3BVHB

Crystal structure of recombinant gammad364a fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Polymerization-defective fibrinogen variant gammaD364A binds knob "A" peptide mimic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 93
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3bvhB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3bvhB02
2OYHC 3H32B 1FIDA 2Q9IB 2Z4EB 2J3FD 1RE4B 1JC9A 2JHHC 2J3FA 2FIBA 2HLOC 4R9TA 1RE3B 3HUSB 4M7HA 2J0GA 2J3OA 3BVHB 2OYIB 1N86B 3H32C 3E1IB 2FFDB 2GY7A 1LWUB 4R9JA 1FZGB 2Q9IC 1M1JB 3GHGC 2Z4EC 1RE4C 2JHLF 2XNXC 2HPCB 1FZCB 1N73B 1FZBB 2J5ZA 1FZAB 3HUSC 1FZEB 1FIBA 1Z3SA 1FZDA 3BVHC 2OYIC 1N86C 3E1IC 2FFDC 2J1GA 1LWUC 2J3UA 1FZGC 1M1JC 2J60A 2JHKF 4ZFGA 4NYTA 1LT9B 4JYOX 2JHMF 1FZFB 1RF0B 2HPCC 2WNPF 1N73C 1FZBC 2H43B 1FZAC 2J3GA 2HODB 1FZEC 1RE3C 1RF1B 2JHIF 2J0HA 1LTJB 2OYHB 2J61B 2D39A 4M7FA 1LT9C 4EPUA 1FZFC 1RF0C 1FICA 2J64A 2XNXB 1Z3UA 2J61A 2H43C 1FZCC 2HODC 3FIBA 2J2PA 2HLOB 1RF1C 4JZCA 2J0YA 1LTJC
chains in the Genus database with same CATH superfamily
2OYHC 3H32B 1FIDA 2Q9IB 3GHGB 2Z4EB 2J3FD 1RE4B 1JC9A 2JHHC 2J3FA 2FIBA 2HLOC 4R9TA 1RE3B 3HUSB 4M7HA 2J0GA 2J3OA 3BVHB 2OYIB 1N86B 3H32C 3E1IB 2FFDB 2GY7A 1LWUB 4R9JA 1FZGB 2Q9IC 1M1JB 3GHGC 2Z4EC 1RE4C 2JHLF 2XNXC 2HPCB 1FZCB 1N73B 1FZBB 2J5ZA 1FZAB 3HUSC 1FZEB 1FIBA 1Z3SA 1FZDA 3BVHC 2OYIC 1N86C 3E1IC 2FFDC 2J1GA 1LWUC 2J3UA 1FZGC 1M1JC 2J60A 2JHKF 4ZFGA 4NYTA 1LT9B 4JYOX 2JHMF 1FZFB 1RF0B 2HPCC 2WNPF 1N73C 1FZBC 2H43B 1FZAC 2J3GA 2HODB 1FZEC 1RE3C 1RF1B 2JHIF 2J0HA 1LTJB 2OYHB 2J61B 2D39A 4M7FA 1LT9C 4EPUA 1FZFC 1RF0C 1FICA 2J64A 2XNXB 1Z3UA 2J61A 2H43C 1FZCC 2HODC 3FIBA 2J2PA 2HLOB 1RF1C 4JZCA 2J0YA 1LTJC
chains in the Genus database with same CATH topology
2OYHC 3H32B 1FIDA 2Q9IB 2Z4EB 2J3FD 1RE4B 1JC9A 2JHHC 2J3FA 2FIBA 2HLOC 4R9TA 1RE3B 3HUSB 4M7HA 2J0GA 2J3OA 3BVHB 2OYIB 1N86B 3H32C 3E1IB 2FFDB 2GY7A 1LWUB 4R9JA 1FZGB 2Q9IC 1M1JB 3GHGC 2Z4EC 1RE4C 2JHLF 2XNXC 2HPCB 1FZCB 1N73B 1FZBB 2J5ZA 1FZAB 3HUSC 1FZEB 1FIBA 1Z3SA 1FZDA 3BVHC 2OYIC 1N86C 3E1IC 2FFDC 2J1GA 1LWUC 2J3UA 1FZGC 1M1JC 2J60A 2JHKF 4ZFGA 4NYTA 1LT9B 4JYOX 2JHMF 1FZFB 1RF0B 2HPCC 2WNPF 1N73C 1FZBC 2H43B 1FZAC 2J3GA 2HODB 1FZEC 1RE3C 1RF1B 2JHIF 2J0HA 1LTJB 2OYHB 2J61B 2D39A 4M7FA 1LT9C 4EPUA 1FZFC 1RF0C 1FICA 2J64A 2XNXB 1Z3UA 2J61A 2H43C 1FZCC 2HODC 3FIBA 2J2PA 2HLOB 1RF1C 4JZCA 2J0YA 1LTJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYH C;  3H32 B;  1FID A;  2Q9I B;  2Z4E B;  2J3F D;  1RE4 B;  1JC9 A;  2JHH C;  2J3F A;  2FIB A;  2HLO C;  4R9T A;  1RE3 B;  3HUS B;  4M7H A;  2J0G A;  2J3O A;  3BVH B;  2OYI B;  1N86 B;  3H32 C;  3E1I B;  2FFD B;  2GY7 A;  1LWU B;  4R9J A;  1FZG B;  2Q9I C;  1M1J B;  3GHG C;  2Z4E C;  1RE4 C;  2JHL F;  2XNX C;  2HPC B;  1FZC B;  1N73 B;  1FZB B;  2J5Z A;  1FZA B;  3HUS C;  1FZE B;  1FIB A;  1Z3S A;  1FZD A;  3BVH C;  2OYI C;  1N86 C;  3E1I C;  2FFD C;  2J1G A;  1LWU C;  2J3U A;  1FZG C;  1M1J C;  2J60 A;  2JHK F;  4ZFG A;  4NYT A;  1LT9 B;  4JYO X;  2JHM F;  1FZF B;  1RF0 B;  2HPC C;  2WNP F;  1N73 C;  1FZB C;  2H43 B;  1FZA C;  2J3G A;  2HOD B;  1FZE C;  1RE3 C;  1RF1 B;  2JHI F;  2J0H A;  1LTJ B;  2OYH B;  2J61 B;  2D39 A;  4M7F A;  1LT9 C;  4EPU A;  1FZF C;  1RF0 C;  1FIC A;  2J64 A;  2XNX B;  1Z3U A;  2J61 A;  2H43 C;  1FZC C;  2HOD C;  3FIB A;  2J2P A;  2HLO B;  1RF1 C;  4JZC A;  2J0Y A;  1LTJ C; 
#chains in the Genus database with same CATH topology
 2OYH C;  3H32 B;  1FID A;  2Q9I B;  3GHG B;  2Z4E B;  2J3F D;  1RE4 B;  1JC9 A;  2JHH C;  2J3F A;  2FIB A;  2HLO C;  4R9T A;  1RE3 B;  3HUS B;  4M7H A;  2J0G A;  2J3O A;  3BVH B;  2OYI B;  1N86 B;  3H32 C;  3E1I B;  2FFD B;  2GY7 A;  1LWU B;  4R9J A;  1FZG B;  2Q9I C;  1M1J B;  3GHG C;  2Z4E C;  1RE4 C;  2JHL F;  2XNX C;  2HPC B;  1FZC B;  1N73 B;  1FZB B;  2J5Z A;  1FZA B;  3HUS C;  1FZE B;  1FIB A;  1Z3S A;  1FZD A;  3BVH C;  2OYI C;  1N86 C;  3E1I C;  2FFD C;  2J1G A;  1LWU C;  2J3U A;  1FZG C;  1M1J C;  2J60 A;  2JHK F;  4ZFG A;  4NYT A;  1LT9 B;  4JYO X;  2JHM F;  1FZF B;  1RF0 B;  2HPC C;  2WNP F;  1N73 C;  1FZB C;  2H43 B;  1FZA C;  2J3G A;  2HOD B;  1FZE C;  1RE3 C;  1RF1 B;  2JHI F;  2J0H A;  1LTJ B;  2OYH B;  2J61 B;  2D39 A;  4M7F A;  1LT9 C;  4EPU A;  1FZF C;  1RF0 C;  1FIC A;  2J64 A;  2XNX B;  1Z3U A;  2J61 A;  2H43 C;  1FZC C;  2HOD C;  3FIB A;  2J2P A;  2HLO B;  1RF1 C;  4JZC A;  2J0Y A;  1LTJ C; 
#chains in the Genus database with same CATH homology
 2OYH C;  3H32 B;  1FID A;  2Q9I B;  2Z4E B;  2J3F D;  1RE4 B;  1JC9 A;  2JHH C;  2J3F A;  2FIB A;  2HLO C;  4R9T A;  1RE3 B;  3HUS B;  4M7H A;  2J0G A;  2J3O A;  3BVH B;  2OYI B;  1N86 B;  3H32 C;  3E1I B;  2FFD B;  2GY7 A;  1LWU B;  4R9J A;  1FZG B;  2Q9I C;  1M1J B;  3GHG C;  2Z4E C;  1RE4 C;  2JHL F;  2XNX C;  2HPC B;  1FZC B;  1N73 B;  1FZB B;  2J5Z A;  1FZA B;  3HUS C;  1FZE B;  1FIB A;  1Z3S A;  1FZD A;  3BVH C;  2OYI C;  1N86 C;  3E1I C;  2FFD C;  2J1G A;  1LWU C;  2J3U A;  1FZG C;  1M1J C;  2J60 A;  2JHK F;  4ZFG A;  4NYT A;  1LT9 B;  4JYO X;  2JHM F;  1FZF B;  1RF0 B;  2HPC C;  2WNP F;  1N73 C;  1FZB C;  2H43 B;  1FZA C;  2J3G A;  2HOD B;  1FZE C;  1RE3 C;  1RF1 B;  2JHI F;  2J0H A;  1LTJ B;  2OYH B;  2J61 B;  2D39 A;  4M7F A;  1LT9 C;  4EPU A;  1FZF C;  1RF0 C;  1FIC A;  2J64 A;  2XNX B;  1Z3U A;  2J61 A;  2H43 C;  1FZC C;  2HOD C;  3FIB A;  2J2P A;  2HLO B;  1RF1 C;  4JZC A;  2J0Y A;  1LTJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...