1FZEC

Crystal structure of fragment double-d from human fibrin
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
303
structure length
303
Chain Sequence
EIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN
publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 85
structure length 303
sequence length 303
chains with identical sequence F
ec nomenclature
pdb deposition date 1998-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzeC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzeC02
1FZAC 1RF0B 4R9TA 2HODC 2OYHC 2J61B 2JHKF 3HUSC 1N86C 2J1GA 2GY7A 2J3UA 1FZBC 2HPCB 4M7FA 1RE4C 2JHMF 2J3FD 1FZAB 1RF1C 2HLOC 2D39A 2J2PA 1LTJC 2OYHB 2XNXB 1FZDA 1FZFC 1FICA 1FZEC 3H32C 1RE3C 3BVHC 2HLOB 3E1IC 1LWUB 2J3FA 2J61A 1FZCC 2Q9IC 2JHHC 1Z3UA 1FIBA 3GHGC 1LT9C 2J3GA 1FZEB 3H32B 2Z4EC 2HODB 3FIBA 4JZCA 2H43C 1RE3B 2J0GA 4R9JA 1FZGC 3HUSB 3BVHB 1N86B 3E1IB 1M1JC 1FZBB 1RF0C 1RE4B 4EPUA 2Q9IB 1N73C 1RF1B 4M7HA 4NYTA 4ZFGA 2J3OA 1LTJB 1Z3SA 2H43B 1FZGB 4JYOX 2FFDC 1FZFB 2JHLF 1FIDA 2J5ZA 2J0HA 1N73B 2J64A 2OYIC 2XNXC 1FZCB 2FIBA 1JC9A 2J60A 1LT9B 2FFDB 2Z4EB 2WNPF 1LWUC 2HPCC 2JHIF 2OYIB 1M1JB 2J0YA
chains in the Genus database with same CATH superfamily
1FZAC 1RF0B 4R9TA 2HODC 2OYHC 2J61B 2JHKF 3HUSC 1N86C 2J1GA 2GY7A 2J3UA 1FZBC 2HPCB 4M7FA 1RE4C 2JHMF 2J3FD 1FZAB 1RF1C 2HLOC 2D39A 2J2PA 1LTJC 2OYHB 2XNXB 1FZDA 1FZFC 1FICA 1FZEC 3H32C 1RE3C 3BVHC 2HLOB 3E1IC 1LWUB 2J3FA 2J61A 1FZCC 2Q9IC 2JHHC 1Z3UA 1FIBA 3GHGC 1LT9C 2J3GA 1FZEB 3H32B 2Z4EC 2HODB 3FIBA 4JZCA 2H43C 1RE3B 2J0GA 4R9JA 1FZGC 3HUSB 3BVHB 1N86B 3E1IB 1M1JC 1FZBB 1RF0C 1RE4B 4EPUA 2Q9IB 1N73C 1RF1B 4M7HA 4NYTA 4ZFGA 2J3OA 1LTJB 1Z3SA 2H43B 1FZGB 4JYOX 2FFDC 1FZFB 2JHLF 1FIDA 2J5ZA 2J0HA 1N73B 2J64A 2OYIC 2XNXC 1FZCB 2FIBA 1JC9A 2J60A 3GHGB 1LT9B 2FFDB 2Z4EB 2WNPF 1LWUC 2HPCC 2JHIF 2OYIB 1M1JB 2J0YA
chains in the Genus database with same CATH topology
1FZAC 1RF0B 4R9TA 2HODC 2OYHC 2J61B 2JHKF 3HUSC 1N86C 2J1GA 2GY7A 2J3UA 1FZBC 2HPCB 4M7FA 1RE4C 2JHMF 2J3FD 1FZAB 1RF1C 2HLOC 2D39A 2J2PA 1LTJC 2OYHB 2XNXB 1FZDA 1FZFC 1FICA 1FZEC 3H32C 1RE3C 3BVHC 2HLOB 3E1IC 1LWUB 2J3FA 2J61A 1FZCC 2Q9IC 2JHHC 1Z3UA 1FIBA 3GHGC 1LT9C 2J3GA 1FZEB 3H32B 2Z4EC 2HODB 3FIBA 4JZCA 2H43C 1RE3B 2J0GA 4R9JA 1FZGC 3HUSB 3BVHB 1N86B 3E1IB 1M1JC 1FZBB 1RF0C 1RE4B 4EPUA 2Q9IB 1N73C 1RF1B 4M7HA 4NYTA 4ZFGA 2J3OA 1LTJB 1Z3SA 2H43B 1FZGB 4JYOX 2FFDC 1FZFB 2JHLF 1FIDA 2J5ZA 2J0HA 1N73B 2J64A 2OYIC 2XNXC 1FZCB 2FIBA 1JC9A 2J60A 1LT9B 2FFDB 2Z4EB 2WNPF 1LWUC 2HPCC 2JHIF 2OYIB 1M1JB 2J0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZA C;  1RF0 B;  4R9T A;  2HOD C;  2OYH C;  2J61 B;  2JHK F;  3HUS C;  1N86 C;  2J1G A;  2GY7 A;  2J3U A;  1FZB C;  2HPC B;  4M7F A;  1RE4 C;  2JHM F;  2J3F D;  1FZA B;  1RF1 C;  2HLO C;  2D39 A;  2J2P A;  1LTJ C;  2OYH B;  2XNX B;  1FZD A;  1FZF C;  1FIC A;  1FZE C;  3H32 C;  1RE3 C;  3BVH C;  2HLO B;  3E1I C;  1LWU B;  2J3F A;  2J61 A;  1FZC C;  2Q9I C;  2JHH C;  1Z3U A;  1FIB A;  3GHG C;  1LT9 C;  2J3G A;  1FZE B;  3H32 B;  2Z4E C;  2HOD B;  3FIB A;  4JZC A;  2H43 C;  1RE3 B;  2J0G A;  4R9J A;  1FZG C;  3HUS B;  3BVH B;  1N86 B;  3E1I B;  1M1J C;  1FZB B;  1RF0 C;  1RE4 B;  4EPU A;  2Q9I B;  1N73 C;  1RF1 B;  4M7H A;  4NYT A;  4ZFG A;  2J3O A;  1LTJ B;  1Z3S A;  2H43 B;  1FZG B;  4JYO X;  2FFD C;  1FZF B;  2JHL F;  1FID A;  2J5Z A;  2J0H A;  1N73 B;  2J64 A;  2OYI C;  2XNX C;  1FZC B;  2FIB A;  1JC9 A;  2J60 A;  1LT9 B;  2FFD B;  2Z4E B;  2WNP F;  1LWU C;  2HPC C;  2JHI F;  2OYI B;  1M1J B;  2J0Y A; 
#chains in the Genus database with same CATH topology
 1FZA C;  1RF0 B;  4R9T A;  2HOD C;  2OYH C;  2J61 B;  2JHK F;  3HUS C;  1N86 C;  2J1G A;  2GY7 A;  2J3U A;  1FZB C;  2HPC B;  4M7F A;  1RE4 C;  2JHM F;  2J3F D;  1FZA B;  1RF1 C;  2HLO C;  2D39 A;  2J2P A;  1LTJ C;  2OYH B;  2XNX B;  1FZD A;  1FZF C;  1FIC A;  1FZE C;  3H32 C;  1RE3 C;  3BVH C;  2HLO B;  3E1I C;  1LWU B;  2J3F A;  2J61 A;  1FZC C;  2Q9I C;  2JHH C;  1Z3U A;  1FIB A;  3GHG C;  1LT9 C;  2J3G A;  1FZE B;  3H32 B;  2Z4E C;  2HOD B;  3FIB A;  4JZC A;  2H43 C;  1RE3 B;  2J0G A;  4R9J A;  1FZG C;  3HUS B;  3BVH B;  1N86 B;  3E1I B;  1M1J C;  1FZB B;  1RF0 C;  1RE4 B;  4EPU A;  2Q9I B;  1N73 C;  1RF1 B;  4M7H A;  4NYT A;  4ZFG A;  2J3O A;  1LTJ B;  1Z3S A;  2H43 B;  1FZG B;  4JYO X;  2FFD C;  1FZF B;  2JHL F;  1FID A;  2J5Z A;  2J0H A;  1N73 B;  2J64 A;  2OYI C;  2XNX C;  1FZC B;  2FIB A;  1JC9 A;  2J60 A;  3GHG B;  1LT9 B;  2FFD B;  2Z4E B;  2WNP F;  1LWU C;  2HPC C;  2JHI F;  2OYI B;  1M1J B;  2J0Y A; 
#chains in the Genus database with same CATH homology
 1FZA C;  1RF0 B;  4R9T A;  2HOD C;  2OYH C;  2J61 B;  2JHK F;  3HUS C;  1N86 C;  2J1G A;  2GY7 A;  2J3U A;  1FZB C;  2HPC B;  4M7F A;  1RE4 C;  2JHM F;  2J3F D;  1FZA B;  1RF1 C;  2HLO C;  2D39 A;  2J2P A;  1LTJ C;  2OYH B;  2XNX B;  1FZD A;  1FZF C;  1FIC A;  1FZE C;  3H32 C;  1RE3 C;  3BVH C;  2HLO B;  3E1I C;  1LWU B;  2J3F A;  2J61 A;  1FZC C;  2Q9I C;  2JHH C;  1Z3U A;  1FIB A;  3GHG C;  1LT9 C;  2J3G A;  1FZE B;  3H32 B;  2Z4E C;  2HOD B;  3FIB A;  4JZC A;  2H43 C;  1RE3 B;  2J0G A;  4R9J A;  1FZG C;  3HUS B;  3BVH B;  1N86 B;  3E1I B;  1M1J C;  1FZB B;  1RF0 C;  1RE4 B;  4EPU A;  2Q9I B;  1N73 C;  1RF1 B;  4M7H A;  4NYT A;  4ZFG A;  2J3O A;  1LTJ B;  1Z3S A;  2H43 B;  1FZG B;  4JYO X;  2FFD C;  1FZF B;  2JHL F;  1FID A;  2J5Z A;  2J0H A;  1N73 B;  2J64 A;  2OYI C;  2XNX C;  1FZC B;  2FIB A;  1JC9 A;  2J60 A;  1LT9 B;  2FFD B;  2Z4E B;  2WNP F;  1LWU C;  2HPC C;  2JHI F;  2OYI B;  1M1J B;  2J0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...