1FZGB

Crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
303
structure length
303
Chain Sequence
VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN
publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 92
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 1999-01-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzgB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzgB02
1Z3SA 1FZGC 2D39A 2Q9IC 2J0HA 2JHLF 2Z4EB 1RE4C 2J5ZA 2HPCC 4EPUA 2OYIC 1LTJC 3BVHC 2XNXB 1FZFC 1FZGB 2JHMF 4JYOX 2FFDC 1RE4B 2J0YA 2HPCB 1N73C 2OYHC 1RF1B 2HLOC 2OYIB 3FIBA 1LTJB 4ZFGA 3BVHB 1FZFB 2HODC 1FZEC 2FFDB 1N73B 2OYHB 4M7HA 1RF1C 2HLOB 4NYTA 1FZDA 1FZCC 2HODB 2H43C 2J60A 3H32B 1FZEB 1FZAB 2JHIF 2J3FD 2JHKF 1FIDA 1FZCB 2J3GA 2H43B 2J2PA 3H32C 1LT9C 1FIBA 1FZAC 3E1IB 1FZBC 1RF0C 2J61A 3HUSB 2WNPF 2J64A 1LWUC 1M1JB 1LT9B 2GY7A 3E1IC 2J3FA 1RE3C 1JC9A 2J3OA 1FZBB 1RF0B 2J61B 2JHHC 1N86C 3HUSC 2J1GA 1LWUB 1M1JC 2FIBA 2J3UA 1RE3B 2J0GA 4M7FA 1N86B 2Q9IB 2Z4EC 1FICA 4R9JA 1Z3UA 4JZCA 2XNXC 3GHGC 4R9TA
chains in the Genus database with same CATH superfamily
1Z3SA 1FZGC 2D39A 2Q9IC 2J0HA 2JHLF 2Z4EB 1RE4C 2J5ZA 2HPCC 4EPUA 2OYIC 1LTJC 3BVHC 2XNXB 1FZFC 3GHGB 1FZGB 2JHMF 4JYOX 2FFDC 1RE4B 2J0YA 2HPCB 1N73C 2OYHC 1RF1B 2HLOC 2OYIB 3FIBA 1LTJB 4ZFGA 3BVHB 1FZFB 2HODC 1FZEC 2FFDB 1N73B 2OYHB 4M7HA 1RF1C 2HLOB 4NYTA 1FZDA 1FZCC 2HODB 2H43C 2J60A 3H32B 1FZEB 1FZAB 2JHIF 2J3FD 2JHKF 1FIDA 1FZCB 2J3GA 2H43B 2J2PA 3H32C 1LT9C 1FIBA 1FZAC 3E1IB 1FZBC 1RF0C 2J61A 3HUSB 2WNPF 2J64A 1LWUC 1M1JB 1LT9B 2GY7A 3E1IC 2J3FA 1RE3C 1JC9A 2J3OA 1FZBB 1RF0B 2J61B 2JHHC 1N86C 3HUSC 2J1GA 1LWUB 1M1JC 2FIBA 2J3UA 1RE3B 2J0GA 4M7FA 1N86B 2Q9IB 2Z4EC 1FICA 4R9JA 1Z3UA 4JZCA 2XNXC 3GHGC 4R9TA
chains in the Genus database with same CATH topology
1Z3SA 1FZGC 2D39A 2Q9IC 2J0HA 2JHLF 2Z4EB 1RE4C 2J5ZA 2HPCC 4EPUA 2OYIC 1LTJC 3BVHC 2XNXB 1FZFC 1FZGB 2JHMF 4JYOX 2FFDC 1RE4B 2J0YA 2HPCB 1N73C 2OYHC 1RF1B 2HLOC 2OYIB 3FIBA 1LTJB 4ZFGA 3BVHB 1FZFB 2HODC 1FZEC 2FFDB 1N73B 2OYHB 4M7HA 1RF1C 2HLOB 4NYTA 1FZDA 1FZCC 2HODB 2H43C 2J60A 3H32B 1FZEB 1FZAB 2JHIF 2J3FD 2JHKF 1FIDA 1FZCB 2J3GA 2H43B 2J2PA 3H32C 1LT9C 1FIBA 1FZAC 3E1IB 1FZBC 1RF0C 2J61A 3HUSB 2WNPF 2J64A 1LWUC 1M1JB 1LT9B 2GY7A 3E1IC 2J3FA 1RE3C 1JC9A 2J3OA 1FZBB 1RF0B 2J61B 2JHHC 1N86C 3HUSC 2J1GA 1LWUB 1M1JC 2FIBA 2J3UA 1RE3B 2J0GA 4M7FA 1N86B 2Q9IB 2Z4EC 1FICA 4R9JA 1Z3UA 4JZCA 2XNXC 3GHGC 4R9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3S A;  1FZG C;  2D39 A;  2Q9I C;  2J0H A;  2JHL F;  2Z4E B;  1RE4 C;  2J5Z A;  2HPC C;  4EPU A;  2OYI C;  1LTJ C;  3BVH C;  2XNX B;  1FZF C;  1FZG B;  2JHM F;  4JYO X;  2FFD C;  1RE4 B;  2J0Y A;  2HPC B;  1N73 C;  2OYH C;  1RF1 B;  2HLO C;  2OYI B;  3FIB A;  1LTJ B;  4ZFG A;  3BVH B;  1FZF B;  2HOD C;  1FZE C;  2FFD B;  1N73 B;  2OYH B;  4M7H A;  1RF1 C;  2HLO B;  4NYT A;  1FZD A;  1FZC C;  2HOD B;  2H43 C;  2J60 A;  3H32 B;  1FZE B;  1FZA B;  2JHI F;  2J3F D;  2JHK F;  1FID A;  1FZC B;  2J3G A;  2H43 B;  2J2P A;  3H32 C;  1LT9 C;  1FIB A;  1FZA C;  3E1I B;  1FZB C;  1RF0 C;  2J61 A;  3HUS B;  2WNP F;  2J64 A;  1LWU C;  1M1J B;  1LT9 B;  2GY7 A;  3E1I C;  2J3F A;  1RE3 C;  1JC9 A;  2J3O A;  1FZB B;  1RF0 B;  2J61 B;  2JHH C;  1N86 C;  3HUS C;  2J1G A;  1LWU B;  1M1J C;  2FIB A;  2J3U A;  1RE3 B;  2J0G A;  4M7F A;  1N86 B;  2Q9I B;  2Z4E C;  1FIC A;  4R9J A;  1Z3U A;  4JZC A;  2XNX C;  3GHG C;  4R9T A; 
#chains in the Genus database with same CATH topology
 1Z3S A;  1FZG C;  2D39 A;  2Q9I C;  2J0H A;  2JHL F;  2Z4E B;  1RE4 C;  2J5Z A;  2HPC C;  4EPU A;  2OYI C;  1LTJ C;  3BVH C;  2XNX B;  1FZF C;  3GHG B;  1FZG B;  2JHM F;  4JYO X;  2FFD C;  1RE4 B;  2J0Y A;  2HPC B;  1N73 C;  2OYH C;  1RF1 B;  2HLO C;  2OYI B;  3FIB A;  1LTJ B;  4ZFG A;  3BVH B;  1FZF B;  2HOD C;  1FZE C;  2FFD B;  1N73 B;  2OYH B;  4M7H A;  1RF1 C;  2HLO B;  4NYT A;  1FZD A;  1FZC C;  2HOD B;  2H43 C;  2J60 A;  3H32 B;  1FZE B;  1FZA B;  2JHI F;  2J3F D;  2JHK F;  1FID A;  1FZC B;  2J3G A;  2H43 B;  2J2P A;  3H32 C;  1LT9 C;  1FIB A;  1FZA C;  3E1I B;  1FZB C;  1RF0 C;  2J61 A;  3HUS B;  2WNP F;  2J64 A;  1LWU C;  1M1J B;  1LT9 B;  2GY7 A;  3E1I C;  2J3F A;  1RE3 C;  1JC9 A;  2J3O A;  1FZB B;  1RF0 B;  2J61 B;  2JHH C;  1N86 C;  3HUS C;  2J1G A;  1LWU B;  1M1J C;  2FIB A;  2J3U A;  1RE3 B;  2J0G A;  4M7F A;  1N86 B;  2Q9I B;  2Z4E C;  1FIC A;  4R9J A;  1Z3U A;  4JZC A;  2XNX C;  3GHG C;  4R9T A; 
#chains in the Genus database with same CATH homology
 1Z3S A;  1FZG C;  2D39 A;  2Q9I C;  2J0H A;  2JHL F;  2Z4E B;  1RE4 C;  2J5Z A;  2HPC C;  4EPU A;  2OYI C;  1LTJ C;  3BVH C;  2XNX B;  1FZF C;  1FZG B;  2JHM F;  4JYO X;  2FFD C;  1RE4 B;  2J0Y A;  2HPC B;  1N73 C;  2OYH C;  1RF1 B;  2HLO C;  2OYI B;  3FIB A;  1LTJ B;  4ZFG A;  3BVH B;  1FZF B;  2HOD C;  1FZE C;  2FFD B;  1N73 B;  2OYH B;  4M7H A;  1RF1 C;  2HLO B;  4NYT A;  1FZD A;  1FZC C;  2HOD B;  2H43 C;  2J60 A;  3H32 B;  1FZE B;  1FZA B;  2JHI F;  2J3F D;  2JHK F;  1FID A;  1FZC B;  2J3G A;  2H43 B;  2J2P A;  3H32 C;  1LT9 C;  1FIB A;  1FZA C;  3E1I B;  1FZB C;  1RF0 C;  2J61 A;  3HUS B;  2WNP F;  2J64 A;  1LWU C;  1M1J B;  1LT9 B;  2GY7 A;  3E1I C;  2J3F A;  1RE3 C;  1JC9 A;  2J3O A;  1FZB B;  1RF0 B;  2J61 B;  2JHH C;  1N86 C;  3HUS C;  2J1G A;  1LWU B;  1M1J C;  2FIB A;  2J3U A;  1RE3 B;  2J0G A;  4M7F A;  1N86 B;  2Q9I B;  2Z4E C;  1FIC A;  4R9J A;  1Z3U A;  4JZC A;  2XNX C;  3GHG C;  4R9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...