1FZGB

Crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
303
structure length
303
Chain Sequence
VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood coagulation
molecule keywords FIBRINOGEN
publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
total genus 92
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 1999-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzgB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzgB02
2Z4EB 2JHMF 2FIBA 2H43B 2OYIC 1FIDA 2J61A 2J0GA 1FZBC 1N86C 1RE3B 2HPCC 4M7FA 4R9TA 2HLOB 2FFDC 4R9JA 2OYIB 1LTJC 2D39A 3BVHB 2J60A 4ZFGA 1RF0C 1N86B 2HPCB 4JYOX 1FZFB 1M1JB 2J0YA 2Q9IC 4EPUA 2OYHC 2XNXB 2J3UA 3GHGC 2HODC 1RF0B 2J3OA 4M7HA 1Z3UA 1FIBA 3HUSC 1FZBB 1FZCC 1FZGC 2J64A 1RF1C 4NYTA 3FIBA 1LT9C 1FZEC 1LWUC 3E1IC 2GY7A 2FFDB 2JHHC 1JC9A 2H43C 2WNPF 4JZCA 3HUSB 2JHKF 3H32C 1LTJB 1RE3C 1FZGB 2J5ZA 1RE4C 2JHIF 3E1IB 2HLOC 2J0HA 2Q9IB 2OYHB 1N73C 1FZAC 2J1GA 3H32B 3BVHC 2HODB 1RE4B 1FICA 2Z4EC 2J2PA 1FZFC 1M1JC 2JHLF 2J3FD 2J61B 1FZCB 1N73B 2XNXC 1RF1B 1FZAB 1FZDA 2J3FA 1LT9B 1FZEB 1LWUB 1Z3SA 2J3GA
chains in the Genus database with same CATH superfamily
2Z4EB 2JHMF 2FIBA 2H43B 2OYIC 1FIDA 2J61A 2J0GA 1FZBC 1N86C 1RE3B 2HPCC 4M7FA 4R9TA 2HLOB 2FFDC 4R9JA 2OYIB 1LTJC 2D39A 3BVHB 2J60A 4ZFGA 1RF0C 1N86B 2HPCB 4JYOX 1FZFB 1M1JB 2J0YA 2Q9IC 4EPUA 2OYHC 2XNXB 2J3UA 3GHGC 2HODC 1RF0B 2J3OA 4M7HA 1Z3UA 1FIBA 3HUSC 1FZBB 1FZCC 1FZGC 2J64A 1RF1C 4NYTA 3FIBA 1LT9C 1FZEC 1LWUC 3GHGB 3E1IC 2GY7A 2FFDB 2JHHC 1JC9A 2H43C 2WNPF 4JZCA 3HUSB 2JHKF 3H32C 1LTJB 1RE3C 1FZGB 2J5ZA 1RE4C 2JHIF 3E1IB 2HLOC 2J0HA 2Q9IB 2OYHB 1N73C 1FZAC 2J1GA 3H32B 3BVHC 2HODB 1RE4B 1FICA 2Z4EC 2J2PA 1FZFC 1M1JC 2JHLF 2J3FD 2J61B 1FZCB 1N73B 2XNXC 1RF1B 1FZAB 1FZDA 2J3FA 1LT9B 1FZEB 1LWUB 1Z3SA 2J3GA
chains in the Genus database with same CATH topology
2Z4EB 2JHMF 2FIBA 2H43B 2OYIC 1FIDA 2J61A 2J0GA 1FZBC 1N86C 1RE3B 2HPCC 4M7FA 4R9TA 2HLOB 2FFDC 4R9JA 2OYIB 1LTJC 2D39A 3BVHB 2J60A 4ZFGA 1RF0C 1N86B 2HPCB 4JYOX 1FZFB 1M1JB 2J0YA 2Q9IC 4EPUA 2OYHC 2XNXB 2J3UA 3GHGC 2HODC 1RF0B 2J3OA 4M7HA 1Z3UA 1FIBA 3HUSC 1FZBB 1FZCC 1FZGC 2J64A 1RF1C 4NYTA 3FIBA 1LT9C 1FZEC 1LWUC 3E1IC 2GY7A 2FFDB 2JHHC 1JC9A 2H43C 2WNPF 4JZCA 3HUSB 2JHKF 3H32C 1LTJB 1RE3C 1FZGB 2J5ZA 1RE4C 2JHIF 3E1IB 2HLOC 2J0HA 2Q9IB 2OYHB 1N73C 1FZAC 2J1GA 3H32B 3BVHC 2HODB 1RE4B 1FICA 2Z4EC 2J2PA 1FZFC 1M1JC 2JHLF 2J3FD 2J61B 1FZCB 1N73B 2XNXC 1RF1B 1FZAB 1FZDA 2J3FA 1LT9B 1FZEB 1LWUB 1Z3SA 2J3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4E B;  2JHM F;  2FIB A;  2H43 B;  2OYI C;  1FID A;  2J61 A;  2J0G A;  1FZB C;  1N86 C;  1RE3 B;  2HPC C;  4M7F A;  4R9T A;  2HLO B;  2FFD C;  4R9J A;  2OYI B;  1LTJ C;  2D39 A;  3BVH B;  2J60 A;  4ZFG A;  1RF0 C;  1N86 B;  2HPC B;  4JYO X;  1FZF B;  1M1J B;  2J0Y A;  2Q9I C;  4EPU A;  2OYH C;  2XNX B;  2J3U A;  3GHG C;  2HOD C;  1RF0 B;  2J3O A;  4M7H A;  1Z3U A;  1FIB A;  3HUS C;  1FZB B;  1FZC C;  1FZG C;  2J64 A;  1RF1 C;  4NYT A;  3FIB A;  1LT9 C;  1FZE C;  1LWU C;  3E1I C;  2GY7 A;  2FFD B;  2JHH C;  1JC9 A;  2H43 C;  2WNP F;  4JZC A;  3HUS B;  2JHK F;  3H32 C;  1LTJ B;  1RE3 C;  1FZG B;  2J5Z A;  1RE4 C;  2JHI F;  3E1I B;  2HLO C;  2J0H A;  2Q9I B;  2OYH B;  1N73 C;  1FZA C;  2J1G A;  3H32 B;  3BVH C;  2HOD B;  1RE4 B;  1FIC A;  2Z4E C;  2J2P A;  1FZF C;  1M1J C;  2JHL F;  2J3F D;  2J61 B;  1FZC B;  1N73 B;  2XNX C;  1RF1 B;  1FZA B;  1FZD A;  2J3F A;  1LT9 B;  1FZE B;  1LWU B;  1Z3S A;  2J3G A; 
#chains in the Genus database with same CATH topology
 2Z4E B;  2JHM F;  2FIB A;  2H43 B;  2OYI C;  1FID A;  2J61 A;  2J0G A;  1FZB C;  1N86 C;  1RE3 B;  2HPC C;  4M7F A;  4R9T A;  2HLO B;  2FFD C;  4R9J A;  2OYI B;  1LTJ C;  2D39 A;  3BVH B;  2J60 A;  4ZFG A;  1RF0 C;  1N86 B;  2HPC B;  4JYO X;  1FZF B;  1M1J B;  2J0Y A;  2Q9I C;  4EPU A;  2OYH C;  2XNX B;  2J3U A;  3GHG C;  2HOD C;  1RF0 B;  2J3O A;  4M7H A;  1Z3U A;  1FIB A;  3HUS C;  1FZB B;  1FZC C;  1FZG C;  2J64 A;  1RF1 C;  4NYT A;  3FIB A;  1LT9 C;  1FZE C;  1LWU C;  3GHG B;  3E1I C;  2GY7 A;  2FFD B;  2JHH C;  1JC9 A;  2H43 C;  2WNP F;  4JZC A;  3HUS B;  2JHK F;  3H32 C;  1LTJ B;  1RE3 C;  1FZG B;  2J5Z A;  1RE4 C;  2JHI F;  3E1I B;  2HLO C;  2J0H A;  2Q9I B;  2OYH B;  1N73 C;  1FZA C;  2J1G A;  3H32 B;  3BVH C;  2HOD B;  1RE4 B;  1FIC A;  2Z4E C;  2J2P A;  1FZF C;  1M1J C;  2JHL F;  2J3F D;  2J61 B;  1FZC B;  1N73 B;  2XNX C;  1RF1 B;  1FZA B;  1FZD A;  2J3F A;  1LT9 B;  1FZE B;  1LWU B;  1Z3S A;  2J3G A; 
#chains in the Genus database with same CATH homology
 2Z4E B;  2JHM F;  2FIB A;  2H43 B;  2OYI C;  1FID A;  2J61 A;  2J0G A;  1FZB C;  1N86 C;  1RE3 B;  2HPC C;  4M7F A;  4R9T A;  2HLO B;  2FFD C;  4R9J A;  2OYI B;  1LTJ C;  2D39 A;  3BVH B;  2J60 A;  4ZFG A;  1RF0 C;  1N86 B;  2HPC B;  4JYO X;  1FZF B;  1M1J B;  2J0Y A;  2Q9I C;  4EPU A;  2OYH C;  2XNX B;  2J3U A;  3GHG C;  2HOD C;  1RF0 B;  2J3O A;  4M7H A;  1Z3U A;  1FIB A;  3HUS C;  1FZB B;  1FZC C;  1FZG C;  2J64 A;  1RF1 C;  4NYT A;  3FIB A;  1LT9 C;  1FZE C;  1LWU C;  3E1I C;  2GY7 A;  2FFD B;  2JHH C;  1JC9 A;  2H43 C;  2WNP F;  4JZC A;  3HUS B;  2JHK F;  3H32 C;  1LTJ B;  1RE3 C;  1FZG B;  2J5Z A;  1RE4 C;  2JHI F;  3E1I B;  2HLO C;  2J0H A;  2Q9I B;  2OYH B;  1N73 C;  1FZA C;  2J1G A;  3H32 B;  3BVH C;  2HOD B;  1RE4 B;  1FIC A;  2Z4E C;  2J2P A;  1FZF C;  1M1J C;  2JHL F;  2J3F D;  2J61 B;  1FZC B;  1N73 B;  2XNX C;  1RF1 B;  1FZA B;  1FZD A;  2J3F A;  1LT9 B;  1FZE B;  1LWU B;  1Z3S A;  2J3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...