3GYUA 3B3KA 3OSAA 5KCWA 1XJ7A 5GT4A 2PIQA 5DXQA 4OIVA 1MVCA 1KNUA 2J7YA 3HO0A 3CQVA 3RVFA 4DQMA 5DKEA 2XKWA 3DT3A 3SZ1A 3HQ5A 3VTDA 4ITFA 1R5KA 3GN8A 1NHZA 2ZK6A 3UU7A 2XYXA 4MGAB 1FM9D 4J5WA 2QGWA 1S0XA 5KRMA 3R2AA 4NUFA 2P15A 3NSPA 3LMPA 2ZNOA 1K74D 2G44A 5E15A 2ZXZA 3OS8A 4ZNUA 3O1EA 5C4UA 4MGDB 3AN3A 1N83A 2HWQA 5AWJA 3NSQA 2PIUA 4Q50A 3P88A 3P0UA 1PQCA 4NB6A 3V3EA 3H52A 3VRTA 5KCDA 3CS6A 3KDUA 5DWGA 4F9MA 4ZJRA 1E3KA 1Z5XE 3B67A 1YIMA 2QXMA 2PJLA 1SR7A 5M96A 5IXKA 3WFGA 4FHIA 3RY9A 3WJ4A 2BAWA 1ZUCA 1FM6A 2I4PA 4OKBA 4J5WC 2OZ7A 5DVVA 5DUEA 4A2JA 5DLRA 5G44A 5FQPA 3L3ZA 1XOWA 3OS8C 4IQRA 1TXIA 4LTWA 1EXXA 2ZXMA 3BQDA 2I4ZA 4JYHA 2ZK5A 4REFA 3VHWA 2W8YA 2QZOA 2HWRA 3DY6A 1XQ3A 4IVWA 3B66A 2AB2A 3A78A 4XT9A 1T65A 5DP0A 4LNWA 2O4RA 3DR1A 5C4TA 4FGYA 5DMFA 2BJ4B 3Q95B 4OKTA 4YMQA 3R8AA 2PIWA 2AA2A 2QE4A 3VI8A 4G1DA 2YATA 2JJ3A 1XDKB 3FLIA 4YPQA 1T74A 5DXEA 1S19A 2H77A 2YLQA 3L0EA 3N00A 3U9QA 3P89A 5DXBA 3OZ0A 1NDEA 2AA7A 1SQNA 3HLVA 4QL8A 3FEJA 5H1EA 3FUGA 1NAVA 4YNKA 1U3RA 4MG8B 2ZMHA 3CWDA 5DX3A 1VJBA 1FBYA 3FEIA 4Y29A 4OH5A 1MV9A 4DM8A 3A40X 3Q95A 1FCYA 1KKQA 4RAKA 4OZTE 4K4JA 5KRAA 4PP6A 1LV2A 4TUZB 3V4AA 2PNUA 3G9EA 5AVIA 4E4KA 2P4YA 5EC9A 3ZR7A 3WGPA 1XNNA 2LBDA 1T5ZA 3R8IA 2AX6A 1XP9A 3H0AD 4OEDA 1ERRA 5IZ0A 2ZK1A 2O4JA 4PPPA 2ZXNA 3IMYA 4WVDA 5GIDA 5A86A 4CSJA 4JGVA 4R06A 1FCZA 3IA6A 5AAUA 3ET2A 3QT0A 5L7GA 4WHGA 3UUDB 4IA7A 4G20A 4POHA 5LWPA 1DKFA 5DXKA 3ZQTA 4DORA 5KRIA 2ZK2A 2YLOA 2ZMIA 3A2JA 1SKXA 5JY3A 5KRJA 5B41A 5HYKA 3PBAA 4IA2A 1X7JA 4OJ4A 4UDCA 5I4VA 2Q6JA 5KRKA 3L03A 3CS8A 5KD9A 4MG9A 3B0TA 3VN2A 3S9SA 1IE8A 1YMTA 4IVYA 2ZK4A 5EHJA 3PCUA 1XZXX 4KZIA 1FM6D 1NRLA 2Q7LA 1PDUA 2OVMA 2ZY0A 3FXVA 4S14A 5C4SA 5KYAA 2FAIA 3DCTA 3VT9A 4ZN7A 4ONIA 1N46A 4RMEA 3OMPA 1U3QA 4N1YA 4P6WA 3UUDA 2GPVA 4QK4A 1E3GA 3VSOA 1UPWA 2ZLCA 3MNPA 4N8RA 2XYJA 1X78A 3A3ZX 3GWSX 4XLDA 5DUGA 3VT5A 3AN4A 4PLDA 2Q5SA 1YJEA 4PLEA 2AX8A 1R6GA 3UU7B 5KCTA 3OAPA 5DZ0A 5G5WA 3ADXA 2ZFXA 4IA1A 1S9PA 1I37A 2JFAA 2VV1A 4LNXA 4OIUA 4ZNTA 3TX7B 1RKHA 5DU5A 1ZDTA 4RZFA 2J4AA 2QGTA 2Q59A 2V0VA 4BCRA 3SP9A 3KWYA 3E00D 3W0CA 1X7BA 2Q5PA 3UUCA 4G21A 3W5TA 2ZNQA 1RK3A 1NQ1A 4FN9A 4RE8A 3WT7A 3RUUA 3AZ2A 3IXPA 5AWKA 3OZJA 2ZNNA 4IV2A 4J26A 3D90A 2O9IA 3H0AA 4UDDA 5FQSA 2A3IA 2AA5A 4LSJA 4RUJA 2P7GA 3OOKA 4OFUA 3B0RA 3WJ5A 1XV9B 4JYGA 1K7LA 3A2IA 3OMKA 3K8SA 5DKGA 3CDPA 3KMGA 1IE9A 4X1GA 1XQCA 3G8OA 2AO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QZO B;  1ILH A;  2P1T A;  1HG4 A;  4L98 A;  4XAO A;  5DXM A;  4ZNV A;  5F9B A;  5DID A;  5FQR A;  3ET1 A;  3W0H A;  1PQ6 A;  4ITE A;  3TKC A;  3GBK A;  4ZJW A;  5DWE A;  5DY8 A;  3TKM A;  4KZJ A;  2QPY A;  2VSR A;  4Q0A C;  4RMC A;  5HJS A;  3R8D A;  3PO9 A;  4DOS A;  1XP6 A;  3FS1 A;  4OH6 A;  3OOF A;  2NPA A;  1KV6 A;  1XV9 A;  1PRG A;  1YP0 A;  4JAZ A;  4B7W A;  4G2H A;  2Z4J A;  1R20 D;  2HC4 A;  1OSV A;  3HZF A;  3MNO A;  5DXB B;  4ZI1 A;  4WHF A;  4IWC A;  3OMM A;  5HZC A;  5IAW A;  5AZV A;  1L2J A;  2QSE A;  5HJP A;  3OS9 A;  3VJS A;  5AVL A;  1WM0 X;  4X1F A;  5E14 A;  4JL4 A;  5AAV A;  2P7Z A;  5DX3 B;  2VST A;  5E7V A;  5FQV A;  4E4Q A;  5DI7 A;  1I38 A;  1NQ7 A;  1OT7 A;  3NOA A;  4A4V A;  2G5O A;  5APH A;  2AA6 A;  3VRV A;  3HVL A;  2PIX A;  4M8E A;  4OZR U;  3FUR A;  5SYZ A;  1XNX A;  3ADS A;  1A52 A;  2PKL A;  3AFR A;  3IPU A;  4J24 A;  3VT3 A;  3X1H A;  3HC5 A;  2QA6 A;  5KRL A;  5DKB A;  3CLD A;  5DTV A;  5DXR A;  3ERT A;  4G2I A;  5L11 A;  3E00 A;  2ZMJ A;  1R1K A;  5L7E A;  1UOM A;  4IUI A;  4OEY A;  5KCU A;  3V3Q A;  3WT6 A;  4WQP A;  3PLZ A;  4G1Y A;  4NIE A;  1XB7 A;  3KMR A;  2G0H A;  2Q60 A;  2YLP A;  5DV8 A;  3W0A A;  2AYR A;  5HCV A;  1XP1 A;  4PF3 A;  4ZOM A;  1T7F A;  4EMA A;  2NXX E;  4MGB A;  3DCU A;  5DV6 A;  4OK1 A;  2VV0 A;  3VJT A;  1PK5 A;  1PCG A;  1DKF B;  2P7A A;  1G5Y A;  2P1V A;  3HC6 A;  4HLW A;  2Q6R A;  1NYX A;  2Q8S A;  2YJD A;  4K6I A;  4L96 A;  5DXG A;  2QW4 A;  5DWI A;  2GIU A;  3DZU A;  3ZRA A;  3ZRB A;  3GZ9 A;  1ILG A;  3DZY A;  5DSH A;  5G3J A;  3K6P A;  3W0Y A;  3ET0 A;  4NQA B;  3L0J A;  1NQ0 A;  4PVU A;  4MG9 B;  3IXP D;  3CDS A;  1YIN A;  3FAL B;  1X7R A;  3OSW A;  1MZN A;  5DVS A;  2VV4 A;  2ACL A;  5KRH A;  4TV1 B;  3L1B A;  2NW4 A;  1T7M A;  2XHS A;  5KRO A;  2FSZ A;  5DXP A;  3JZC A;  1X7E A;  3W5R A;  2GWX A;  2OM9 A;  2Q5G A;  3KDT A;  1Y0S A;  5EIT A;  4RZG A;  5KCC A;  5FQT A;  3AUR A;  2GPU A;  2HAR A;  2P54 A;  4IA3 A;  3D6D A;  1R20 A;  5KCF A;  4QJR A;  3ILZ A;  2AWH A;  4PXM A;  3VRU A;  5ETH A;  1Z5X U;  4MGC A;  2Q7J A;  4PWL A;  1YA3 A;  4ZNH A;  2XYW A;  4IU7 A;  1ERE A;  2GPP A;  3D24 A;  3VSP A;  2QA8 B;  5K13 A;  1ZEO A;  2JFA B;  2VV1 B;  1HJ1 A;  1U9E A;  2ZLA A;  3FAL A;  4G1Z A;  4R6S A;  4CI4 A;  1EXA A;  1QKN A;  5DIE A;  3B65 A;  2AX9 A;  1RDT A;  4IW8 A;  5JJM A;  3G8I A;  1TFC A;  4J5X A;  1OSH A;  2Q59 B;  4TV1 A;  5DRJ A;  3UP3 A;  1XLS E;  4EM9 A;  4ZN9 A;  5DK9 A;  2G0G A;  4K7A A;  5ICK A;  4OKX A;  4OJB A;  4MG5 A;  4PP3 A;  2QAB A;  2OAX A;  3CS4 A;  4PRG A;  1GS4 A;  4R2U A;  3P8X A;  1QKU A;  3VRW A;  3IPS A;  3B68 A;  2QR9 A;  4JYI A;  4APU A;  1Q4X A;  5G45 A;  5KYJ A;  3OLL A;  4E2J A;  2R6Y A;  3M7R A;  3OKI A;  5AYG A;  5KRF A;  3PRG A;  4ZNS A;  4IW6 A;  2QA8 A;  2QMV A;  2Q7K A;  2I0G A;  2HBH A;  3VT4 A;  1T76 A;  4J5X C;  4QE6 A;  3W5P A;  4O8F A;  3HOD A;  5LGA A;  5DZH A;  3RUT A;  2Q1H A;  5KR9 A;  2B1Z A;  4HEE X;  2HAS A;  1R1K D;  2Q61 A;  4RFW A;  1GWX A;  4UDB A;  3T03 A;  1ZGY A;  4OJ9 A;  1RKG A;  2HB7 A;  3D5F A;  3AUQ A;  3R5M A;  3UVV A;  3EYB A;  2ZK0 A;  4XUM A;  3E94 A;  5HYR A;  4DM6 A;  1UPV A;  3A2H A;  1DB1 A;  2AAX A;  3OLS A;  2QXS A;  2GL8 A;  2PIN A;  4OZT U;  5DZI A;  1M2Z A;  1T7R A;  2ZVT A;  2QNV A;  3AZ1 A;  1T63 A;  3OMO A;  1I7I A;  2Q7I A;  2GTK A;  3AZ3 A;  5AZT A;  4RWV A;  3VTB A;  3PEQ A;  5DL4 A;  3X36 A;  5HJP B;  3DZY D;  1S9Q A;  3LBD A;  5B5B A;  1S0Z A;  3ADU A;  3AX8 A;  5AAV B;  1BSX A;  2V7C A;  5JI0 D;  3L3X A;  5KRC A;  1XVP A;  1Y0X X;  1UHL A;  3FC6 A;  4KZM A;  4LBD A;  3O1D A;  2AX7 A;  3B1M A;  3VHV A;  1QKT A;  5DIG A;  5DKS A;  4MG7 A;  3GWX A;  3V49 A;  2FVJ A;  4RUO X;  1M7W A;  4MDD A;  4ZO1 X;  3W5Q A;  1OVL A;  4N5G A;  1T73 A;  4IWF A;  3CJW A;  2HAM A;  3RLJ A;  4DK7 A;  5DUH A;  4XUH A;  2J7X A;  4A4W A;  1YUC A;  3G0W A;  2POG A;  4OGH A;  3KFC A;  4QE8 A;  4ZO1 B;  5DWJ A;  5DV3 A;  5E0X A;  5GIE A;  3RLL A;  3VHU A;  2EWP A;  2ZNP A;  3GYT A;  2HB8 A;  5G43 A;  3ET3 A;  3VJI A;  3OKH A;  4OHA A;  4MGB B;  4NY9 A;  4OKW A;  1ZAF A;  4UDA A;  1RDT D;  1NQ2 A;  3V9Y A;  2IOK A;  3R5N A;  1RJK A;  4DK8 A;  3WFF A;  2HFP A;  3OSI A;  4MGA A;  2GP7 A;  2PIO A;  2REW A;  4MG6 A;  5AK2 A;  3D57 A;  5E1C A;  3UUA B;  2YLY A;  2IHQ A;  2VV2 A;  1ZH7 A;  2VV4 B;  2ACL B;  3KBA A;  3KYT A;  1G1U A;  3ADV A;  4MGD A;  1LBD A;  3W0I A;  2B50 A;  3F5C B;  4XTA A;  1G50 A;  2ZBS A;  4RMD A;  4RZE A;  3TY0 A;  1XIU A;  5APK A;  1QKM A;  2OUZ A;  5EGV A;  1I7G A;  1M13 A;  1Y9R A;  3BEJ A;  3W0J A;  3X1I A;  2NXX A;  2YFE A;  2AMB A;  5EJV A;  3VT6 A;  2GPO A;  3ERD A;  4WPF A;  4POJ A;  1PZL A;  1A28 A;  1P8D A;  2OVH A;  3OMQ A;  3WMH A;  1T7T A;  3KPZ A;  4OLM A;  5DYD A;  5DZ3 A;  5APJ A;  5CJ6 A;  2AM9 A;  2ZL9 A;  2Q70 A;  3SP6 A;  3WWR A;  4DMA A;  3UP0 A;  5DRM A;  1XPC A;  4OEZ A;  3UUA A;  2P1U A;  5JJM B;  2PIP L;  3WT5 A;  3IPQ A;  3F5C A;  4IS8 A;  2PIV A;  2ZAS A;  1YYE A;  1FD0 A;  3VJH A;  1GWQ A;  1PQ9 A;  2QTU A;  1FM9 A;  2VV3 A;  2HVC A;  2B23 A;  3HM1 A;  2R40 D;  3KMZ A;  4OIL A;  5GIC A;  3A9E B;  3F7D A;  1H9U A;  3DZU D;  2JF9 A;  2BJ4 A;  2HCD A;  1T79 A;  1K74 A;  2YJA B;  4Q13 A;  4XHD A;  5DZ1 A;  4OFR A;  5DMC A;  5DVC A;  3JZB A;  4REE A;  3BC5 A;  3ADT A;  1XDK A;  3E7C A;  3X31 A;  5C4O A;  2NV7 A;  4ZNW A;  2ZK3 A;  4IV4 A;  4QM0 A;  3OGT A;  5ACC A;  1X76 A;  1P93 A;  2I4J A;  5E19 A;  4YT1 A;  2F4B A;  1U3S A;  1G2N A;  3GD2 A;  5DWL A;  5E0W A;  2J14 A;  2I0J A;  2OCF A;  2PIT A;  4MG8 A;  1XLS A;  4XI3 A;  3B5R A;  3W0G A;  2QH6 A;  2ZKC A;  3A9E A;  1L2I A;  3K23 A;  5DYB A;  1XAP A;  3AUN A;  4FHH A;  3V9T A;  2B1V A;  2Z4B A;  3UVV B;  4TUZ A;  2AXA A;  3B0W A;  4WLB A;  2AMA A;  4RUP A;  4S0T A;  1NUO A;  4M8H A;  3V9V A;  1N4H A;  2Q3Y A;  4OEA A;  3WTQ A;  1SJ0 A;  1ZDU A;  3L0L A;  2ABI A;  2PRG A;  2IOG A;  2Q6S A;  3MNE A;  3OLF A;  1YY4 A;  4OAR A;  3R29 A;  5G42 A;  5L7H A;  4S15 A;  1NAX A;  2Q1V A;  1YOW A;  3ADW A;  1ZKY A;  1Z95 A;  4OZR E;  1XVP B;  3FC6 B;  1UHL B;  3CTB A;  4CI5 A;  4PPS A;  5G46 A;  3K22 A;  3B0Q A;  3VT7 A;  1FCX A;  5EI1 A;  4FNE A;  2ATH A;  4MG7 B;  4PP5 A;  2H79 A;  4N73 A;  2PIR A;  4P6X A;  4S0S A;  3VTC A;  1OVL B;  2E2R A;  2R6W A;  2YHD A;  4OC7 A;  1K4W A;  3VT8 A;  1GWR A;  5KCE A;  2POB A;  1YOK A;  2R40 A;  3GYU A;  3B3K A;  3OSA A;  5KCW A;  1XJ7 A;  5GT4 A;  2PIQ A;  5DXQ A;  4OIV A;  1MVC A;  1KNU A;  2J7Y A;  3HO0 A;  3CQV A;  3RVF A;  4DQM A;  5DKE A;  2XKW A;  3DT3 A;  3SZ1 A;  3HQ5 A;  3VTD A;  4ITF A;  1R5K A;  3GN8 A;  1NHZ A;  2ZK6 A;  3UU7 A;  2XYX A;  4MGA B;  1FM9 D;  4J5W A;  2QGW A;  1S0X A;  5KRM A;  3R2A A;  4NUF A;  2P15 A;  3NSP A;  3LMP A;  2ZNO A;  1K74 D;  2G44 A;  5E15 A;  2ZXZ A;  3OS8 A;  4ZNU A;  3O1E A;  5C4U A;  4MGD B;  3AN3 A;  1N83 A;  2HWQ A;  5AWJ A;  3NSQ A;  2PIU A;  4Q50 A;  3P88 A;  3P0U A;  1PQC A;  4NB6 A;  3V3E A;  3H52 A;  3VRT A;  5KCD A;  3CS6 A;  3KDU A;  5DWG A;  4F9M A;  4ZJR A;  1E3K A;  1Z5X E;  3B67 A;  1YIM A;  2QXM A;  2PJL A;  1SR7 A;  5M96 A;  5IXK A;  3WFG A;  4FHI A;  3RY9 A;  3WJ4 A;  2BAW A;  1ZUC A;  1FM6 A;  2I4P A;  4OKB A;  4J5W C;  2OZ7 A;  5DVV A;  5DUE A;  4A2J A;  5DLR A;  5G44 A;  5FQP A;  3L3Z A;  1XOW A;  3OS8 C;  4IQR A;  1TXI A;  4LTW A;  1EXX A;  2ZXM A;  3BQD A;  2I4Z A;  4JYH A;  2ZK5 A;  4REF A;  3VHW A;  2W8Y A;  2QZO A;  2HWR A;  3DY6 A;  1XQ3 A;  4IVW A;  3B66 A;  2AB2 A;  3A78 A;  4XT9 A;  1T65 A;  5DP0 A;  4LNW A;  2O4R A;  3DR1 A;  5C4T A;  4FGY A;  5DMF A;  2BJ4 B;  3Q95 B;  4OKT A;  4YMQ A;  3R8A A;  2PIW A;  2AA2 A;  2QE4 A;  3VI8 A;  4G1D A;  2YAT A;  2JJ3 A;  1XDK B;  3FLI A;  4YPQ A;  1T74 A;  5DXE A;  1S19 A;  2H77 A;  2YLQ A;  3L0E A;  3N00 A;  3U9Q A;  3P89 A;  5DXB A;  3OZ0 A;  1NDE A;  2AA7 A;  1SQN A;  3HLV A;  4QL8 A;  3FEJ A;  5H1E A;  3FUG A;  1NAV A;  4YNK A;  1U3R A;  4MG8 B;  2ZMH A;  3CWD A;  5DX3 A;  1VJB A;  1FBY A;  3FEI A;  4Y29 A;  4OH5 A;  1MV9 A;  4DM8 A;  3A40 X;  3Q95 A;  1FCY A;  1KKQ A;  4RAK A;  4OZT E;  4K4J A;  5KRA A;  4PP6 A;  1LV2 A;  4TUZ B;  3V4A A;  2PNU A;  3G9E A;  5AVI A;  4E4K A;  2P4Y A;  5EC9 A;  3ZR7 A;  3WGP A;  1XNN A;  2LBD A;  1T5Z A;  3R8I A;  2AX6 A;  1XP9 A;  3H0A D;  4OED A;  1ERR A;  5IZ0 A;  2ZK1 A;  2O4J A;  4PPP A;  2ZXN A;  3IMY A;  4WVD A;  5GID A;  5A86 A;  4CSJ A;  4JGV A;  4R06 A;  1FCZ A;  3IA6 A;  5AAU A;  3ET2 A;  3QT0 A;  5L7G A;  4WHG A;  3UUD B;  4IA7 A;  4G20 A;  4POH A;  5LWP A;  1DKF A;  5DXK A;  3ZQT A;  4DOR A;  5KRI A;  2ZK2 A;  2YLO A;  2ZMI A;  3A2J A;  1SKX A;  5JY3 A;  5KRJ A;  5B41 A;  5HYK A;  3PBA A;  4IA2 A;  1X7J A;  4OJ4 A;  4UDC A;  5I4V A;  2Q6J A;  5KRK A;  3L03 A;  3CS8 A;  5KD9 A;  4MG9 A;  3B0T A;  3VN2 A;  3S9S A;  1IE8 A;  1YMT A;  4IVY A;  2ZK4 A;  5EHJ A;  3PCU A;  1XZX X;  4KZI A;  1FM6 D;  1NRL A;  2Q7L A;  1PDU A;  2OVM A;  2ZY0 A;  3FXV A;  4S14 A;  5C4S A;  5KYA A;  2FAI A;  3DCT A;  3VT9 A;  4ZN7 A;  4ONI A;  1N46 A;  4RME A;  3OMP A;  1U3Q A;  4N1Y A;  4P6W A;  3UUD A;  2GPV A;  4QK4 A;  1E3G A;  3VSO A;  1UPW A;  2ZLC A;  3MNP A;  4N8R A;  2XYJ A;  1X78 A;  3A3Z X;  3GWS X;  4XLD A;  5DUG A;  3VT5 A;  3AN4 A;  4PLD A;  2Q5S A;  1YJE A;  4PLE A;  2AX8 A;  1R6G A;  3UU7 B;  5KCT A;  3OAP A;  5DZ0 A;  5G5W A;  3ADX A;  2ZFX A;  4IA1 A;  1S9P A;  1I37 A;  2JFA A;  2VV1 A;  4LNX A;  4OIU A;  4ZNT A;  3TX7 B;  1RKH A;  5DU5 A;  1ZDT A;  4RZF A;  2J4A A;  2QGT A;  2Q59 A;  2V0V A;  4BCR A;  3SP9 A;  3KWY A;  3E00 D;  3W0C A;  1X7B A;  2Q5P A;  3UUC A;  4G21 A;  3W5T A;  2ZNQ A;  1RK3 A;  1NQ1 A;  4FN9 A;  4RE8 A;  3WT7 A;  3RUU A;  3AZ2 A;  3IXP A;  5AWK A;  3OZJ A;  2ZNN A;  4IV2 A;  4J26 A;  3D90 A;  2O9I A;  3H0A A;  4UDD A;  5FQS A;  2A3I A;  2AA5 A;  4LSJ A;  4RUJ A;  2P7G A;  3OOK A;  4OFU A;  3B0R A;  3WJ5 A;  1XV9 B;  4JYG A;  1K7L A;  3A2I A;  3OMK A;  3K8S A;  5DKG A;  3CDP A;  3KMG A;  1IE9 A;  4X1G A;  1XQC A;  3G8O A;  2AO6 A; 
#chains in the Genus database with same CATH topology
 2QZO B;  1ILH A;  2P1T A;  1HG4 A;  4L98 A;  4XAO A;  5DXM A;  4ZNV A;  5F9B A;  5DID A;  5FQR A;  3ET1 A;  3W0H A;  1PQ6 A;  4ITE A;  3TKC A;  3GBK A;  4ZJW A;  5DWE A;  5DY8 A;  3TKM A;  4KZJ A;  2QPY A;  2VSR A;  4Q0A C;  4RMC A;  5HJS A;  3R8D A;  3PO9 A;  4DOS A;  1XP6 A;  3FS1 A;  4OH6 A;  3OOF A;  2NPA A;  1KV6 A;  1XV9 A;  1PRG A;  1YP0 A;  4JAZ A;  4B7W A;  4G2H A;  2Z4J A;  1R20 D;  2HC4 A;  1OSV A;  3HZF A;  3MNO A;  5DXB B;  4ZI1 A;  4WHF A;  4IWC A;  3OMM A;  5HZC A;  5IAW A;  5AZV A;  1L2J A;  2QSE A;  5HJP A;  3OS9 A;  3VJS A;  5AVL A;  1WM0 X;  4X1F A;  5E14 A;  4JL4 A;  5AAV A;  2P7Z A;  5DX3 B;  2VST A;  5E7V A;  5FQV A;  4E4Q A;  5DI7 A;  1I38 A;  1NQ7 A;  1OT7 A;  3NOA A;  4A4V A;  2G5O A;  5APH A;  2AA6 A;  3VRV A;  3HVL A;  2PIX A;  4M8E A;  4OZR U;  3FUR A;  5SYZ A;  1XNX A;  3ADS A;  1A52 A;  2PKL A;  3AFR A;  3IPU A;  4J24 A;  3VT3 A;  3X1H A;  3HC5 A;  2QA6 A;  5KRL A;  5DKB A;  3CLD A;  5DTV A;  5DXR A;  3ERT A;  4G2I A;  5L11 A;  3E00 A;  2ZMJ A;  1R1K A;  5L7E A;  1UOM A;  4IUI A;  4OEY A;  5KCU A;  3V3Q A;  3WT6 A;  4WQP A;  3PLZ A;  4G1Y A;  4NIE A;  1XB7 A;  3KMR A;  2G0H A;  2Q60 A;  2YLP A;  5DV8 A;  3W0A A;  2AYR A;  5HCV A;  1XP1 A;  4PF3 A;  4ZOM A;  1T7F A;  4EMA A;  2NXX E;  4MGB A;  3DCU A;  5DV6 A;  4OK1 A;  2VV0 A;  3VJT A;  1PK5 A;  1PCG A;  1DKF B;  2P7A A;  1G5Y A;  2P1V A;  3HC6 A;  4HLW A;  2Q6R A;  1NYX A;  2Q8S A;  2YJD A;  4K6I A;  4L96 A;  5DXG A;  2QW4 A;  5DWI A;  2GIU A;  3DZU A;  3ZRA A;  3ZRB A;  3GZ9 A;  1ILG A;  3DZY A;  5DSH A;  5G3J A;  3K6P A;  3W0Y A;  3ET0 A;  4NQA B;  3L0J A;  1NQ0 A;  4PVU A;  4MG9 B;  3IXP D;  3CDS A;  1YIN A;  3FAL B;  1X7R A;  3OSW A;  1MZN A;  5DVS A;  2VV4 A;  2ACL A;  5KRH A;  4TV1 B;  3L1B A;  2NW4 A;  1T7M A;  2XHS A;  5KRO A;  2FSZ A;  5DXP A;  3JZC A;  1X7E A;  3W5R A;  2GWX A;  2OM9 A;  2Q5G A;  3KDT A;  1Y0S A;  5EIT A;  4RZG A;  5KCC A;  5FQT A;  3AUR A;  2GPU A;  2HAR A;  2P54 A;  4IA3 A;  3D6D A;  1R20 A;  5KCF A;  4QJR A;  3ILZ A;  2AWH A;  4PXM A;  3VRU A;  5ETH A;  1Z5X U;  4MGC A;  2Q7J A;  4PWL A;  1YA3 A;  4ZNH A;  2XYW A;  4IU7 A;  1ERE A;  2GPP A;  3D24 A;  3VSP A;  2QA8 B;  5K13 A;  1ZEO A;  2JFA B;  2VV1 B;  1HJ1 A;  1U9E A;  2ZLA A;  3FAL A;  4G1Z A;  4R6S A;  4CI4 A;  1EXA A;  1QKN A;  5DIE A;  3B65 A;  2AX9 A;  1RDT A;  4IW8 A;  5JJM A;  3G8I A;  1TFC A;  4J5X A;  1OSH A;  2Q59 B;  4TV1 A;  5DRJ A;  3UP3 A;  1XLS E;  4EM9 A;  4ZN9 A;  5DK9 A;  2G0G A;  4K7A A;  5ICK A;  4OKX A;  4OJB A;  4MG5 A;  4PP3 A;  2QAB A;  2OAX A;  3CS4 A;  4PRG A;  1GS4 A;  4R2U A;  3P8X A;  1QKU A;  3VRW A;  3IPS A;  3B68 A;  2QR9 A;  4JYI A;  4APU A;  1Q4X A;  5G45 A;  5KYJ A;  3OLL A;  4E2J A;  2R6Y A;  3M7R A;  3OKI A;  5AYG A;  5KRF A;  3PRG A;  4ZNS A;  4IW6 A;  2QA8 A;  2QMV A;  2Q7K A;  2I0G A;  2HBH A;  3VT4 A;  1T76 A;  4J5X C;  4QE6 A;  3W5P A;  4O8F A;  3HOD A;  5LGA A;  5DZH A;  3RUT A;  2Q1H A;  5KR9 A;  2B1Z A;  4HEE X;  2HAS A;  1R1K D;  2Q61 A;  4RFW A;  1GWX A;  4UDB A;  3T03 A;  1ZGY A;  4OJ9 A;  1RKG A;  2HB7 A;  3D5F A;  3AUQ A;  3R5M A;  3UVV A;  3EYB A;  2ZK0 A;  4XUM A;  3E94 A;  5HYR A;  4DM6 A;  1UPV A;  3A2H A;  1DB1 A;  2AAX A;  3OLS A;  2QXS A;  2GL8 A;  2PIN A;  4OZT U;  5DZI A;  1M2Z A;  1T7R A;  2ZVT A;  2QNV A;  3AZ1 A;  1T63 A;  3OMO A;  1I7I A;  2Q7I A;  2GTK A;  3AZ3 A;  5AZT A;  4RWV A;  3VTB A;  3PEQ A;  5DL4 A;  3X36 A;  5HJP B;  3DZY D;  1S9Q A;  3LBD A;  5B5B A;  1S0Z A;  3ADU A;  3AX8 A;  5AAV B;  1BSX A;  2V7C A;  5JI0 D;  3L3X A;  5KRC A;  1XVP A;  1Y0X X;  1UHL A;  3FC6 A;  4KZM A;  4LBD A;  3O1D A;  2AX7 A;  3B1M A;  3VHV A;  1QKT A;  5DIG A;  5DKS A;  4MG7 A;  3GWX A;  3V49 A;  2FVJ A;  4RUO X;  1M7W A;  4MDD A;  4ZO1 X;  3W5Q A;  1OVL A;  4N5G A;  1T73 A;  4IWF A;  3CJW A;  2HAM A;  3RLJ A;  4DK7 A;  5DUH A;  4XUH A;  2J7X A;  4A4W A;  1YUC A;  3G0W A;  2POG A;  4OGH A;  3KFC A;  4QE8 A;  4ZO1 B;  5DWJ A;  5DV3 A;  5E0X A;  5GIE A;  3RLL A;  3VHU A;  2EWP A;  2ZNP A;  3GYT A;  2HB8 A;  5G43 A;  3ET3 A;  3VJI A;  3OKH A;  4OHA A;  4MGB B;  4NY9 A;  4OKW A;  1ZAF A;  4UDA A;  1RDT D;  1NQ2 A;  3V9Y A;  2IOK A;  3R5N A;  1RJK A;  4DK8 A;  3WFF A;  2HFP A;  3OSI A;  4MGA A;  2GP7 A;  2PIO A;  2REW A;  4MG6 A;  5AK2 A;  3D57 A;  5E1C A;  3UUA B;  2YLY A;  2IHQ A;  2VV2 A;  1ZH7 A;  2VV4 B;  2ACL B;  3KBA A;  3KYT A;  1G1U A;  3ADV A;  4MGD A;  1LBD A;  3W0I A;  2B50 A;  3F5C B;  4XTA A;  1G50 A;  2ZBS A;  4RMD A;  4RZE A;  3TY0 A;  1XIU A;  5APK A;  1QKM A;  2OUZ A;  5EGV A;  1I7G A;  1M13 A;  1Y9R A;  3BEJ A;  3W0J A;  3X1I A;  2NXX A;  2YFE A;  2AMB A;  5EJV A;  3VT6 A;  2GPO A;  3ERD A;  4WPF A;  4POJ A;  1PZL A;  1A28 A;  1P8D A;  2OVH A;  3OMQ A;  3WMH A;  1T7T A;  3KPZ A;  4OLM A;  5DYD A;  5DZ3 A;  5APJ A;  5CJ6 A;  2AM9 A;  2ZL9 A;  2Q70 A;  3SP6 A;  3WWR A;  4DMA A;  3UP0 A;  5DRM A;  1XPC A;  4OEZ A;  3UUA A;  2P1U A;  5JJM B;  2PIP L;  3WT5 A;  3IPQ A;  3F5C A;  4IS8 A;  2PIV A;  2ZAS A;  1YYE A;  1FD0 A;  3VJH A;  1GWQ A;  1PQ9 A;  2QTU A;  1FM9 A;  2VV3 A;  2HVC A;  2B23 A;  3HM1 A;  2R40 D;  3KMZ A;  4OIL A;  5GIC A;  3A9E B;  3F7D A;  1H9U A;  3DZU D;  2JF9 A;  2BJ4 A;  2HCD A;  1T79 A;  1K74 A;  2YJA B;  4Q13 A;  4XHD A;  5DZ1 A;  4OFR A;  5DMC A;  5DVC A;  3JZB A;  4REE A;  3BC5 A;  3ADT A;  1XDK A;  3E7C A;  3X31 A;  5C4O A;  2NV7 A;  4ZNW A;  2ZK3 A;  4IV4 A;  4QM0 A;  3OGT A;  5ACC A;  1X76 A;  1P93 A;  2I4J A;  5E19 A;  4YT1 A;  2F4B A;  1U3S A;  1G2N A;  3GD2 A;  5DWL A;  5E0W A;  2J14 A;  2I0J A;  2OCF A;  2PIT A;  4MG8 A;  1XLS A;  4XI3 A;  3B5R A;  3W0G A;  2QH6 A;  2ZKC A;  3A9E A;  1L2I A;  3K23 A;  5DYB A;  1XAP A;  3AUN A;  4FHH A;  3V9T A;  2B1V A;  2Z4B A;  3UVV B;  4TUZ A;  2AXA A;  3B0W A;  4WLB A;  2AMA A;  4RUP A;  4S0T A;  1NUO A;  4M8H A;  3V9V A;  1N4H A;  2Q3Y A;  4OEA A;  3WTQ A;  1SJ0 A;  1ZDU A;  3L0L A;  2ABI A;  2PRG A;  2IOG A;  2Q6S A;  3MNE A;  3OLF A;  1YY4 A;  4OAR A;  3R29 A;  5G42 A;  5L7H A;  4S15 A;  1NAX A;  2Q1V A;  1YOW A;  3ADW A;  1ZKY A;  1Z95 A;  4OZR E;  1XVP B;  3FC6 B;  1UHL B;  3CTB A;  4CI5 A;  4PPS A;  5G46 A;  3K22 A;  3B0Q A;  3VT7 A;  1FCX A;  5EI1 A;  4FNE A;  2ATH A;  4MG7 B;  4PP5 A;  2H79 A;  4N73 A;  2PIR A;  4P6X A;  4S0S A;  3VTC A;  1OVL B;  2E2R A;  2R6W A;  2YHD A;  4OC7 A;  1K4W A;  3VT8 A;  1GWR A;  5KCE A;  2POB A;  1YOK A;  2R40 A;  3GYU A;  3B3K A;  3OSA A;  5KCW A;  1XJ7 A;  5GT4 A;  2PIQ A;  5DXQ A;  4OIV A;  1MVC A;  1KNU A;  2J7Y A;  3HO0 A;  3CQV A;  3RVF A;  4DQM A;  5DKE A;  2XKW A;  3DT3 A;  3SZ1 A;  3HQ5 A;  3VTD A;  4ITF A;  1R5K A;  3GN8 A;  1NHZ A;  2ZK6 A;  3UU7 A;  2XYX A;  4MGA B;  1FM9 D;  4J5W A;  2QGW A;  1S0X A;  5KRM A;  3R2A A;  4NUF A;  2P15 A;  3NSP A;  3LMP A;  2ZNO A;  1K74 D;  2G44 A;  5E15 A;  2ZXZ A;  3OS8 A;  4ZNU A;  3O1E A;  5C4U A;  4MGD B;  3AN3 A;  1N83 A;  2HWQ A;  5AWJ A;  3NSQ A;  2PIU A;  4Q50 A;  3P88 A;  3P0U A;  1PQC A;  4NB6 A;  3V3E A;  3H52 A;  3VRT A;  5KCD A;  3CS6 A;  3KDU A;  5DWG A;  4F9M A;  4ZJR A;  1E3K A;  1Z5X E;  3B67 A;  1YIM A;  2QXM A;  2PJL A;  1SR7 A;  5M96 A;  5IXK A;  3WFG A;  4FHI A;  3RY9 A;  3WJ4 A;  2BAW A;  1ZUC A;  1FM6 A;  2I4P A;  4OKB A;  4J5W C;  2OZ7 A;  5DVV A;  5DUE A;  4A2J A;  5DLR A;  5G44 A;  5FQP A;  3L3Z A;  1XOW A;  3OS8 C;  4IQR A;  1TXI A;  4LTW A;  1EXX A;  2ZXM A;  3BQD A;  2I4Z A;  4JYH A;  2ZK5 A;  4REF A;  3VHW A;  2W8Y A;  2QZO A;  2HWR A;  3DY6 A;  1XQ3 A;  4IVW A;  3B66 A;  2AB2 A;  3A78 A;  4XT9 A;  1T65 A;  5DP0 A;  4LNW A;  2O4R A;  3DR1 A;  5C4T A;  4FGY A;  5DMF A;  2BJ4 B;  3Q95 B;  4OKT A;  4YMQ A;  3R8A A;  2PIW A;  2AA2 A;  2QE4 A;  3VI8 A;  4G1D A;  2YAT A;  2JJ3 A;  1XDK B;  3FLI A;  4YPQ A;  1T74 A;  5DXE A;  1S19 A;  2H77 A;  2YLQ A;  3L0E A;  3N00 A;  3U9Q A;  3P89 A;  5DXB A;  3OZ0 A;  1NDE A;  2AA7 A;  1SQN A;  3HLV A;  4QL8 A;  3FEJ A;  5H1E A;  3FUG A;  1NAV A;  4YNK A;  1U3R A;  4MG8 B;  2ZMH A;  3CWD A;  5DX3 A;  1VJB A;  1FBY A;  3FEI A;  4Y29 A;  4OH5 A;  1MV9 A;  4DM8 A;  3A40 X;  3Q95 A;  1FCY A;  1KKQ A;  4RAK A;  4OZT E;  4K4J A;  5KRA A;  4PP6 A;  1LV2 A;  4TUZ B;  3V4A A;  2PNU A;  3G9E A;  5AVI A;  4E4K A;  2P4Y A;  5EC9 A;  3ZR7 A;  3WGP A;  1XNN A;  2LBD A;  1T5Z A;  3R8I A;  2AX6 A;  1XP9 A;  3H0A D;  4OED A;  1ERR A;  5IZ0 A;  2ZK1 A;  2O4J A;  4PPP A;  2ZXN A;  3IMY A;  4WVD A;  5GID A;  5A86 A;  4CSJ A;  4JGV A;  4R06 A;  1FCZ A;  3IA6 A;  5AAU A;  3ET2 A;  3QT0 A;  5L7G A;  4WHG A;  3UUD B;  4IA7 A;  4G20 A;  4POH A;  5LWP A;  1DKF A;  5DXK A;  3ZQT A;  4DOR A;  5KRI A;  2ZK2 A;  2YLO A;  2ZMI A;  3A2J A;  1SKX A;  5JY3 A;  5KRJ A;  5B41 A;  5HYK A;  3PBA A;  4IA2 A;  1X7J A;  4OJ4 A;  4UDC A;  5I4V A;  2Q6J A;  5KRK A;  3L03 A;  3CS8 A;  5KD9 A;  4MG9 A;  3B0T A;  3VN2 A;  3S9S A;  1IE8 A;  1YMT A;  4IVY A;  2ZK4 A;  5EHJ A;  3PCU A;  1XZX X;  4KZI A;  1FM6 D;  1NRL A;  2Q7L A;  1PDU A;  2OVM A;  2ZY0 A;  3FXV A;  4S14 A;  5C4S A;  5KYA A;  2FAI A;  3DCT A;  3VT9 A;  4ZN7 A;  4ONI A;  1N46 A;  4RME A;  3OMP A;  1U3Q A;  4N1Y A;  4P6W A;  3UUD A;  2GPV A;  4QK4 A;  1E3G A;  3VSO A;  1UPW A;  2ZLC A;  3MNP A;  4N8R A;  2XYJ A;  1X78 A;  3A3Z X;  3GWS X;  4XLD A;  5DUG A;  3VT5 A;  3AN4 A;  4PLD A;  2Q5S A;  1YJE A;  4PLE A;  2AX8 A;  1R6G A;  3UU7 B;  5KCT A;  3OAP A;  5DZ0 A;  5G5W A;  3ADX A;  2ZFX A;  4IA1 A;  1S9P A;  1I37 A;  2JFA A;  2VV1 A;  4LNX A;  4OIU A;  4ZNT A;  3TX7 B;  1RKH A;  5DU5 A;  1ZDT A;  4RZF A;  2J4A A;  2QGT A;  2Q59 A;  2V0V A;  4BCR A;  3SP9 A;  3KWY A;  3E00 D;  3W0C A;  1X7B A;  2Q5P A;  3UUC A;  4G21 A;  3W5T A;  2ZNQ A;  1RK3 A;  1NQ1 A;  4FN9 A;  4RE8 A;  3WT7 A;  3RUU A;  3AZ2 A;  3IXP A;  5AWK A;  3OZJ A;  2ZNN A;  4IV2 A;  4J26 A;  3D90 A;  2O9I A;  3H0A A;  4UDD A;  5FQS A;  2A3I A;  2AA5 A;  4LSJ A;  4RUJ A;  2P7G A;  3OOK A;  4OFU A;  3B0R A;  3WJ5 A;  1XV9 B;  4JYG A;  1K7L A;  3A2I A;  3OMK A;  3K8S A;  5DKG A;  3CDP A;  3KMG A;  1IE9 A;  4X1G A;  1XQC A;  3G8O A;  2AO6 A; 
#chains in the Genus database with same CATH homology
 2QZO B;  1ILH A;  2P1T A;  1HG4 A;  4L98 A;  4XAO A;  5DXM A;  4ZNV A;  5F9B A;  5DID A;  5FQR A;  3ET1 A;  3W0H A;  1PQ6 A;  4ITE A;  3TKC A;  3GBK A;  4ZJW A;  5DWE A;  5DY8 A;  3TKM A;  4KZJ A;  2QPY A;  2VSR A;  4Q0A C;  4RMC A;  5HJS A;  3R8D A;  3PO9 A;  4DOS A;  1XP6 A;  3FS1 A;  4OH6 A;  3OOF A;  2NPA A;  1KV6 A;  1XV9 A;  1PRG A;  1YP0 A;  4JAZ A;  4B7W A;  4G2H A;  2Z4J A;  1R20 D;  2HC4 A;  1OSV A;  3HZF A;  3MNO A;  5DXB B;  4ZI1 A;  4WHF A;  4IWC A;  3OMM A;  5HZC A;  5IAW A;  5AZV A;  1L2J A;  2QSE A;  5HJP A;  3OS9 A;  3VJS A;  5AVL A;  1WM0 X;  4X1F A;  5E14 A;  4JL4 A;  5AAV A;  2P7Z A;  5DX3 B;  2VST A;  5E7V A;  5FQV A;  4E4Q A;  5DI7 A;  1I38 A;  1NQ7 A;  1OT7 A;  3NOA A;  4A4V A;  2G5O A;  5APH A;  2AA6 A;  3VRV A;  3HVL A;  2PIX A;  4M8E A;  4OZR U;  3FUR A;  5SYZ A;  1XNX A;  3ADS A;  1A52 A;  2PKL A;  3AFR A;  3IPU A;  4J24 A;  3VT3 A;  3X1H A;  3HC5 A;  2QA6 A;  5KRL A;  5DKB A;  3CLD A;  5DTV A;  5DXR A;  3ERT A;  4G2I A;  5L11 A;  3E00 A;  2ZMJ A;  1R1K A;  5L7E A;  1UOM A;  4IUI A;  4OEY A;  5KCU A;  3V3Q A;  3WT6 A;  4WQP A;  3PLZ A;  4G1Y A;  4NIE A;  1XB7 A;  3KMR A;  2G0H A;  2Q60 A;  2YLP A;  5DV8 A;  3W0A A;  2AYR A;  5HCV A;  1XP1 A;  4PF3 A;  4ZOM A;  1T7F A;  4EMA A;  2NXX E;  4MGB A;  3DCU A;  5DV6 A;  4OK1 A;  2VV0 A;  3VJT A;  1PK5 A;  1PCG A;  1DKF B;  2P7A A;  1G5Y A;  2P1V A;  3HC6 A;  4HLW A;  2Q6R A;  1NYX A;  2Q8S A;  2YJD A;  4K6I A;  4L96 A;  5DXG A;  2QW4 A;  5DWI A;  2GIU A;  3DZU A;  3ZRA A;  3ZRB A;  3GZ9 A;  1ILG A;  3DZY A;  5DSH A;  5G3J A;  3K6P A;  3W0Y A;  3ET0 A;  4NQA B;  3L0J A;  1NQ0 A;  4PVU A;  4MG9 B;  3IXP D;  3CDS A;  1YIN A;  3FAL B;  1X7R A;  3OSW A;  1MZN A;  5DVS A;  2VV4 A;  2ACL A;  5KRH A;  4TV1 B;  3L1B A;  2NW4 A;  1T7M A;  2XHS A;  5KRO A;  2FSZ A;  5DXP A;  3JZC A;  1X7E A;  3W5R A;  2GWX A;  2OM9 A;  2Q5G A;  3KDT A;  1Y0S A;  5EIT A;  4RZG A;  5KCC A;  5FQT A;  3AUR A;  2GPU A;  2HAR A;  2P54 A;  4IA3 A;  3D6D A;  1R20 A;  5KCF A;  4QJR A;  3ILZ A;  2AWH A;  4PXM A;  3VRU A;  5ETH A;  1Z5X U;  4MGC A;  2Q7J A;  4PWL A;  1YA3 A;  4ZNH A;  2XYW A;  4IU7 A;  1ERE A;  2GPP A;  3D24 A;  3VSP A;  2QA8 B;  5K13 A;  1ZEO A;  2JFA B;  2VV1 B;  1HJ1 A;  1U9E A;  2ZLA A;  3FAL A;  4G1Z A;  4R6S A;  4CI4 A;  1EXA A;  1QKN A;  5DIE A;  3B65 A;  2AX9 A;  1RDT A;  4IW8 A;  5JJM A;  3G8I A;  1TFC A;  4J5X A;  1OSH A;  2Q59 B;  4TV1 A;  5DRJ A;  3UP3 A;  1XLS E;  4EM9 A;  4ZN9 A;  5DK9 A;  2G0G A;  4K7A A;  5ICK A;  4OKX A;  4OJB A;  4MG5 A;  4PP3 A;  2QAB A;  2OAX A;  3CS4 A;  4PRG A;  1GS4 A;  4R2U A;  3P8X A;  1QKU A;  3VRW A;  3IPS A;  3B68 A;  2QR9 A;  4JYI A;  4APU A;  1Q4X A;  5G45 A;  5KYJ A;  3OLL A;  4E2J A;  2R6Y A;  3M7R A;  3OKI A;  5AYG A;  5KRF A;  3PRG A;  4ZNS A;  4IW6 A;  2QA8 A;  2QMV A;  2Q7K A;  2I0G A;  2HBH A;  3VT4 A;  1T76 A;  4J5X C;  4QE6 A;  3W5P A;  4O8F A;  3HOD A;  5LGA A;  5DZH A;  3RUT A;  2Q1H A;  5KR9 A;  2B1Z A;  4HEE X;  2HAS A;  1R1K D;  2Q61 A;  4RFW A;  1GWX A;  4UDB A;  3T03 A;  1ZGY A;  4OJ9 A;  1RKG A;  2HB7 A;  3D5F A;  3AUQ A;  3R5M A;  3UVV A;  3EYB A;  2ZK0 A;  4XUM A;  3E94 A;  5HYR A;  4DM6 A;  1UPV A;  3A2H A;  1DB1 A;  2AAX A;  3OLS A;  2QXS A;  2GL8 A;  2PIN A;  4OZT U;  5DZI A;  1M2Z A;  1T7R A;  2ZVT A;  2QNV A;  3AZ1 A;  1T63 A;  3OMO A;  1I7I A;  2Q7I A;  2GTK A;  3AZ3 A;  5AZT A;  4RWV A;  3VTB A;  3PEQ A;  5DL4 A;  3X36 A;  5HJP B;  3DZY D;  1S9Q A;  3LBD A;  5B5B A;  1S0Z A;  3ADU A;  3AX8 A;  5AAV B;  1BSX A;  2V7C A;  5JI0 D;  3L3X A;  5KRC A;  1XVP A;  1Y0X X;  1UHL A;  3FC6 A;  4KZM A;  4LBD A;  3O1D A;  2AX7 A;  3B1M A;  3VHV A;  1QKT A;  5DIG A;  5DKS A;  4MG7 A;  3GWX A;  3V49 A;  2FVJ A;  4RUO X;  1M7W A;  4MDD A;  4ZO1 X;  3W5Q A;  1OVL A;  4N5G A;  1T73 A;  4IWF A;  3CJW A;  2HAM A;  3RLJ A;  4DK7 A;  5DUH A;  4XUH A;  2J7X A;  4A4W A;  1YUC A;  3G0W A;  2POG A;  4OGH A;  3KFC A;  4QE8 A;  4ZO1 B;  5DWJ A;  5DV3 A;  5E0X A;  5GIE A;  3RLL A;  3VHU A;  2EWP A;  2ZNP A;  3GYT A;  2HB8 A;  5G43 A;  3ET3 A;  3VJI A;  3OKH A;  4OHA A;  4MGB B;  4NY9 A;  4OKW A;  1ZAF A;  4UDA A;  1RDT D;  1NQ2 A;  3V9Y A;  2IOK A;  3R5N A;  1RJK A;  4DK8 A;  3WFF A;  2HFP A;  3OSI A;  4MGA A;  2GP7 A;  2PIO A;  2REW A;  4MG6 A;  5AK2 A;  3D57 A;  5E1C A;  3UUA B;  2YLY A;  2IHQ A;  2VV2 A;  1ZH7 A;  2VV4 B;  2ACL B;  3KBA A;  3KYT A;  1G1U A;  3ADV A;  4MGD A;  1LBD A;  3W0I A;  2B50 A;  3F5C B;  4XTA A;  1G50 A;  2ZBS A;  4RMD A;  4RZE A;  3TY0 A;  1XIU A;  5APK A;  1QKM A;  2OUZ A;  5EGV A;  1I7G A;  1M13 A;  1Y9R A;  3BEJ A;  3W0J A;  3X1I A;  2NXX A;  2YFE A;  2AMB A;  5EJV A;  3VT6 A;  2GPO A;  3ERD A;  4WPF A;  4POJ A;  1PZL A;  1A28 A;  1P8D A;  2OVH A;  3OMQ A;  3WMH A;  1T7T A;  3KPZ A;  4OLM A;  5DYD A;  5DZ3 A;  5APJ A;  5CJ6 A;  2AM9 A;  2ZL9 A;  2Q70 A;  3SP6 A;  3WWR A;  4DMA A;  3UP0 A;  5DRM A;  1XPC A;  4OEZ A;  3UUA A;  2P1U A;  5JJM B;  2PIP L;  3WT5 A;  3IPQ A;  3F5C A;  4IS8 A;  2PIV A;  2ZAS A;  1YYE A;  1FD0 A;  3VJH A;  1GWQ A;  1PQ9 A;  2QTU A;  1FM9 A;  2VV3 A;  2HVC A;  2B23 A;  3HM1 A;  2R40 D;  3KMZ A;  4OIL A;  5GIC A;  3A9E B;  3F7D A;  1H9U A;  3DZU D;  2JF9 A;  2BJ4 A;  2HCD A;  1T79 A;  1K74 A;  2YJA B;  4Q13 A;  4XHD A;  5DZ1 A;  4OFR A;  5DMC A;  5DVC A;  3JZB A;  4REE A;  3BC5 A;  3ADT A;  1XDK A;  3E7C A;  3X31 A;  5C4O A;  2NV7 A;  4ZNW A;  2ZK3 A;  4IV4 A;  4QM0 A;  3OGT A;  5ACC A;  1X76 A;  1P93 A;  2I4J A;  5E19 A;  4YT1 A;  2F4B A;  1U3S A;  1G2N A;  3GD2 A;  5DWL A;  5E0W A;  2J14 A;  2I0J A;  2OCF A;  2PIT A;  4MG8 A;  1XLS A;  4XI3 A;  3B5R A;  3W0G A;  2QH6 A;  2ZKC A;  3A9E A;  1L2I A;  3K23 A;  5DYB A;  1XAP A;  3AUN A;  4FHH A;  3V9T A;  2B1V A;  2Z4B A;  3UVV B;  4TUZ A;  2AXA A;  3B0W A;  4WLB A;  2AMA A;  4RUP A;  4S0T A;  1NUO A;  4M8H A;  3V9V A;  1N4H A;  2Q3Y A;  4OEA A;  3WTQ A;  1SJ0 A;  1ZDU A;  3L0L A;  2ABI A;  2PRG A;  2IOG A;  2Q6S A;  3MNE A;  3OLF A;  1YY4 A;  4OAR A;  3R29 A;  5G42 A;  5L7H A;  4S15 A;  1NAX A;  2Q1V A;  1YOW A;  3ADW A;  1ZKY A;  1Z95 A;  4OZR E;  1XVP B;  3FC6 B;  1UHL B;  3CTB A;  4CI5 A;  4PPS A;  5G46 A;  3K22 A;  3B0Q A;  3VT7 A;  1FCX A;  5EI1 A;  4FNE A;  2ATH A;  4MG7 B;  4PP5 A;  2H79 A;  4N73 A;  2PIR A;  4P6X A;  4S0S A;  3VTC A;  1OVL B;  2E2R A;  2R6W A;  2YHD A;  4OC7 A;  1K4W A;  3VT8 A;  1GWR A;  5KCE A;  2POB A;  1YOK A;  2R40 A;  3GYU A;  3B3K A;  3OSA A;  5KCW A;  1XJ7 A;  5GT4 A;  2PIQ A;  5DXQ A;  4OIV A;  1MVC A;  1KNU A;  2J7Y A;  3HO0 A;  3CQV A;  3RVF A;  4DQM A;  5DKE A;  2XKW A;  3DT3 A;  3SZ1 A;  3HQ5 A;  3VTD A;  4ITF A;  1R5K A;  3GN8 A;  1NHZ A;  2ZK6 A;  3UU7 A;  2XYX A;  4MGA B;  1FM9 D;  4J5W A;  2QGW A;  1S0X A;  5KRM A;  3R2A A;  4NUF A;  2P15 A;  3NSP A;  3LMP A;  2ZNO A;  1K74 D;  2G44 A;  5E15 A;  2ZXZ A;  3OS8 A;  4ZNU A;  3O1E A;  5C4U A;  4MGD B;  3AN3 A;  1N83 A;  2HWQ A;  5AWJ A;  3NSQ A;  2PIU A;  4Q50 A;  3P88 A;  3P0U A;  1PQC A;  4NB6 A;  3V3E A;  3H52 A;  3VRT A;  5KCD A;  3CS6 A;  3KDU A;  5DWG A;  4F9M A;  4ZJR A;  1E3K A;  1Z5X E;  3B67 A;  1YIM A;  2QXM A;  2PJL A;  1SR7 A;  5M96 A;  5IXK A;  3WFG A;  4FHI A;  3RY9 A;  3WJ4 A;  2BAW A;  1ZUC A;  1FM6 A;  2I4P A;  4OKB A;  4J5W C;  2OZ7 A;  5DVV A;  5DUE A;  4A2J A;  5DLR A;  5G44 A;  5FQP A;  3L3Z A;  1XOW A;  3OS8 C;  4IQR A;  1TXI A;  4LTW A;  1EXX A;  2ZXM A;  3BQD A;  2I4Z A;  4JYH A;  2ZK5 A;  4REF A;  3VHW A;  2W8Y A;  2QZO A;  2HWR A;  3DY6 A;  1XQ3 A;  4IVW A;  3B66 A;  2AB2 A;  3A78 A;  4XT9 A;  1T65 A;  5DP0 A;  4LNW A;  2O4R A;  3DR1 A;  5C4T A;  4FGY A;  5DMF A;  2BJ4 B;  3Q95 B;  4OKT A;  4YMQ A;  3R8A A;  2PIW A;  2AA2 A;  2QE4 A;  3VI8 A;  4G1D A;  2YAT A;  2JJ3 A;  1XDK B;  3FLI A;  4YPQ A;  1T74 A;  5DXE A;  1S19 A;  2H77 A;  2YLQ A;  3L0E A;  3N00 A;  3U9Q A;  3P89 A;  5DXB A;  3OZ0 A;  1NDE A;  2AA7 A;  1SQN A;  3HLV A;  4QL8 A;  3FEJ A;  5H1E A;  3FUG A;  1NAV A;  4YNK A;  1U3R A;  4MG8 B;  2ZMH A;  3CWD A;  5DX3 A;  1VJB A;  1FBY A;  3FEI A;  4Y29 A;  4OH5 A;  1MV9 A;  4DM8 A;  3A40 X;  3Q95 A;  1FCY A;  1KKQ A;  4RAK A;  4OZT E;  4K4J A;  5KRA A;  4PP6 A;  1LV2 A;  4TUZ B;  3V4A A;  2PNU A;  3G9E A;  5AVI A;  4E4K A;  2P4Y A;  5EC9 A;  3ZR7 A;  3WGP A;  1XNN A;  2LBD A;  1T5Z A;  3R8I A;  2AX6 A;  1XP9 A;  3H0A D;  4OED A;  1ERR A;  5IZ0 A;  2ZK1 A;  2O4J A;  4PPP A;  2ZXN A;  3IMY A;  4WVD A;  5GID A;  5A86 A;  4CSJ A;  4JGV A;  4R06 A;  1FCZ A;  3IA6 A;  5AAU A;  3ET2 A;  3QT0 A;  5L7G A;  4WHG A;  3UUD B;  4IA7 A;  4G20 A;  4POH A;  5LWP A;  1DKF A;  5DXK A;  3ZQT A;  4DOR A;  5KRI A;  2ZK2 A;  2YLO A;  2ZMI A;  3A2J A;  1SKX A;  5JY3 A;  5KRJ A;  5B41 A;  5HYK A;  3PBA A;  4IA2 A;  1X7J A;  4OJ4 A;  4UDC A;  5I4V A;  2Q6J A;  5KRK A;  3L03 A;  3CS8 A;  5KD9 A;  4MG9 A;  3B0T A;  3VN2 A;  3S9S A;  1IE8 A;  1YMT A;  4IVY A;  2ZK4 A;  5EHJ A;  3PCU A;  1XZX X;  4KZI A;  1FM6 D;  1NRL A;  2Q7L A;  1PDU A;  2OVM A;  2ZY0 A;  3FXV A;  4S14 A;  5C4S A;  5KYA A;  2FAI A;  3DCT A;  3VT9 A;  4ZN7 A;  4ONI A;  1N46 A;  4RME A;  3OMP A;  1U3Q A;  4N1Y A;  4P6W A;  3UUD A;  2GPV A;  4QK4 A;  1E3G A;  3VSO A;  1UPW A;  2ZLC A;  3MNP A;  4N8R A;  2XYJ A;  1X78 A;  3A3Z X;  3GWS X;  4XLD A;  5DUG A;  3VT5 A;  3AN4 A;  4PLD A;  2Q5S A;  1YJE A;  4PLE A;  2AX8 A;  1R6G A;  3UU7 B;  5KCT A;  3OAP A;  5DZ0 A;  5G5W A;  3ADX A;  2ZFX A;  4IA1 A;  1S9P A;  1I37 A;  2JFA A;  2VV1 A;  4LNX A;  4OIU A;  4ZNT A;  3TX7 B;  1RKH A;  5DU5 A;  1ZDT A;  4RZF A;  2J4A A;  2QGT A;  2Q59 A;  2V0V A;  4BCR A;  3SP9 A;  3KWY A;  3E00 D;  3W0C A;  1X7B A;  2Q5P A;  3UUC A;  4G21 A;  3W5T A;  2ZNQ A;  1RK3 A;  1NQ1 A;  4FN9 A;  4RE8 A;  3WT7 A;  3RUU A;  3AZ2 A;  3IXP A;  5AWK A;  3OZJ A;  2ZNN A;  4IV2 A;  4J26 A;  3D90 A;  2O9I A;  3H0A A;  4UDD A;  5FQS A;  2A3I A;  2AA5 A;  4LSJ A;  4RUJ A;  2P7G A;  3OOK A;  4OFU A;  3B0R A;  3WJ5 A;  1XV9 B;  4JYG A;  1K7L A;  3A2I A;  3OMK A;  3K8S A;  5DKG A;  3CDP A;  3KMG A;  1IE9 A;  4X1G A;  1XQC A;  3G8O A;  2AO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...