1Z3UA

Structure of the angiopoietin-2 recptor binding domain and identification of surfaces involved in tie2 recognition
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
SFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKANGIKWAAWKGSGYSLKATTMMIRPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Angiopoietin-2
publication title Structure of the angiopoietin-2 receptor binding domain and identification of surfaces involved in Tie2 recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1z3uA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1z3uA02
1FICA 3HUSB 3BVHB 2FFDC 2WNPF 1JC9A 1FZGC 2Z4EC 1Z3SA 4EPUA 1LT9C 1FZEB 1RE4C 2HLOC 2J61A 4ZFGA 1RE4B 3GHGC 4R9TA 1RF0C 1FZFB 1Z3UA 1FIDA 1M1JB 2J60A 2JHIF 2J1GA 4M7HA 2HPCB 2OYIB 2J3GA 1FZEC 2J64A 2J3FA 1RF1B 2H43B 3H32B 2J3OA 2J61B 2JHHC 1LWUB 1FZFC 2J3UA 2J2PA 1M1JC 3FIBA 1LTJB 2JHLF 4M7FA 2HPCC 2OYIC 2FIBA 2XNXB 1FZAB 2HODB 1RE3B 4JYOX 1RF0B 1N86B 2JHKF 2J5ZA 1RF1C 3E1IC 1FZBB 2J0HA 3H32C 2H43C 2GY7A 2D39A 3E1IB 1FIBA 1N73B 2J0GA 1LWUC 2Q9IB 2JHMF 2J3FD 1FZCB 1FZDA 1LTJC 2FFDB 2XNXC 1FZAC 2HODC 1RE3C 1FZGB 2Z4EB 1N86C 1FZBC 1LT9B 4NYTA 1N73C 2HLOB 4JZCA 2Q9IC 4R9JA 2OYHC 3HUSC 3BVHC 1FZCC 2J0YA 2OYHB
chains in the Genus database with same CATH superfamily
1FICA 3HUSB 3BVHB 2FFDC 2WNPF 1JC9A 1FZGC 2Z4EC 1Z3SA 4EPUA 1LT9C 1FZEB 1RE4C 2HLOC 2J61A 4ZFGA 1RE4B 3GHGC 4R9TA 1RF0C 1FZFB 1Z3UA 1FIDA 1M1JB 2J60A 2JHIF 2J1GA 4M7HA 2HPCB 2OYIB 2J3GA 1FZEC 2J64A 2J3FA 1RF1B 2H43B 3H32B 2J3OA 2J61B 2JHHC 1LWUB 1FZFC 2J3UA 2J2PA 1M1JC 3FIBA 1LTJB 2JHLF 4M7FA 2HPCC 2OYIC 2FIBA 2XNXB 1FZAB 2HODB 1RE3B 4JYOX 1RF0B 1N86B 2JHKF 2J5ZA 1RF1C 3E1IC 1FZBB 2J0HA 3H32C 2H43C 2GY7A 2D39A 3E1IB 1FIBA 1N73B 2J0GA 1LWUC 2Q9IB 2JHMF 2J3FD 1FZCB 1FZDA 1LTJC 2FFDB 2XNXC 1FZAC 2HODC 1RE3C 1FZGB 2Z4EB 1N86C 1FZBC 1LT9B 4NYTA 1N73C 2HLOB 4JZCA 2Q9IC 4R9JA 2OYHC 3GHGB 3HUSC 3BVHC 1FZCC 2J0YA 2OYHB
chains in the Genus database with same CATH topology
1FICA 3HUSB 3BVHB 2FFDC 2WNPF 1JC9A 1FZGC 2Z4EC 1Z3SA 4EPUA 1LT9C 1FZEB 1RE4C 2HLOC 2J61A 4ZFGA 1RE4B 3GHGC 4R9TA 1RF0C 1FZFB 1Z3UA 1FIDA 1M1JB 2J60A 2JHIF 2J1GA 4M7HA 2HPCB 2OYIB 2J3GA 1FZEC 2J64A 2J3FA 1RF1B 2H43B 3H32B 2J3OA 2J61B 2JHHC 1LWUB 1FZFC 2J3UA 2J2PA 1M1JC 3FIBA 1LTJB 2JHLF 4M7FA 2HPCC 2OYIC 2FIBA 2XNXB 1FZAB 2HODB 1RE3B 4JYOX 1RF0B 1N86B 2JHKF 2J5ZA 1RF1C 3E1IC 1FZBB 2J0HA 3H32C 2H43C 2GY7A 2D39A 3E1IB 1FIBA 1N73B 2J0GA 1LWUC 2Q9IB 2JHMF 2J3FD 1FZCB 1FZDA 1LTJC 2FFDB 2XNXC 1FZAC 2HODC 1RE3C 1FZGB 2Z4EB 1N86C 1FZBC 1LT9B 4NYTA 1N73C 2HLOB 4JZCA 2Q9IC 4R9JA 2OYHC 3HUSC 3BVHC 1FZCC 2J0YA 2OYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIC A;  3HUS B;  3BVH B;  2FFD C;  2WNP F;  1JC9 A;  1FZG C;  2Z4E C;  1Z3S A;  4EPU A;  1LT9 C;  1FZE B;  1RE4 C;  2HLO C;  2J61 A;  4ZFG A;  1RE4 B;  3GHG C;  4R9T A;  1RF0 C;  1FZF B;  1Z3U A;  1FID A;  1M1J B;  2J60 A;  2JHI F;  2J1G A;  4M7H A;  2HPC B;  2OYI B;  2J3G A;  1FZE C;  2J64 A;  2J3F A;  1RF1 B;  2H43 B;  3H32 B;  2J3O A;  2J61 B;  2JHH C;  1LWU B;  1FZF C;  2J3U A;  2J2P A;  1M1J C;  3FIB A;  1LTJ B;  2JHL F;  4M7F A;  2HPC C;  2OYI C;  2FIB A;  2XNX B;  1FZA B;  2HOD B;  1RE3 B;  4JYO X;  1RF0 B;  1N86 B;  2JHK F;  2J5Z A;  1RF1 C;  3E1I C;  1FZB B;  2J0H A;  3H32 C;  2H43 C;  2GY7 A;  2D39 A;  3E1I B;  1FIB A;  1N73 B;  2J0G A;  1LWU C;  2Q9I B;  2JHM F;  2J3F D;  1FZC B;  1FZD A;  1LTJ C;  2FFD B;  2XNX C;  1FZA C;  2HOD C;  1RE3 C;  1FZG B;  2Z4E B;  1N86 C;  1FZB C;  1LT9 B;  4NYT A;  1N73 C;  2HLO B;  4JZC A;  2Q9I C;  4R9J A;  2OYH C;  3HUS C;  3BVH C;  1FZC C;  2J0Y A;  2OYH B; 
#chains in the Genus database with same CATH topology
 1FIC A;  3HUS B;  3BVH B;  2FFD C;  2WNP F;  1JC9 A;  1FZG C;  2Z4E C;  1Z3S A;  4EPU A;  1LT9 C;  1FZE B;  1RE4 C;  2HLO C;  2J61 A;  4ZFG A;  1RE4 B;  3GHG C;  4R9T A;  1RF0 C;  1FZF B;  1Z3U A;  1FID A;  1M1J B;  2J60 A;  2JHI F;  2J1G A;  4M7H A;  2HPC B;  2OYI B;  2J3G A;  1FZE C;  2J64 A;  2J3F A;  1RF1 B;  2H43 B;  3H32 B;  2J3O A;  2J61 B;  2JHH C;  1LWU B;  1FZF C;  2J3U A;  2J2P A;  1M1J C;  3FIB A;  1LTJ B;  2JHL F;  4M7F A;  2HPC C;  2OYI C;  2FIB A;  2XNX B;  1FZA B;  2HOD B;  1RE3 B;  4JYO X;  1RF0 B;  1N86 B;  2JHK F;  2J5Z A;  1RF1 C;  3E1I C;  1FZB B;  2J0H A;  3H32 C;  2H43 C;  2GY7 A;  2D39 A;  3E1I B;  1FIB A;  1N73 B;  2J0G A;  1LWU C;  2Q9I B;  2JHM F;  2J3F D;  1FZC B;  1FZD A;  1LTJ C;  2FFD B;  2XNX C;  1FZA C;  2HOD C;  1RE3 C;  1FZG B;  2Z4E B;  1N86 C;  1FZB C;  1LT9 B;  4NYT A;  1N73 C;  2HLO B;  4JZC A;  2Q9I C;  4R9J A;  2OYH C;  3GHG B;  3HUS C;  3BVH C;  1FZC C;  2J0Y A;  2OYH B; 
#chains in the Genus database with same CATH homology
 1FIC A;  3HUS B;  3BVH B;  2FFD C;  2WNP F;  1JC9 A;  1FZG C;  2Z4E C;  1Z3S A;  4EPU A;  1LT9 C;  1FZE B;  1RE4 C;  2HLO C;  2J61 A;  4ZFG A;  1RE4 B;  3GHG C;  4R9T A;  1RF0 C;  1FZF B;  1Z3U A;  1FID A;  1M1J B;  2J60 A;  2JHI F;  2J1G A;  4M7H A;  2HPC B;  2OYI B;  2J3G A;  1FZE C;  2J64 A;  2J3F A;  1RF1 B;  2H43 B;  3H32 B;  2J3O A;  2J61 B;  2JHH C;  1LWU B;  1FZF C;  2J3U A;  2J2P A;  1M1J C;  3FIB A;  1LTJ B;  2JHL F;  4M7F A;  2HPC C;  2OYI C;  2FIB A;  2XNX B;  1FZA B;  2HOD B;  1RE3 B;  4JYO X;  1RF0 B;  1N86 B;  2JHK F;  2J5Z A;  1RF1 C;  3E1I C;  1FZB B;  2J0H A;  3H32 C;  2H43 C;  2GY7 A;  2D39 A;  3E1I B;  1FIB A;  1N73 B;  2J0G A;  1LWU C;  2Q9I B;  2JHM F;  2J3F D;  1FZC B;  1FZD A;  1LTJ C;  2FFD B;  2XNX C;  1FZA C;  2HOD C;  1RE3 C;  1FZG B;  2Z4E B;  1N86 C;  1FZB C;  1LT9 B;  4NYT A;  1N73 C;  2HLO B;  4JZC A;  2Q9I C;  4R9J A;  2OYH C;  3HUS C;  3BVH C;  1FZC C;  2J0Y A;  2OYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...