1FIBA

Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound to calcium at ph 6.0
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
249
structure length
249
Chain Sequence
QIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA-FIBRINOGEN CARBOXYL TERMINAL FRAGMENT
publication title Crystal structure of a 30 kDa C-terminal fragment from the gamma chain of human fibrinogen.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood coagulation factor
total genus 79
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 1996-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fibA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fibA02
2J3FA 2XNXB 2J61B 1FIBA 3H32C 2FIBA 2HLOB 3GHGC 1N73B 2HODC 3BVHC 4M7HA 1LT9C 1RF0B 4NYTA 1N86C 1RE4B 1Z3SA 1FZFC 1RF1B 2JHKF 4JZCA 1M1JC 2J3FD 2FFDB 1FZFB 1LWUB 2Z4EC 1FIDA 1FZAB 1FZBC 3H32B 3E1IC 2JHLF 1FZBB 2J61A 2OYIC 2H43C 2OYHC 4JYOX 1LTJC 2HPCC 2J0YA 1RE3C 2HODB 3BVHB 1FICA 1LT9B 2D39A 1N86B 2J5ZA 2JHHC 1FZGC 2J3GA 2J3OA 1M1JB 4EPUA 2J0GA 4ZFGA 1FZCC 2Z4EB 2WNPF 1FZEC 3FIBA 2J64A 2XNXC 4R9TA 1FZCB 2JHMF 1N73C 3E1IB 1FZEB 2OYIB 2H43B 4R9JA 2OYHB 1LTJB 2GY7A 3HUSC 2HPCB 1RE3B 4M7FA 1JC9A 2J2PA 1RF0C 2J60A 2Q9IC 1RE4C 2J0HA 3HUSB 1RF1C 2J1GA 1FZGB 1FZDA 2Q9IB 2FFDC 1LWUC 1Z3UA 2JHIF 2HLOC 2J3UA 1FZAC
chains in the Genus database with same CATH superfamily
2J3FA 2XNXB 2J61B 1FIBA 3H32C 2FIBA 2HLOB 3GHGC 1N73B 2HODC 3GHGB 3BVHC 4M7HA 1LT9C 1RF0B 4NYTA 1N86C 1RE4B 1Z3SA 1FZFC 1RF1B 2JHKF 4JZCA 1M1JC 2J3FD 2FFDB 1FZFB 1LWUB 2Z4EC 1FIDA 1FZAB 1FZBC 3H32B 3E1IC 2JHLF 1FZBB 2J61A 2OYIC 2H43C 2OYHC 4JYOX 1LTJC 2HPCC 2J0YA 1RE3C 2HODB 3BVHB 1FICA 1LT9B 2D39A 1N86B 2J5ZA 2JHHC 1FZGC 2J3GA 2J3OA 1M1JB 4EPUA 2J0GA 4ZFGA 1FZCC 2Z4EB 2WNPF 1FZEC 3FIBA 2J64A 2XNXC 4R9TA 1FZCB 2JHMF 1N73C 3E1IB 1FZEB 2OYIB 2H43B 4R9JA 2OYHB 1LTJB 2GY7A 3HUSC 2HPCB 1RE3B 4M7FA 1JC9A 2J2PA 1RF0C 2J60A 2Q9IC 1RE4C 2J0HA 3HUSB 1RF1C 2J1GA 1FZGB 1FZDA 2Q9IB 2FFDC 1LWUC 1Z3UA 2JHIF 2HLOC 2J3UA 1FZAC
chains in the Genus database with same CATH topology
2J3FA 2XNXB 2J61B 1FIBA 3H32C 2FIBA 2HLOB 3GHGC 1N73B 2HODC 3BVHC 4M7HA 1LT9C 1RF0B 4NYTA 1N86C 1RE4B 1Z3SA 1FZFC 1RF1B 2JHKF 4JZCA 1M1JC 2J3FD 2FFDB 1FZFB 1LWUB 2Z4EC 1FIDA 1FZAB 1FZBC 3H32B 3E1IC 2JHLF 1FZBB 2J61A 2OYIC 2H43C 2OYHC 4JYOX 1LTJC 2HPCC 2J0YA 1RE3C 2HODB 3BVHB 1FICA 1LT9B 2D39A 1N86B 2J5ZA 2JHHC 1FZGC 2J3GA 2J3OA 1M1JB 4EPUA 2J0GA 4ZFGA 1FZCC 2Z4EB 2WNPF 1FZEC 3FIBA 2J64A 2XNXC 4R9TA 1FZCB 2JHMF 1N73C 3E1IB 1FZEB 2OYIB 2H43B 4R9JA 2OYHB 1LTJB 2GY7A 3HUSC 2HPCB 1RE3B 4M7FA 1JC9A 2J2PA 1RF0C 2J60A 2Q9IC 1RE4C 2J0HA 3HUSB 1RF1C 2J1GA 1FZGB 1FZDA 2Q9IB 2FFDC 1LWUC 1Z3UA 2JHIF 2HLOC 2J3UA 1FZAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3F A;  2XNX B;  2J61 B;  1FIB A;  3H32 C;  2FIB A;  2HLO B;  3GHG C;  1N73 B;  2HOD C;  3BVH C;  4M7H A;  1LT9 C;  1RF0 B;  4NYT A;  1N86 C;  1RE4 B;  1Z3S A;  1FZF C;  1RF1 B;  2JHK F;  4JZC A;  1M1J C;  2J3F D;  2FFD B;  1FZF B;  1LWU B;  2Z4E C;  1FID A;  1FZA B;  1FZB C;  3H32 B;  3E1I C;  2JHL F;  1FZB B;  2J61 A;  2OYI C;  2H43 C;  2OYH C;  4JYO X;  1LTJ C;  2HPC C;  2J0Y A;  1RE3 C;  2HOD B;  3BVH B;  1FIC A;  1LT9 B;  2D39 A;  1N86 B;  2J5Z A;  2JHH C;  1FZG C;  2J3G A;  2J3O A;  1M1J B;  4EPU A;  2J0G A;  4ZFG A;  1FZC C;  2Z4E B;  2WNP F;  1FZE C;  3FIB A;  2J64 A;  2XNX C;  4R9T A;  1FZC B;  2JHM F;  1N73 C;  3E1I B;  1FZE B;  2OYI B;  2H43 B;  4R9J A;  2OYH B;  1LTJ B;  2GY7 A;  3HUS C;  2HPC B;  1RE3 B;  4M7F A;  1JC9 A;  2J2P A;  1RF0 C;  2J60 A;  2Q9I C;  1RE4 C;  2J0H A;  3HUS B;  1RF1 C;  2J1G A;  1FZG B;  1FZD A;  2Q9I B;  2FFD C;  1LWU C;  1Z3U A;  2JHI F;  2HLO C;  2J3U A;  1FZA C; 
#chains in the Genus database with same CATH topology
 2J3F A;  2XNX B;  2J61 B;  1FIB A;  3H32 C;  2FIB A;  2HLO B;  3GHG C;  1N73 B;  2HOD C;  3GHG B;  3BVH C;  4M7H A;  1LT9 C;  1RF0 B;  4NYT A;  1N86 C;  1RE4 B;  1Z3S A;  1FZF C;  1RF1 B;  2JHK F;  4JZC A;  1M1J C;  2J3F D;  2FFD B;  1FZF B;  1LWU B;  2Z4E C;  1FID A;  1FZA B;  1FZB C;  3H32 B;  3E1I C;  2JHL F;  1FZB B;  2J61 A;  2OYI C;  2H43 C;  2OYH C;  4JYO X;  1LTJ C;  2HPC C;  2J0Y A;  1RE3 C;  2HOD B;  3BVH B;  1FIC A;  1LT9 B;  2D39 A;  1N86 B;  2J5Z A;  2JHH C;  1FZG C;  2J3G A;  2J3O A;  1M1J B;  4EPU A;  2J0G A;  4ZFG A;  1FZC C;  2Z4E B;  2WNP F;  1FZE C;  3FIB A;  2J64 A;  2XNX C;  4R9T A;  1FZC B;  2JHM F;  1N73 C;  3E1I B;  1FZE B;  2OYI B;  2H43 B;  4R9J A;  2OYH B;  1LTJ B;  2GY7 A;  3HUS C;  2HPC B;  1RE3 B;  4M7F A;  1JC9 A;  2J2P A;  1RF0 C;  2J60 A;  2Q9I C;  1RE4 C;  2J0H A;  3HUS B;  1RF1 C;  2J1G A;  1FZG B;  1FZD A;  2Q9I B;  2FFD C;  1LWU C;  1Z3U A;  2JHI F;  2HLO C;  2J3U A;  1FZA C; 
#chains in the Genus database with same CATH homology
 2J3F A;  2XNX B;  2J61 B;  1FIB A;  3H32 C;  2FIB A;  2HLO B;  3GHG C;  1N73 B;  2HOD C;  3BVH C;  4M7H A;  1LT9 C;  1RF0 B;  4NYT A;  1N86 C;  1RE4 B;  1Z3S A;  1FZF C;  1RF1 B;  2JHK F;  4JZC A;  1M1J C;  2J3F D;  2FFD B;  1FZF B;  1LWU B;  2Z4E C;  1FID A;  1FZA B;  1FZB C;  3H32 B;  3E1I C;  2JHL F;  1FZB B;  2J61 A;  2OYI C;  2H43 C;  2OYH C;  4JYO X;  1LTJ C;  2HPC C;  2J0Y A;  1RE3 C;  2HOD B;  3BVH B;  1FIC A;  1LT9 B;  2D39 A;  1N86 B;  2J5Z A;  2JHH C;  1FZG C;  2J3G A;  2J3O A;  1M1J B;  4EPU A;  2J0G A;  4ZFG A;  1FZC C;  2Z4E B;  2WNP F;  1FZE C;  3FIB A;  2J64 A;  2XNX C;  4R9T A;  1FZC B;  2JHM F;  1N73 C;  3E1I B;  1FZE B;  2OYI B;  2H43 B;  4R9J A;  2OYH B;  1LTJ B;  2GY7 A;  3HUS C;  2HPC B;  1RE3 B;  4M7F A;  1JC9 A;  2J2P A;  1RF0 C;  2J60 A;  2Q9I C;  1RE4 C;  2J0H A;  3HUS B;  1RF1 C;  2J1G A;  1FZG B;  1FZD A;  2Q9I B;  2FFD C;  1LWU C;  1Z3U A;  2JHI F;  2HLO C;  2J3U A;  1FZA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...