1Z3UA

Structure of the angiopoietin-2 recptor binding domain and identification of surfaces involved in tie2 recognition
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
216
structure length
216
Chain Sequence
SFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKANGIKWAAWKGSGYSLKATTMMIRPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-2
publication title Structure of the angiopoietin-2 receptor binding domain and identification of surfaces involved in Tie2 recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1z3uA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1z3uA02
2JHMF 2HODB 2J60A 1FZCB 4M7HA 2OYHC 1LTJB 1Z3UA 2J2PA 1FZGC 2J1GA 2Q9IB 2J0GA 1Z3SA 4JYOX 2OYHB 1FIBA 1FZGB 1N86B 2GY7A 1FZEC 1FZFC 4EPUA 2H43B 1FZEB 1FZFB 3E1IB 2J3OA 1FZBB 2XNXC 2HPCC 4R9JA 1LT9C 1N73B 2XNXB 2J3FD 2HPCB 1LT9B 2HLOC 1RF0C 2HLOB 2J3GA 1FIDA 1RF0B 2J0HA 2J0YA 2J64A 1JC9A 1FICA 2JHKF 3H32C 2FIBA 1LWUC 2J3UA 2JHIF 2D39A 1LWUB 4ZFGA 1RE3C 1FZAC 3FIBA 3BVHC 1FZAB 1RE4C 2J61A 3BVHB 4M7FA 2FFDC 2OYIC 2HODC 2J3FA 2OYIB 1LTJC 2Q9IC 2Z4EC 3H32B 3HUSC 1N86C 2J61B 1FZDA 4R9TA 2Z4EB 3HUSB 4NYTA 2H43C 2JHLF 3E1IC 1RE3B 2J5ZA 4JZCA 1FZBC 1RF1C 2WNPF 1RE4B 1RF1B 1M1JC 2JHHC 3GHGC 1N73C 1FZCC 2FFDB 1M1JB
chains in the Genus database with same CATH superfamily
3GHGB 2JHMF 2HODB 2J60A 1FZCB 4M7HA 2OYHC 1LTJB 1Z3UA 2J2PA 1FZGC 2J1GA 2Q9IB 2J0GA 1Z3SA 4JYOX 2OYHB 1FIBA 1FZGB 1N86B 2GY7A 1FZEC 1FZFC 4EPUA 2H43B 1FZEB 1FZFB 3E1IB 2J3OA 1FZBB 2XNXC 2HPCC 4R9JA 1LT9C 1N73B 2XNXB 2J3FD 2HPCB 1LT9B 2HLOC 1RF0C 2HLOB 2J3GA 1FIDA 1RF0B 2J0HA 2J0YA 2J64A 1JC9A 1FICA 2JHKF 3H32C 2FIBA 1LWUC 2J3UA 2JHIF 2D39A 1LWUB 4ZFGA 1RE3C 1FZAC 3FIBA 3BVHC 1FZAB 1RE4C 2J61A 3BVHB 4M7FA 2FFDC 2OYIC 2HODC 2J3FA 2OYIB 1LTJC 2Q9IC 2Z4EC 3H32B 3HUSC 1N86C 2J61B 1FZDA 4R9TA 2Z4EB 3HUSB 4NYTA 2H43C 2JHLF 3E1IC 1RE3B 2J5ZA 4JZCA 1FZBC 1RF1C 2WNPF 1RE4B 1RF1B 1M1JC 2JHHC 3GHGC 1N73C 1FZCC 2FFDB 1M1JB
chains in the Genus database with same CATH topology
2JHMF 2HODB 2J60A 1FZCB 4M7HA 2OYHC 1LTJB 1Z3UA 2J2PA 1FZGC 2J1GA 2Q9IB 2J0GA 1Z3SA 4JYOX 2OYHB 1FIBA 1FZGB 1N86B 2GY7A 1FZEC 1FZFC 4EPUA 2H43B 1FZEB 1FZFB 3E1IB 2J3OA 1FZBB 2XNXC 2HPCC 4R9JA 1LT9C 1N73B 2XNXB 2J3FD 2HPCB 1LT9B 2HLOC 1RF0C 2HLOB 2J3GA 1FIDA 1RF0B 2J0HA 2J0YA 2J64A 1JC9A 1FICA 2JHKF 3H32C 2FIBA 1LWUC 2J3UA 2JHIF 2D39A 1LWUB 4ZFGA 1RE3C 1FZAC 3FIBA 3BVHC 1FZAB 1RE4C 2J61A 3BVHB 4M7FA 2FFDC 2OYIC 2HODC 2J3FA 2OYIB 1LTJC 2Q9IC 2Z4EC 3H32B 3HUSC 1N86C 2J61B 1FZDA 4R9TA 2Z4EB 3HUSB 4NYTA 2H43C 2JHLF 3E1IC 1RE3B 2J5ZA 4JZCA 1FZBC 1RF1C 2WNPF 1RE4B 1RF1B 1M1JC 2JHHC 3GHGC 1N73C 1FZCC 2FFDB 1M1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHM F;  2HOD B;  2J60 A;  1FZC B;  4M7H A;  2OYH C;  1LTJ B;  1Z3U A;  2J2P A;  1FZG C;  2J1G A;  2Q9I B;  2J0G A;  1Z3S A;  4JYO X;  2OYH B;  1FIB A;  1FZG B;  1N86 B;  2GY7 A;  1FZE C;  1FZF C;  4EPU A;  2H43 B;  1FZE B;  1FZF B;  3E1I B;  2J3O A;  1FZB B;  2XNX C;  2HPC C;  4R9J A;  1LT9 C;  1N73 B;  2XNX B;  2J3F D;  2HPC B;  1LT9 B;  2HLO C;  1RF0 C;  2HLO B;  2J3G A;  1FID A;  1RF0 B;  2J0H A;  2J0Y A;  2J64 A;  1JC9 A;  1FIC A;  2JHK F;  3H32 C;  2FIB A;  1LWU C;  2J3U A;  2JHI F;  2D39 A;  1LWU B;  4ZFG A;  1RE3 C;  1FZA C;  3FIB A;  3BVH C;  1FZA B;  1RE4 C;  2J61 A;  3BVH B;  4M7F A;  2FFD C;  2OYI C;  2HOD C;  2J3F A;  2OYI B;  1LTJ C;  2Q9I C;  2Z4E C;  3H32 B;  3HUS C;  1N86 C;  2J61 B;  1FZD A;  4R9T A;  2Z4E B;  3HUS B;  4NYT A;  2H43 C;  2JHL F;  3E1I C;  1RE3 B;  2J5Z A;  4JZC A;  1FZB C;  1RF1 C;  2WNP F;  1RE4 B;  1RF1 B;  1M1J C;  2JHH C;  3GHG C;  1N73 C;  1FZC C;  2FFD B;  1M1J B; 
#chains in the Genus database with same CATH topology
 3GHG B;  2JHM F;  2HOD B;  2J60 A;  1FZC B;  4M7H A;  2OYH C;  1LTJ B;  1Z3U A;  2J2P A;  1FZG C;  2J1G A;  2Q9I B;  2J0G A;  1Z3S A;  4JYO X;  2OYH B;  1FIB A;  1FZG B;  1N86 B;  2GY7 A;  1FZE C;  1FZF C;  4EPU A;  2H43 B;  1FZE B;  1FZF B;  3E1I B;  2J3O A;  1FZB B;  2XNX C;  2HPC C;  4R9J A;  1LT9 C;  1N73 B;  2XNX B;  2J3F D;  2HPC B;  1LT9 B;  2HLO C;  1RF0 C;  2HLO B;  2J3G A;  1FID A;  1RF0 B;  2J0H A;  2J0Y A;  2J64 A;  1JC9 A;  1FIC A;  2JHK F;  3H32 C;  2FIB A;  1LWU C;  2J3U A;  2JHI F;  2D39 A;  1LWU B;  4ZFG A;  1RE3 C;  1FZA C;  3FIB A;  3BVH C;  1FZA B;  1RE4 C;  2J61 A;  3BVH B;  4M7F A;  2FFD C;  2OYI C;  2HOD C;  2J3F A;  2OYI B;  1LTJ C;  2Q9I C;  2Z4E C;  3H32 B;  3HUS C;  1N86 C;  2J61 B;  1FZD A;  4R9T A;  2Z4E B;  3HUS B;  4NYT A;  2H43 C;  2JHL F;  3E1I C;  1RE3 B;  2J5Z A;  4JZC A;  1FZB C;  1RF1 C;  2WNP F;  1RE4 B;  1RF1 B;  1M1J C;  2JHH C;  3GHG C;  1N73 C;  1FZC C;  2FFD B;  1M1J B; 
#chains in the Genus database with same CATH homology
 2JHM F;  2HOD B;  2J60 A;  1FZC B;  4M7H A;  2OYH C;  1LTJ B;  1Z3U A;  2J2P A;  1FZG C;  2J1G A;  2Q9I B;  2J0G A;  1Z3S A;  4JYO X;  2OYH B;  1FIB A;  1FZG B;  1N86 B;  2GY7 A;  1FZE C;  1FZF C;  4EPU A;  2H43 B;  1FZE B;  1FZF B;  3E1I B;  2J3O A;  1FZB B;  2XNX C;  2HPC C;  4R9J A;  1LT9 C;  1N73 B;  2XNX B;  2J3F D;  2HPC B;  1LT9 B;  2HLO C;  1RF0 C;  2HLO B;  2J3G A;  1FID A;  1RF0 B;  2J0H A;  2J0Y A;  2J64 A;  1JC9 A;  1FIC A;  2JHK F;  3H32 C;  2FIB A;  1LWU C;  2J3U A;  2JHI F;  2D39 A;  1LWU B;  4ZFG A;  1RE3 C;  1FZA C;  3FIB A;  3BVH C;  1FZA B;  1RE4 C;  2J61 A;  3BVH B;  4M7F A;  2FFD C;  2OYI C;  2HOD C;  2J3F A;  2OYI B;  1LTJ C;  2Q9I C;  2Z4E C;  3H32 B;  3HUS C;  1N86 C;  2J61 B;  1FZD A;  4R9T A;  2Z4E B;  3HUS B;  4NYT A;  2H43 C;  2JHL F;  3E1I C;  1RE3 B;  2J5Z A;  4JZC A;  1FZB C;  1RF1 C;  2WNP F;  1RE4 B;  1RF1 B;  1M1J C;  2JHH C;  3GHG C;  1N73 C;  1FZC C;  2FFD B;  1M1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...