1FIBA

Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound to calcium at ph 6.0
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
249
structure length
249
Chain Sequence
QIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood coagulation factor
molecule keywords GAMMA-FIBRINOGEN CARBOXYL TERMINAL FRAGMENT
publication title Crystal structure of a 30 kDa C-terminal fragment from the gamma chain of human fibrinogen.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 1996-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fibA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fibA02
1FZFC 3FIBA 1FZBC 2JHHC 2GY7A 1RF0C 4M7HA 2HPCC 2J3GA 1RE3B 1LTJC 3E1IC 3BVHB 2HODC 2J61B 4R9TA 1FIBA 2H43C 1FZGB 1RE4B 2HLOC 1LWUB 3H32B 2J64A 2J3FD 1FICA 1FZFB 1FZBB 1RF0B 4R9JA 1N73C 1M1JB 1LTJB 2J2PA 2D39A 1LT9C 3E1IB 1RF1B 4NYTA 1Z3SA 2FFDB 2OYIC 2FIBA 2H43B 2Q9IC 2HLOB 3HUSC 2J5ZA 1FZEC 2J3UA 2JHKF 2J3OA 2J0HA 2HPCB 2JHLF 2OYHC 1JC9A 2J3FA 2J0GA 2HODB 2Z4EC 2JHMF 2OYIB 2Q9IB 4M7FA 3HUSB 2XNXC 3H32C 3GHGC 1FZAC 4EPUA 1FZCC 2JHIF 2J1GA 1N86C 1N73B 1M1JC 2OYHB 1RE3C 2WNPF 1LT9B 2J61A 4JZCA 4JYOX 2Z4EB 2J60A 1RF1C 2J0YA 3BVHC 1Z3UA 2FFDC 2XNXB 1FIDA 1FZEB 1FZGC 1RE4C 1LWUC 1FZAB 4ZFGA 1FZCB 1N86B 1FZDA
chains in the Genus database with same CATH superfamily
1FZFC 3FIBA 1FZBC 2JHHC 2GY7A 1RF0C 4M7HA 2HPCC 2J3GA 1RE3B 1LTJC 3E1IC 3BVHB 2HODC 2J61B 4R9TA 1FIBA 2H43C 1FZGB 1RE4B 2HLOC 1LWUB 3H32B 2J64A 2J3FD 1FICA 1FZFB 1FZBB 1RF0B 4R9JA 1N73C 1M1JB 1LTJB 2J2PA 2D39A 1LT9C 3E1IB 1RF1B 4NYTA 1Z3SA 2FFDB 2OYIC 2FIBA 2H43B 2Q9IC 2HLOB 3HUSC 2J5ZA 1FZEC 2J3UA 2JHKF 2J3OA 2J0HA 2HPCB 2JHLF 2OYHC 1JC9A 2J3FA 2J0GA 2HODB 2Z4EC 2JHMF 2OYIB 2Q9IB 4M7FA 3HUSB 2XNXC 3H32C 3GHGC 1FZAC 4EPUA 1FZCC 2JHIF 2J1GA 1N86C 1N73B 1M1JC 2OYHB 1RE3C 2WNPF 1LT9B 2J61A 4JZCA 4JYOX 2Z4EB 2J60A 1RF1C 2J0YA 3BVHC 1Z3UA 2FFDC 2XNXB 1FIDA 1FZEB 3GHGB 1FZGC 1RE4C 1LWUC 1FZAB 4ZFGA 1FZCB 1N86B 1FZDA
chains in the Genus database with same CATH topology
1FZFC 3FIBA 1FZBC 2JHHC 2GY7A 1RF0C 4M7HA 2HPCC 2J3GA 1RE3B 1LTJC 3E1IC 3BVHB 2HODC 2J61B 4R9TA 1FIBA 2H43C 1FZGB 1RE4B 2HLOC 1LWUB 3H32B 2J64A 2J3FD 1FICA 1FZFB 1FZBB 1RF0B 4R9JA 1N73C 1M1JB 1LTJB 2J2PA 2D39A 1LT9C 3E1IB 1RF1B 4NYTA 1Z3SA 2FFDB 2OYIC 2FIBA 2H43B 2Q9IC 2HLOB 3HUSC 2J5ZA 1FZEC 2J3UA 2JHKF 2J3OA 2J0HA 2HPCB 2JHLF 2OYHC 1JC9A 2J3FA 2J0GA 2HODB 2Z4EC 2JHMF 2OYIB 2Q9IB 4M7FA 3HUSB 2XNXC 3H32C 3GHGC 1FZAC 4EPUA 1FZCC 2JHIF 2J1GA 1N86C 1N73B 1M1JC 2OYHB 1RE3C 2WNPF 1LT9B 2J61A 4JZCA 4JYOX 2Z4EB 2J60A 1RF1C 2J0YA 3BVHC 1Z3UA 2FFDC 2XNXB 1FIDA 1FZEB 1FZGC 1RE4C 1LWUC 1FZAB 4ZFGA 1FZCB 1N86B 1FZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZF C;  3FIB A;  1FZB C;  2JHH C;  2GY7 A;  1RF0 C;  4M7H A;  2HPC C;  2J3G A;  1RE3 B;  1LTJ C;  3E1I C;  3BVH B;  2HOD C;  2J61 B;  4R9T A;  1FIB A;  2H43 C;  1FZG B;  1RE4 B;  2HLO C;  1LWU B;  3H32 B;  2J64 A;  2J3F D;  1FIC A;  1FZF B;  1FZB B;  1RF0 B;  4R9J A;  1N73 C;  1M1J B;  1LTJ B;  2J2P A;  2D39 A;  1LT9 C;  3E1I B;  1RF1 B;  4NYT A;  1Z3S A;  2FFD B;  2OYI C;  2FIB A;  2H43 B;  2Q9I C;  2HLO B;  3HUS C;  2J5Z A;  1FZE C;  2J3U A;  2JHK F;  2J3O A;  2J0H A;  2HPC B;  2JHL F;  2OYH C;  1JC9 A;  2J3F A;  2J0G A;  2HOD B;  2Z4E C;  2JHM F;  2OYI B;  2Q9I B;  4M7F A;  3HUS B;  2XNX C;  3H32 C;  3GHG C;  1FZA C;  4EPU A;  1FZC C;  2JHI F;  2J1G A;  1N86 C;  1N73 B;  1M1J C;  2OYH B;  1RE3 C;  2WNP F;  1LT9 B;  2J61 A;  4JZC A;  4JYO X;  2Z4E B;  2J60 A;  1RF1 C;  2J0Y A;  3BVH C;  1Z3U A;  2FFD C;  2XNX B;  1FID A;  1FZE B;  1FZG C;  1RE4 C;  1LWU C;  1FZA B;  4ZFG A;  1FZC B;  1N86 B;  1FZD A; 
#chains in the Genus database with same CATH topology
 1FZF C;  3FIB A;  1FZB C;  2JHH C;  2GY7 A;  1RF0 C;  4M7H A;  2HPC C;  2J3G A;  1RE3 B;  1LTJ C;  3E1I C;  3BVH B;  2HOD C;  2J61 B;  4R9T A;  1FIB A;  2H43 C;  1FZG B;  1RE4 B;  2HLO C;  1LWU B;  3H32 B;  2J64 A;  2J3F D;  1FIC A;  1FZF B;  1FZB B;  1RF0 B;  4R9J A;  1N73 C;  1M1J B;  1LTJ B;  2J2P A;  2D39 A;  1LT9 C;  3E1I B;  1RF1 B;  4NYT A;  1Z3S A;  2FFD B;  2OYI C;  2FIB A;  2H43 B;  2Q9I C;  2HLO B;  3HUS C;  2J5Z A;  1FZE C;  2J3U A;  2JHK F;  2J3O A;  2J0H A;  2HPC B;  2JHL F;  2OYH C;  1JC9 A;  2J3F A;  2J0G A;  2HOD B;  2Z4E C;  2JHM F;  2OYI B;  2Q9I B;  4M7F A;  3HUS B;  2XNX C;  3H32 C;  3GHG C;  1FZA C;  4EPU A;  1FZC C;  2JHI F;  2J1G A;  1N86 C;  1N73 B;  1M1J C;  2OYH B;  1RE3 C;  2WNP F;  1LT9 B;  2J61 A;  4JZC A;  4JYO X;  2Z4E B;  2J60 A;  1RF1 C;  2J0Y A;  3BVH C;  1Z3U A;  2FFD C;  2XNX B;  1FID A;  1FZE B;  3GHG B;  1FZG C;  1RE4 C;  1LWU C;  1FZA B;  4ZFG A;  1FZC B;  1N86 B;  1FZD A; 
#chains in the Genus database with same CATH homology
 1FZF C;  3FIB A;  1FZB C;  2JHH C;  2GY7 A;  1RF0 C;  4M7H A;  2HPC C;  2J3G A;  1RE3 B;  1LTJ C;  3E1I C;  3BVH B;  2HOD C;  2J61 B;  4R9T A;  1FIB A;  2H43 C;  1FZG B;  1RE4 B;  2HLO C;  1LWU B;  3H32 B;  2J64 A;  2J3F D;  1FIC A;  1FZF B;  1FZB B;  1RF0 B;  4R9J A;  1N73 C;  1M1J B;  1LTJ B;  2J2P A;  2D39 A;  1LT9 C;  3E1I B;  1RF1 B;  4NYT A;  1Z3S A;  2FFD B;  2OYI C;  2FIB A;  2H43 B;  2Q9I C;  2HLO B;  3HUS C;  2J5Z A;  1FZE C;  2J3U A;  2JHK F;  2J3O A;  2J0H A;  2HPC B;  2JHL F;  2OYH C;  1JC9 A;  2J3F A;  2J0G A;  2HOD B;  2Z4E C;  2JHM F;  2OYI B;  2Q9I B;  4M7F A;  3HUS B;  2XNX C;  3H32 C;  3GHG C;  1FZA C;  4EPU A;  1FZC C;  2JHI F;  2J1G A;  1N86 C;  1N73 B;  1M1J C;  2OYH B;  1RE3 C;  2WNP F;  1LT9 B;  2J61 A;  4JZC A;  4JYO X;  2Z4E B;  2J60 A;  1RF1 C;  2J0Y A;  3BVH C;  1Z3U A;  2FFD C;  2XNX B;  1FID A;  1FZE B;  1FZG C;  1RE4 C;  1LWU C;  1FZA B;  4ZFG A;  1FZC B;  1N86 B;  1FZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...