1M1JB

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
402
structure length
402
Chain Sequence
IYPDAGGCKHPLDELGVLCPTGCELQTTLLKQEKTVKPVLRDLKDRVAKFSDTSTTMYQYVNMIDNKLVKTQKQRKDNDIILSEYNTEMELHYNYIKDNLDNNIPSSLRVLRAVIDSLHKKIQKLENAIATQTDYCRSPCVASCNIPVVSGRECEDIYRKGGETSEMYIIQPDPFTTPYRVYCDMETDNGGWTLIQNRQDGSVNFGRAWDEYKRGFGNIAKSGGKKYCDTPGEYWLGNDKISQLTKIGPTKVLIEMEDWNGDKVSALYGGFTIHNEGNKYQLSVSNYKGNAGNALMEGASQLYGENRTMTIHNGMYFSTYDRDNDGWLTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGTYSWDMAKHGTDDGIVWMNWKGSWYSMKKMSMKIKPYFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha subunit
total genus 128
structure length 402
sequence length 402
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
B PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1m1jB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1m1jB02
3FIBA 2FFDC 4R9JA 2J0HA 3H32B 1FICA 2J61A 2Q9IC 2OYIA 2XNXC 2H43B 1FZFB 1FZEC 2J0YA 1T3UA 1FZFA 2J60A 2J3GA 1JY2P 3H32A 2XNXA 1LTJA 2HPCB 1N73B 1LTJB 3GHGC 1LWUA 2FIBA 2OYHB 1FZGC 2FFDA 2FFDB 3H32C 3HUSA 1N73A 2HPCA 1W2EA 1RF0B 1Z3SA 1RF0A 2A45G 1FZCC 2J5ZA 1FZFC 1RE4C 1N86C 3BVHA 2D39A 2HLOC 2H43A 1N73C 2HPCC 2GY7A 2Z4EB 2OYIB 2HODA 1LWUB 2HODC 1M1JC 1FZGB 3E1IC 1RE3C 2Q9IA 1RF0C 2Z4EA 1LT9B 1LT9A 1FZAB 1M1JA 1FIBA 2JHMF 3E1IA 2A45H 2J1GA 2J61B 4JZCA 2XNXB 1JY2O 1FZBB 1FZBA 4ZFGA 2Z4EC 1RF1A 2JHKF 1RF1C 1FIDA 1M1JB 1RE3B 4R9TA 4M7FA 3HUSC 1JY3O 2JHLF 2OYHC 2JHHC 1LT9C 1FZEA 1FZEB 2HLOA 4EPUA 3BVHC 2JHIF 2WNPF 2J64A 1FZBC 1FZDA 1FZCB 3GHGA 1FZCA 1RE4B 1FZAA 1JY3N 2J2PA 4M7HA 2J3FA 1JY3P 2OYIC 3HUSB 1LWUC 2HODB 2A45I 1RE4A 3E1IB 2J3UA 4JYOX 1JY2N 1N86A 1RE3A 1N86B 3BVHB 2HLOB 1Z3UA 2Q9IB 2J0GA 1JC9A 4NYTA 2J3FD 2H43C 1FZAC 1FZGA 2J3OA 1LTJC 3GHGB 1RF1B 2OYHA
chains in the Genus database with same CATH superfamily
3TSIA 4WBAA 2O01H 2P67A 1DH3A 2Q9IC 5GTIH 1BGYG 2WTYA 1GW4A 1TU3F 2Q7CA 1FAVA 2WSEH 1OW7A 3D6ZA 1IFIA 1N73B 1P84I 1NTKD 3Q3DA 3G3ZA 1AV1A 1PV3A 1SQXE 4I2LC 2IBZI 3FXDA 3HRNA 3JCUE 2GM4A 1N73C 3CCVP 2XU6A 1SQQE 2WPRA 1BE3G 4ZKUA 1NTZD 3CMAP 3B8EB 5KLVG 2Q9IA 4PD4I 3CCLP 1VQ8P 2OTLP 4JZCA 3GF7A 1NU1J 1VL2A 5AVSB 1GMJA 1BGYE 1NTZE 3A3YB 2QM7A 1QEXA 3S1KA 4JYCA 2WQYC 1GU5A 4D6TG 2WSEJ 1FZEB 2H8PD 2FYUE 2JHIF 1T8ZA 3PLNA 1FZCA 4M7HA 2NZ2A 2AEFA 1KV4A 2M3EA 5CJ4A 1EDKA 3L75J 2KZIA 1Y47A 1ZP0C 3W68A 4N3YB 2Q6QA 2IYPA 5K5GB 2C0WA 1JY2N 1N86B 1MUUA 4RO0A 2ZVOB 2KNCA 2D2CB 1IFMA 3WU2E 2POHA 1FZGA 1E5WA 3M9HA 2G3AA 4RKUJ 1EXJA 1M90Q 2UWJE 2E76D 2PGDA 2P10A 1IFDA 1USDA 2FFDC 3L70E 2OYIA 3FGAD 5B66E 1A02J 1LNQA 3L71E 4NPFX 1VF5D 1SS1A 1PGOA 4CPGA 2NPSB 3JSVC 4EI2A 1N73A 3GMAA 1RHZB 1ZOYC 4GOFA 2FXPA 1MFTA 4L75A 1VQNP 2B9BA 4UB8H 2R5BA 1KILE 2ZT9B 1LT9B 5BVZA 1VQKP 4ZNCA 2L91A 1NTKE 3LIDA 1J1EB 2KOGA 2WPSA 1SQVG 5KLVD 1SQQJ 3BRVB 2KP8A 1DIPA 1LTIC 3VMAA 3R4YA 2J64A 1FZCB 3CI9A 1BGYJ 1YTZI 1E79H 3CWBG 3M06A 4BRYA 3AEBC 1FBMA 3LW5J 2Y0CA 3L71J 1NTMK 1FU1A 3TNUA 3KPEA 3I5CA 3ABVC 2B87B 2PRRA 3H1JJ 1OVUA 3CC2P 2AXTE 4WY4C 4C7NA 1QL1A 1VQOP 3NTNA 3MP7B 2FIBA 2IZ0A 2OTJP 2FYUK 1X0TA 5KJ7D 2D2CD 3AE3C 1FOSF 1Z3SA 1YYCA 3PRJA 1JMBA 1OMIA 1SQVJ 3G4SP 2W8ZA 3VMXA 4PD4E 3BRTB 2Y0EA 2QG4A 3WUVA 1M1JC 1NH4A 3LW5H 1IK9A 3WUTA 1NTZJ 2B89A 1HWTC 3A0HH 4PV1C 3G71P 2WVRA 2FYZA 1NTKK 3TGUE 3N7NA 1LP1B 3L37A 5KLIB 1M1JB 1R8EA 3H1LE 3L73G 4DZOA 1GL2D 3GF3A 1T3JA 2WT7B 3Q5RA 4H44C 3K5BA 5CCHD 2IBZG 2DW3A 1DEBA 2KNCB 3RL0C 4N6JA 1SFCC 3QH9A 2L5GB 1JC9A 4NYTA 2J3FD 2YKOA 2H43C 3CWBE 2A06E 1Z56A 3S4RA 2IBZD 1G1IA 3FIBA 3HE5A 1ZRTE 4O9BA 3MTUE 3KZIE 3B5NA 2IYOA 4PD4H 3V4WA 3CC7P 3U59A 3H1IJ 2YKQA 1LTJB 2LXCB 1MKMA 4IL6E 1NAFA 1W2EA 5KAFE 1KB9I 2HLOC 2KSEA 3AECC 2YMYA 3AE9C 2FBWC 3H1LJ 1OW6A 5TISH 1AFOA 1N8RQ 3HTKB 5AVZB 1NTME 1LT9A 1FZAB 1SQBG 1PPJD 3KXDA 1BCCG 1RF1C 2P7JA 1MV8A 4N78D 2I8DA 3A0HE 1KFNA 2JHLF 1SQPD 2YMKA 2HLOA 2JO1A 3L72E 1X8YA 2CPSA 3L35A 4XFJA 1N7SB 2FYNC 1OW8A 4MN4C 1PP9J 4B86A 1CI6A 5GTIE 3M9BA 4EYYQ 1LGHB 1FJKA 1SQQG 2MJZA 2IDBA 1KB9E 4BXLA 2K9JA 4W80A 4ASWA 5APUA 1YI2P 1SQXG 3BCCG 2KB7P 1YJ9P 2CK3H 1KQFB 1FC2C 4OGQD 1FZEC 2J60A 3H1LG 1LTJA 1NTZG 3KZIH 2OYHB 3IFMA 3L70D 3B4SA 5AVWB 4R4LA 3MUDC 2E75D 1L4AA 1QL2A 1N86C 4K3AA 3CCQP 2D39A 1GTWA 2I1JA 2QVAA 2P58A 2WSSH 1CI6B 4OWFA 2NPSD 4D6TD 3RL0g 1PGJA 1KTMA 1BDDA 3RK2B 2E42A 2OGUA 1NU1D 1L0NJ 1IC2A 1M1JA 4EDFA 2XNXB 5B5EH 3H1KJ 5CCGD 4ZFGA 3C1LA 2WMMA 1EDJA 2C9NY 2Z5HA 2H88C 1UIIA 3RK2C 1KB9H 2BEZF 2IBZE 1NTZK 1ZRTD 2W27A 1FZBC 3GLMA 1L0NE 5L8RJ 2J58A 1JM0A 1PP9D 1SQVK 3EFGA 1OVVA 1L0LK 5APTA 1OVRA 2AXTH 2M8RA 3BVHB 1BE3J 5KKZB 1Q86Q 2ZT9C 3R2PA 2FYUJ 5H2FE 3P8CE 5KLVJ 4AYCA 1KQLA 1HUCA 2NRGA 3HE5B 3CD6P 3L72D 4GOEA 1M57D 1WT6A 3CX5I 3RK3B 3H1KE 1NYHA 3B5NB 1KQGB 3D6YA 1SQXD 1JY2P 2KI7B 1CZQA 2JWDA 1IFNA 4AQRD 4HKZH 5APQA 1M8OB 3RK3C 4W7ZA 2MKVA 2J5ZA 2YIUC 4TLFA 2GY7A 1J1EC 1SQBK 2HODA 1R5SA 5C39A 1L0LJ 3M0DC 1RY3A 2Q3IA 3KQGA 1VQ7P 4IFFA 1GL2C 3V6IA 4IL6H 2YO2A 2N9BA 1JY2O 2WSCJ 1ZN5A 5CCHA 4PJ0H 2YXQB 5B66H 1ZXGA 4C7RA 1VF5C 2K88A 2BCCJ 1IO4A 1X79B 1G2CA 3H1HE 3GHGA 2FXOA 1L0NK 2AXCA 1SQBJ 2WPVB 4HB1A 1JY3P 1LWUC 2HODB 1T2KC 1VF5B 1GK6A 1G1JA 1JTHB 1Q81Q 1RE3A 3T97A 2ZYGA 1PL5A 1RQVA 1OFCX 1MFZA 2XV5A 3SWYA 2G8YA 4KT0J 3CL3D 5GTHE 3AEFC 4GIFA 1KZUB 5CHXA 3LIEA 2J0HA 4WY4D 1HGVA 4H44B 5CJ0A 2E76B 3U1AA 3CCSP 3L72G 4IL6X 4U3FD 1L4AD 1FZGC 1P84H 3V4QA 1RF0B 1U7JA 1VDFA 2Z5IA 3CWBJ 4PJ0E 3V5BA 1DD3A 3I56P 2BCCD 5CCGA 1Q7YQ 2O1JA 3W67A 1FZGB 3VN0A 1KYOI 2OARA 1AVYA 1KORA 1RF0C 4DCKA 1PIXA 4UB8E 5EFWB 3E1IA 2BCCE 2O1KA 1EZVE 2ITAA 2WPQA 1HBWA 1S5LX 1NU1K 1S1CX 2J59M 1Q90D 1SQPK 2AEJA 1S5LH 1AVOA 1URQC 4EPUA 2M5AA 3HD7C 3A0BH 1L0NG 3SSUA 2QEXP 3F5HA 2J5UA 3CPWO 2A45I 3VTPC 3CC4P 2R32A 1URQB 4RESB 2QJPC 2J0GA 1FZAC 2KIKA 3HD7B 4M3LA 2V4HA 1EZVG 2RMZA 1LTJC 2O01N 5AVYB 1KFMA 1RF1B 1P84E 3TGUJ 2PAJA 1HH0A 4RJTA 2J0YA 1H89A 4BWNA 2LR2A 2FXMA 1N7SA 3AEAC 4NPDA 1BCCD 1FZFC 2QE7H 3T97B 2K37A 3CCJP 3SWKA 3JC22 3H1ID 3E1IC 3GW6A 2A06G 1SFCD 3C8VA 3L75D 2Z4EA 3V2RA 1EDLA 3H1HJ 1NVOA 1FZBA 1U57A 3RBZA 1Y9BA 1R5LA 1RF1A 2E75B 3TYYA 1H0TA 3CXHI 4L73A 3HTKA 1QLED 1YITP 3CX5D 4YTPC 3Q5PA 5AW4B 1SQVD 1A02F 4U3FE 2HYNA 1S9KD 2QIWA 2KK7A 4WVZA 1L0ND 5BU5A 4U3FJ 1KILB 3FWLA 2N1TA 2B87A 3Q2YA 5KAFH 1S5LE 1Q82Q 4WB4A 2M0BA 3AE4C 2XNDH 2J61A 1JB0J 1YQ3C 3NXSA 1NOHA 1WMKA 3L74E 3NMDA 3HE4B 2QJKC 3A0BE 3U1CA 1KYOH 4QMAA 3WMM0 3V2PA 1VQLP 3H32A 3GG2A 3Q5SA 1URQA 2YKPA 2ZXEB 3H1IG 3H25A 1LT1A 2WSFJ 2CPBA 5TJHA 1RE4C 3BVHA 3L75G 3P32A 1YTZT 2D2CC 1NTMJ 3O6QB 1SQBD 3AEEC 2OYIB 4HH2A 5APXA 3WUUA 3A5TA 2VRSA 2C0XA 5AVUB 1X9VA 1GW3A 1EXIA 3L72J 4DT0A 2J61B 1FZBB 2E74B 3M9QA 2K3RA 3VMYA 2O01J 1PP9G 1USEA 4H13D 3I55P 1VQ4P 1G2CB 3FWNA 1EQ7A 1SQQK 4I7ZB 1VQ6P 3BVHC 1S72P 3FX0A 3D71A 2WZ7A 1LJ2A 1ZR4A 2YIUB 1J2JB 1T2KD 1FOSE 3L75E 4I7ZC 2FYUD 2JP3A 2N9YB 3F89A 1D7MA 2OYOA 2K1AA 4WY4A 4JQ0D 3E1RA 3NFQA 4IFMA 1QVGO 5KAIE 3CX5E 4D6TJ 1JO5A 2J3GA 1CSBA 3JCUH 1NAYA 1LWUA 1HGZA 3TNUB 2KZJA 4D6TE 3M91A 3H1LD 1RF0A 1GL2B 1OWAA 3D70A 2H43A 1K8AQ 1LP1A 3PHLA 1FDMA 1HTLC 5KLVE 4WY4B 1SP4A 3HE4A 1H88A 4UB6E 1OZHA 1SQVE 1BE3E 1LTSC 1ZW0A 2A45H 4KHXA 1EC5A 2PP6A 3CCEP 1JCDA 1KMIZ 3S9OA 2Z4EC 1BSNA 2PFXA 3H1KG 2IZ1A 1NU1G 1U7MA 2JHHC 1FS0E 1PFIA 5AW2B 1KQSO 5AVTB 1L2PA 1RQUA 2OQQA 4LLHA 3CCRP 1YQ4C 1NTMD 1QGKB 1YHQP 2E74D 1LTGC 3PJSK 2E43A 3H6PA 3RK3D 4PV1D 4YXWH 3B5ND 5AVRB 2KS1B 4Y28J 1SQPE 1SQBE 1KYOD 3AEDC 1NTMG 3TF5A 3OAKA 3H32B 1N7LA 2QRXA 5M1BA 1JOCA 1IK7A 1JEKA 2XDJA 2FKWB 1YIJP 2KXPB 3H32C 3BCCD 2WITA 3HUSA 3L74J 4ZMDA 5AW6B 1SFCB 1FZCC 3L4FA 2KLUA 2QJPB 1DEEG 2AEMA 2KSJA 3ZDMA 2ZFCA 4OH8B 1HF9A 1NKZB 2RN0A 2QA4P 2KUBA 5CBNA 1BCCE 3KYQA 3L70G 3MIWA 3B71A 5APSA 1JNMA 4PD4D 2KLVA 2OTKE 2JHKF 3HUSC 1M1KQ 2IPPA 3AE1C 3HD7A 3CCUP 1ZV8A 4KJMA 2W6AA 4H0LD 3C9IA 3HUSB 3TK1A 1S2EA 1J1DC 1RH5B 5AW5B 1L4AC 1N86A 2XKMA 2XZRA 1NO4A 2GA1A 3PTZA 1IFPA 5APWA 3SFDC 2YNYA 1OXZA 4JYBA 1VQMP 2N1TB 4Y99C 2K9YA 2W90A 1J1DB 5KAIH 3L74G 5AVVB 1L4AB 3P8MC 1FICA 3AE7C 1MZ9A 3RK2D 1FZFB 1KILD 1PGQA 5CMZA 4YPCA 4R4MA 4TT3H 5DJUB 1N7SC 2SPZA 3AE2C 1NHLA 2FYNB 2FFDA 1OX3A 3L74D 3P8CD 2GUVA 3PP5A 1YJNP 2HPCC 4U7JA 3RL0B 1KILC 4ASVA 1JCCA 2JR8A 2E75C 5CBOA 1VPCA 1FIBA 1SQXJ 1URQD 3CLQA 3SWFA 4HYTB 1X22A 2ZVNB 1KC8Q 2W6BA 1FDOA 1FIDA 3RK3E 3CCMP 1VQPP 1SQPJ 1VQ9P 4M7FA 1FDIA 4OGQC 1JY3O 2OYHC 5AVQB 5E79H 5AW7B 1NTKJ 2M3BA 3ITKA 3VP8A 1GDTA 1BSHA 1RE4B 1KILA 2Q1KA 2OYIC 1ZLLA 2JWAA 2C9LY 3EFFK 2J3UA 4JYOX 2KS1A 5APYA 2HLOB 5AW9B 2QJKB 3CXHE 2Q3EA 4NPEA 5GTHH 1SLQA 1T6AA 3GHGB 2BASA 3MUDA 4H0LC 2OYHA 3A2AA 3PH0A 1EZVI 4WWIA 3TDKA 4IFDK 5CCHC 2QJYB 4LC1A 2YO3A 3L70J 3GHGC 2QM8A 3E7KA 2B88A 1GU4A 1VQ5P 2H7HA 2HPCA 1SFCA 5KJ7A 5APVA 3II6A 2E74C 4A7PA 1S4XA 1ZR2A 5KTBA 2HR3A 3A7OA 3L73D 2K9JB 4EIJA 1RE3C 2KYVA 5AVXB 4U3FG 2BEQD 1NTKG 1NWQA 3IF4A 1M56D 5AW3B 2ZXXA 1IJDB 3EQ2A 4OVNF 3FXEA 3B5NC 1L0LE 2A06D 2BCCG 1BCCJ 2IFNA 1RE3B 3MHVA 1BE3D 2WNPF 3SFEC 1H8AA 1IZNB 1FZAA 2ZAEB 1W2BO 2IFMA 1LTBC 2R5DA 2LXBA 3O8ZA 4XE5B 3P7KA 4GODA 4C7NB 2JDIH 1RE4A 3L71G 3VYIA 1PPJE 3BASA 4YXDC 4N78E 4JPZB 3IN6A 3Q1MA 4GT1A 2HG5D 1JMMA 4R9JA 2FY8A 2XNXC 2RH0A 3MZWB 4LGDE 3RBXA 1FZFA 1UIXA 1BDCA 3MGNA 4GDOA 1K73Q 1GD2E 1KYOE 2Y9ZA 1EZVD 5KJ7C 3BATA 3G6EP 2V7QJ 2FFDB 1KB9D 2JEEA 3OW2O 2JKVA 5KLVK 3OA7A 2W6JH 1AQTA 2Z4EB 5CCGC 1FJPA 3KDPB 4DOJA 4DJGA 5KKZC 3M0AA 3IR9A 3H1JG 5AW1B 1WRGA 1H0TB 1W5CE 3CXHD 3HD7D 2E76C 4L74A 2R3SA 3IAOA 1LT9C 1FZEA 4L76A 4XA4A 4JBZA 3TGUD 1SVFA 4IOIH 4H13B 1JY3N 3AE8C 1S3JA 2O3JA 2HFED 2R3CA 2NPSC 1NU1E 4UB6H 2R44A 3L36A 5AW0B 3H1HD 1DX7A 1SQPG 4H13C 1NGMB 1KN7A 3L71D 2FYUG 1NJIQ 2P1JA 3L73E 1DD4A 3CWBD 3AEGC 1ZMEC 1T3UA 1LTAC 3L73J 5B5EE 1PP9E 1N2DC 2Y9YA 4AUWA 1GK4A 1EDIA 3RL0D 1L0LD 3O6QA 1PZQA 1YBKA 4EOTA 2ZT9D 2N1TD 2IX7C 3G9RA 4BRYB 1K9MQ 4Z1MH 1LWUB 2HODC 2H89C 1QX8A 2N1TC 4Y99B 2ZJSE 2WWWA 1L0LG 2ZYDA 4I6MC 2JHMF 1S9KE 1NKNA 3VP9A 1HJ0A 5H2FH 1XTGB 3TGUG 1YJWP 2ZYAA 1OIPA 3VOPA 2GUSA 4R9TA 2Q5UA 3H1JD 5DJTB 1PPJG 1K04A 3V2NA 1FZDA 2V7QH 1QVFO 3H1KD 1SQXK 2J3FA 5KLIC 1FE6A 3USSA 1AA0A 3CXHH 2E5TA 1CW5A 1IFJA 4K35A 3E1IB 2LKMA 4W7YA 1P84D 3AE6C 5E79E 1Z3UA 1LTTC 2J3OA 2P2UA 4HJGH 1AJYA 3H1HG 3N4XA 1GL2A 1SQQD 3QWOC 1K05A 2WSCH 4PV1B 1N7SD 3BCCE 2H43B 1JTHA 3CMEP 2XNXA 2HPCB 4I1LA 3WU2H 3H1IE 1GZLA 1Q2NA 3RGUA 1HJBA 1BGYD 3KHUA 4C46A 3BCCJ 2A45G 2NPSA 1KD1Q 2RKLA 5AW8B 1JUNA 1HVVA 4OGQB 4H0LB 1AQ5A 3VMZA 3UIAA 4H44D 2YXRB 2J1GA 1Y8AA 3AE5C 3EWKA 1PGPA 3M0DA 4ZKPA 2Y0DA 2I1KA 4JF7A 2E5YA 3CX5H 2J2PA 2WSFH 1M7LA 2WT7A 3V2QA 3OJAB 1XTCC 5BU8B 5TISE 2M5AB 2Q9IB 2QSIA 2QJYC 3MD0A 2JJLA 3H1JE 4GKGA 2W83C
chains in the Genus database with same CATH topology
3TSIA 3A2AA 2KB7P 4WB4A 4WBAA 2O01H 2P67A 1DH3A 2J61A 3NXSA 2Q9IC 1NOHA 2WTYA 3NMDA 1GW4A 3HE4B 1FZEC 2Q7CA 3U1CA 2J60A 3WMM0 1FAVA 2WSEH 4IFDK 3V2PA 5CCHC 1IFIA 4LC1A 3H32A 1LTJA 2YO3A 1N73B 3GHGC 2QM8A 2OYHB 1URQA 2YKPA 2ZXEB 3G3ZA 3IFMA 5AVWB 1GU4A 2H7HA 2HPCA 2CPBA 1SFCA 5KJ7A 4I2LC 1RE4C 1L4AA 1QL2A 1N86C 5APVA 3II6A 3BVHA 2D39A 3P32A 3HRNA 1YTZT 1GTWA 1ZR2A 2I1JA 5KTBA 2GM4A 1N73C 2OYIB 4HH2A 5APXA 2XU6A 3A7OA 3A5TA 2VRSA 1CI6B 2WPRA 2NPSD 4EIJA 4ZKUA 1RE3C 2C0XA 2KYVA 5AVUB 5AVXB 1X9VA 3B8EB 2E42A 2Q9IA 1GW3A 3RK2B 1NWQA 5AW3B 1IC2A 1M1JA 1IJDB 2J61B 4JZCA 3EQ2A 2XNXB 5CCGD 1FZBB 3M9QA 4ZFGA 3VMYA 3B5NC 5AVSB 3A3YB 2QM7A 2C9NY 2IFNA 1RE3B 4JYCA 1G2CB 2Z5HA 1GU5A 3RK2C 1EQ7A 1SQQK 1FZEB 2H8PD 3BVHC 1NTZK 2JHIF 2WNPF 1H8AA 2W27A 1FZBC 2WZ7A 1T8ZA 1FZCA 1FZAA 1ZR4A 4M7HA 2IFMA 1J2JB 1LTBC 2R5DA 1T2KD 3O8ZA 4XE5B 5CJ4A 2J58A 1FOSE 3P7KA 4C7NB 4N3YB 1SQVK 1RE4A 3EFGA 1L0LK 5APTA 2C0WA 1JY2N 3VYIA 1N86B 2M8RA 3BVHB 3BASA 1MUUA 1IFMA 3R2PA 2POHA 3P8CE 4N78E 1FZGA 4AYCA 1KQLA 1E5WA 3M9HA 4GT1A 2HG5D 1HUCA 4WY4A 1JMMA 3HE5B 1IFDA 2FFDC 4R9JA 3NFQA 4IFMA 1WT6A 3RK3B 2OYIA 2XNXC 4LGDE 3B5NB 1FZFA 1A02J 3MGNA 1JO5A 2J3GA 1JY2P 1CSBA 1CZQA 1GD2E 1IFNA 1LWUA 4AQRD 5KJ7C 5APQA 3BATA 1HGZA 2FFDB 2NPSB 3TNUB 3M91A 3RK3C 4W7ZA 1N73A 2J5ZA 2JEEA 1RF0A 1GL2B 1OWAA 5KLVK 3OA7A 2H43A 2GY7A 1J1EC 1SQBK 2HODA 5CCGC 2Z4EB 1FDMA 3M0DC 1RY3A 1HTLC 1FJPA 3KDPB 4DOJA 2R5BA 3M0AA 1SP4A 2Q3IA 3HE4A 4WY4B 1H88A 3KQGA 1LT9B 4IFFA 1GL2C 1LTSC 2A45H 3IR9A 4KHXA 2PP6A 2YO2A 5BVZA 5AW1B 1JCDA 2N9BA 1JY2O 1WRGA 3LIDA 1J1EB 2KOGA 2WPSA 2Z4EC 1ZN5A 3HD7D 5CCHA 3BRVB 2KP8A 4C7RA 1LTIC 2JHHC 1LT9C 1FZEA 1PFIA 5AW2B 4XA4A 5AVTB 2J64A 1IO4A 1X79B 1G2CA 1SVFA 1FZCB 3GHGA 1JY3N 3CI9A 1L0NK 4LLHA 1YTZI 2R3CA 2HFED 2NPSC 1JY3P 1LWUC 2HODB 1T2KC 1GK6A 1G1JA 1JTHB 3M06A 1RE3A 3T97A 3L36A 5AW0B 1LTGC 2E43A 1DX7A 1FBMA 3H6PA 1MFZA 1NTMK 2XV5A 3RK3D 3SWYA 1FU1A 3TNUA 3CL3D 3KPEA 3B5ND 5AVRB 3I5CA 4GIFA 1KZUB 4WY4C 4C7NA 2P1JA 1QL1A 5CHXA 3LIEA 3OAKA 2J0HA 3H32B 1N7LA 3NTNA 1JOCA 2XDJA 4WY4D 1T3UA 1LTAC 1HGVA 5CJ0A 1N2DC 2FKWB 3U1AA 4AUWA 2FIBA 1L4AD 1GK4A 1FZGC 3RL0D 2FYUK 5KJ7D 3H32C 2WITA 3HUSA 3V4QA 1FOSF 1RF0B 5AW6B 1SFCB 4EOTA 1Z3SA 1FZCC 1YYCA 1VDFA 3L4FA 2Z5IA 2N1TD 2IX7C 3V5BA 3VMXA 3BRTB 2KSJA 1LWUB 5CCGA 2HODC 2ZFCA 4OH8B 2O1JA 1NKZB 1M1JC 1NH4A 3LW5H 3VN0A 1FZGB 2N1TC 2OARA 1IK9A 4Y99B 4GKGA 3KYQA 2WWWA 1RF0C 3MIWA 4I6MC 5APSA 2JHMF 1JNMA 3E1IA 1HWTC 2O1KA 2KLVA 1S9KE 1NKNA 3VP9A 2FYZA 1NTKK 1XTGB 2WPQA 3N7NA 1HBWA 2JHKF 3L37A 1M1JB 1NU1K 3VOPA 2GUSA 4R9TA 3HUSC 4DZOA 1GL2D 2J59M 1SQPK 2Q5UA 1URQC 1T3JA 2WT7B 4EPUA 3V2NA 2IPPA 1FZDA 1SQXK 3HD7A 5CCHD 3HD7C 2J3FA 1ZV8A 2W6AA 1DEBA 3C9IA 3HUSB 1IFJA 3TK1A 1J1DC 1CW5A 3RL0C 2A45I 3VTPC 4N6JA 1SFCC 2R32A 5AW5B 2LKMA 3E1IB 1L4AC 1N86A 1URQB 4RESB 2XKMA 4W7YA 2XZRA 1Z3UA 1NO4A 2L5GB 2J0GA 1JC9A 4NYTA 2J3FD 2YKOA 2H43C 1FZAC 5APWA 1Z56A 2YNYA 1OXZA 3HD7B 4JYBA 4M3LA 1LTTC 2N1TB 4Y99C 2J3OA 1LTJC 5AVYB 2P2UA 1J1DB 1KFMA 1RF1B 1G1IA 3FIBA 5AVVB 3HE5A 3N4XA 1GL2A 1L4AB 3P8MC 2PAJA 4O9BA 1FICA 1HH0A 2WSCH 3MTUE 1MZ9A 1N7SD 2H43B 1JTHA 3RK2D 3B5NA 2J0YA 1FZFB 1KILD 1H89A 3V4WA 5CMZA 3U59A 2XNXA 2YKQA 2HPCB 1LTJB 4I1LA 2FXMA 1N7SC 1N7SA 1GZLA 1NHLA 1HJBA 2FFDA 1NAFA 4C46A 3P8CD 1W2EA 2A45G 2GUVA 3PP5A 1FZFC 2HLOC 2NPSA 2YMYA 2HPCC 5AW8B 3RL0B 1KILC 1JUNA 1JCCA 3E1IC 1AFOA 1HVVA 1SFCD 3HTKB 5AVZB 1AQ5A 2Z4EA 3VMZA 1VPCA 1LT9A 3UIAA 1FZAB 1FIBA 3V2RA 2J1GA 1URQD 3CLQA 3SWFA 1FZBA 4HYTB 1RF1A 2W6BA 1RF1C 1FIDA 2P7JA 1MV8A 4N78D 3M0DA 1KFNA 4ZKPA 4M7FA 3TYYA 1JY3O 2JHLF 2I1KA 2OYHC 5AVQB 5AW7B 4JF7A 2HLOA 2M3BA 1X8YA 2CPSA 3L35A 3VP8A 1GDTA 1RE4B 3HTKA 2J2PA 1N7SB 1KILA 2WSFH 1M7LA 2WT7A 2OYIC 3V2QA 1ZLLA 3OJAB 5AW4B 4B86A 1CI6A 1A02F 2C9LY 1XTCC 3M9BA 2J3UA 4JYOX 2HYNA 1S9KD 5BU8B 5APYA 2HLOB 1LGHB 1FJKA 2Q9IB 2MJZA 5AW9B 5BU5A 4W80A 1KILB 1SLQA 2N1TA 3MD0A 5APUA 3GHGB 2BASA 2JJLA 3MUDA 2OYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIB A;  2FFD C;  4R9J A;  2J0H A;  3H32 B;  1FIC A;  2J61 A;  2Q9I C;  2OYI A;  2XNX C;  2H43 B;  1FZF B;  1FZE C;  2J0Y A;  1T3U A;  1FZF A;  2J60 A;  2J3G A;  1JY2 P;  3H32 A;  2XNX A;  1LTJ A;  2HPC B;  1N73 B;  1LTJ B;  3GHG C;  1LWU A;  2FIB A;  2OYH B;  1FZG C;  2FFD A;  2FFD B;  3H32 C;  3HUS A;  1N73 A;  2HPC A;  1W2E A;  1RF0 B;  1Z3S A;  1RF0 A;  2A45 G;  1FZC C;  2J5Z A;  1FZF C;  1RE4 C;  1N86 C;  3BVH A;  2D39 A;  2HLO C;  2H43 A;  1N73 C;  2HPC C;  2GY7 A;  2Z4E B;  2OYI B;  2HOD A;  1LWU B;  2HOD C;  1M1J C;  1FZG B;  3E1I C;  1RE3 C;  2Q9I A;  1RF0 C;  2Z4E A;  1LT9 B;  1LT9 A;  1FZA B;  1M1J A;  1FIB A;  2JHM F;  3E1I A;  2A45 H;  2J1G A;  2J61 B;  4JZC A;  2XNX B;  1JY2 O;  1FZB B;  1FZB A;  4ZFG A;  2Z4E C;  1RF1 A;  2JHK F;  1RF1 C;  1FID A;  1M1J B;  1RE3 B;  4R9T A;  4M7F A;  3HUS C;  1JY3 O;  2JHL F;  2OYH C;  2JHH C;  1LT9 C;  1FZE A;  1FZE B;  2HLO A;  4EPU A;  3BVH C;  2JHI F;  2WNP F;  2J64 A;  1FZB C;  1FZD A;  1FZC B;  3GHG A;  1FZC A;  1RE4 B;  1FZA A;  1JY3 N;  2J2P A;  4M7H A;  2J3F A;  1JY3 P;  2OYI C;  3HUS B;  1LWU C;  2HOD B;  2A45 I;  1RE4 A;  3E1I B;  2J3U A;  4JYO X;  1JY2 N;  1N86 A;  1RE3 A;  1N86 B;  3BVH B;  2HLO B;  1Z3U A;  2Q9I B;  2J0G A;  1JC9 A;  4NYT A;  2J3F D;  2H43 C;  1FZA C;  1FZG A;  2J3O A;  1LTJ C;  3GHG B;  1RF1 B;  2OYH A; 
#chains in the Genus database with same CATH topology
 3TSI A;  4WBA A;  2O01 H;  2P67 A;  1DH3 A;  2Q9I C;  5GTI H;  1BGY G;  2WTY A;  1GW4 A;  1TU3 F;  2Q7C A;  1FAV A;  2WSE H;  1OW7 A;  3D6Z A;  1IFI A;  1N73 B;  1P84 I;  1NTK D;  3Q3D A;  3G3Z A;  1AV1 A;  1PV3 A;  1SQX E;  4I2L C;  2IBZ I;  3FXD A;  3HRN A;  3JCU E;  2GM4 A;  1N73 C;  3CCV P;  2XU6 A;  1SQQ E;  2WPR A;  1BE3 G;  4ZKU A;  1NTZ D;  3CMA P;  3B8E B;  5KLV G;  2Q9I A;  4PD4 I;  3CCL P;  1VQ8 P;  2OTL P;  4JZC A;  3GF7 A;  1NU1 J;  1VL2 A;  5AVS B;  1GMJ A;  1BGY E;  1NTZ E;  3A3Y B;  2QM7 A;  1QEX A;  3S1K A;  4JYC A;  2WQY C;  1GU5 A;  4D6T G;  2WSE J;  1FZE B;  2H8P D;  2FYU E;  2JHI F;  1T8Z A;  3PLN A;  1FZC A;  4M7H A;  2NZ2 A;  2AEF A;  1KV4 A;  2M3E A;  5CJ4 A;  1EDK A;  3L75 J;  2KZI A;  1Y47 A;  1ZP0 C;  3W68 A;  4N3Y B;  2Q6Q A;  2IYP A;  5K5G B;  2C0W A;  1JY2 N;  1N86 B;  1MUU A;  4RO0 A;  2ZVO B;  2KNC A;  2D2C B;  1IFM A;  3WU2 E;  2POH A;  1FZG A;  1E5W A;  3M9H A;  2G3A A;  4RKU J;  1EXJ A;  1M90 Q;  2UWJ E;  2E76 D;  2PGD A;  2P10 A;  1IFD A;  1USD A;  2FFD C;  3L70 E;  2OYI A;  3FGA D;  5B66 E;  1A02 J;  1LNQ A;  3L71 E;  4NPF X;  1VF5 D;  1SS1 A;  1PGO A;  4CPG A;  2NPS B;  3JSV C;  4EI2 A;  1N73 A;  3GMA A;  1RHZ B;  1ZOY C;  4GOF A;  2FXP A;  1MFT A;  4L75 A;  1VQN P;  2B9B A;  4UB8 H;  2R5B A;  1KIL E;  2ZT9 B;  1LT9 B;  5BVZ A;  1VQK P;  4ZNC A;  2L91 A;  1NTK E;  3LID A;  1J1E B;  2KOG A;  2WPS A;  1SQV G;  5KLV D;  1SQQ J;  3BRV B;  2KP8 A;  1DIP A;  1LTI C;  3VMA A;  3R4Y A;  2J64 A;  1FZC B;  3CI9 A;  1BGY J;  1YTZ I;  1E79 H;  3CWB G;  3M06 A;  4BRY A;  3AEB C;  1FBM A;  3LW5 J;  2Y0C A;  3L71 J;  1NTM K;  1FU1 A;  3TNU A;  3KPE A;  3I5C A;  3ABV C;  2B87 B;  2PRR A;  3H1J J;  1OVU A;  3CC2 P;  2AXT E;  4WY4 C;  4C7N A;  1QL1 A;  1VQO P;  3NTN A;  3MP7 B;  2FIB A;  2IZ0 A;  2OTJ P;  2FYU K;  1X0T A;  5KJ7 D;  2D2C D;  3AE3 C;  1FOS F;  1Z3S A;  1YYC A;  3PRJ A;  1JMB A;  1OMI A;  1SQV J;  3G4S P;  2W8Z A;  3VMX A;  4PD4 E;  3BRT B;  2Y0E A;  2QG4 A;  3WUV A;  1M1J C;  1NH4 A;  3LW5 H;  1IK9 A;  3WUT A;  1NTZ J;  2B89 A;  1HWT C;  3A0H H;  4PV1 C;  3G71 P;  2WVR A;  2FYZ A;  1NTK K;  3TGU E;  3N7N A;  1LP1 B;  3L37 A;  5KLI B;  1M1J B;  1R8E A;  3H1L E;  3L73 G;  4DZO A;  1GL2 D;  3GF3 A;  1T3J A;  2WT7 B;  3Q5R A;  4H44 C;  3K5B A;  5CCH D;  2IBZ G;  2DW3 A;  1DEB A;  2KNC B;  3RL0 C;  4N6J A;  1SFC C;  3QH9 A;  2L5G B;  1JC9 A;  4NYT A;  2J3F D;  2YKO A;  2H43 C;  3CWB E;  2A06 E;  1Z56 A;  3S4R A;  2IBZ D;  1G1I A;  3FIB A;  3HE5 A;  1ZRT E;  4O9B A;  3MTU E;  3KZI E;  3B5N A;  2IYO A;  4PD4 H;  3V4W A;  3CC7 P;  3U59 A;  3H1I J;  2YKQ A;  1LTJ B;  2LXC B;  1MKM A;  4IL6 E;  1NAF A;  1W2E A;  5KAF E;  1KB9 I;  2HLO C;  2KSE A;  3AEC C;  2YMY A;  3AE9 C;  2FBW C;  3H1L J;  1OW6 A;  5TIS H;  1AFO A;  1N8R Q;  3HTK B;  5AVZ B;  1NTM E;  1LT9 A;  1FZA B;  1SQB G;  1PPJ D;  3KXD A;  1BCC G;  1RF1 C;  2P7J A;  1MV8 A;  4N78 D;  2I8D A;  3A0H E;  1KFN A;  2JHL F;  1SQP D;  2YMK A;  2HLO A;  2JO1 A;  3L72 E;  1X8Y A;  2CPS A;  3L35 A;  4XFJ A;  1N7S B;  2FYN C;  1OW8 A;  4MN4 C;  1PP9 J;  4B86 A;  1CI6 A;  5GTI E;  3M9B A;  4EYY Q;  1LGH B;  1FJK A;  1SQQ G;  2MJZ A;  2IDB A;  1KB9 E;  4BXL A;  2K9J A;  4W80 A;  4ASW A;  5APU A;  1YI2 P;  1SQX G;  3BCC G;  2KB7 P;  1YJ9 P;  2CK3 H;  1KQF B;  1FC2 C;  4OGQ D;  1FZE C;  2J60 A;  3H1L G;  1LTJ A;  1NTZ G;  3KZI H;  2OYH B;  3IFM A;  3L70 D;  3B4S A;  5AVW B;  4R4L A;  3MUD C;  2E75 D;  1L4A A;  1QL2 A;  1N86 C;  4K3A A;  3CCQ P;  2D39 A;  1GTW A;  2I1J A;  2QVA A;  2P58 A;  2WSS H;  1CI6 B;  4OWF A;  2NPS D;  4D6T D;  3RL0 g;  1PGJ A;  1KTM A;  1BDD A;  3RK2 B;  2E42 A;  2OGU A;  1NU1 D;  1L0N J;  1IC2 A;  1M1J A;  4EDF A;  2XNX B;  5B5E H;  3H1K J;  5CCG D;  4ZFG A;  3C1L A;  2WMM A;  1EDJ A;  2C9N Y;  2Z5H A;  2H88 C;  1UII A;  3RK2 C;  1KB9 H;  2BEZ F;  2IBZ E;  1NTZ K;  1ZRT D;  2W27 A;  1FZB C;  3GLM A;  1L0N E;  5L8R J;  2J58 A;  1JM0 A;  1PP9 D;  1SQV K;  3EFG A;  1OVV A;  1L0L K;  5APT A;  1OVR A;  2AXT H;  2M8R A;  3BVH B;  1BE3 J;  5KKZ B;  1Q86 Q;  2ZT9 C;  3R2P A;  2FYU J;  5H2F E;  3P8C E;  5KLV J;  4AYC A;  1KQL A;  1HUC A;  2NRG A;  3HE5 B;  3CD6 P;  3L72 D;  4GOE A;  1M57 D;  1WT6 A;  3CX5 I;  3RK3 B;  3H1K E;  1NYH A;  3B5N B;  1KQG B;  3D6Y A;  1SQX D;  1JY2 P;  2KI7 B;  1CZQ A;  2JWD A;  1IFN A;  4AQR D;  4HKZ H;  5APQ A;  1M8O B;  3RK3 C;  4W7Z A;  2MKV A;  2J5Z A;  2YIU C;  4TLF A;  2GY7 A;  1J1E C;  1SQB K;  2HOD A;  1R5S A;  5C39 A;  1L0L J;  3M0D C;  1RY3 A;  2Q3I A;  3KQG A;  1VQ7 P;  4IFF A;  1GL2 C;  3V6I A;  4IL6 H;  2YO2 A;  2N9B A;  1JY2 O;  2WSC J;  1ZN5 A;  5CCH A;  4PJ0 H;  2YXQ B;  5B66 H;  1ZXG A;  4C7R A;  1VF5 C;  2K88 A;  2BCC J;  1IO4 A;  1X79 B;  1G2C A;  3H1H E;  3GHG A;  2FXO A;  1L0N K;  2AXC A;  1SQB J;  2WPV B;  4HB1 A;  1JY3 P;  1LWU C;  2HOD B;  1T2K C;  1VF5 B;  1GK6 A;  1G1J A;  1JTH B;  1Q81 Q;  1RE3 A;  3T97 A;  2ZYG A;  1PL5 A;  1RQV A;  1OFC X;  1MFZ A;  2XV5 A;  3SWY A;  2G8Y A;  4KT0 J;  3CL3 D;  5GTH E;  3AEF C;  4GIF A;  1KZU B;  5CHX A;  3LIE A;  2J0H A;  4WY4 D;  1HGV A;  4H44 B;  5CJ0 A;  2E76 B;  3U1A A;  3CCS P;  3L72 G;  4IL6 X;  4U3F D;  1L4A D;  1FZG C;  1P84 H;  3V4Q A;  1RF0 B;  1U7J A;  1VDF A;  2Z5I A;  3CWB J;  4PJ0 E;  3V5B A;  1DD3 A;  3I56 P;  2BCC D;  5CCG A;  1Q7Y Q;  2O1J A;  3W67 A;  1FZG B;  3VN0 A;  1KYO I;  2OAR A;  1AVY A;  1KOR A;  1RF0 C;  4DCK A;  1PIX A;  4UB8 E;  5EFW B;  3E1I A;  2BCC E;  2O1K A;  1EZV E;  2ITA A;  2WPQ A;  1HBW A;  1S5L X;  1NU1 K;  1S1C X;  2J59 M;  1Q90 D;  1SQP K;  2AEJ A;  1S5L H;  1AVO A;  1URQ C;  4EPU A;  2M5A A;  3HD7 C;  3A0B H;  1L0N G;  3SSU A;  2QEX P;  3F5H A;  2J5U A;  3CPW O;  2A45 I;  3VTP C;  3CC4 P;  2R32 A;  1URQ B;  4RES B;  2QJP C;  2J0G A;  1FZA C;  2KIK A;  3HD7 B;  4M3L A;  2V4H A;  1EZV G;  2RMZ A;  1LTJ C;  2O01 N;  5AVY B;  1KFM A;  1RF1 B;  1P84 E;  3TGU J;  2PAJ A;  1HH0 A;  4RJT A;  2J0Y A;  1H89 A;  4BWN A;  2LR2 A;  2FXM A;  1N7S A;  3AEA C;  4NPD A;  1BCC D;  1FZF C;  2QE7 H;  3T97 B;  2K37 A;  3CCJ P;  3SWK A;  3JC2 2;  3H1I D;  3E1I C;  3GW6 A;  2A06 G;  1SFC D;  3C8V A;  3L75 D;  2Z4E A;  3V2R A;  1EDL A;  3H1H J;  1NVO A;  1FZB A;  1U57 A;  3RBZ A;  1Y9B A;  1R5L A;  1RF1 A;  2E75 B;  3TYY A;  1H0T A;  3CXH I;  4L73 A;  3HTK A;  1QLE D;  1YIT P;  3CX5 D;  4YTP C;  3Q5P A;  5AW4 B;  1SQV D;  1A02 F;  4U3F E;  2HYN A;  1S9K D;  2QIW A;  2KK7 A;  4WVZ A;  1L0N D;  5BU5 A;  4U3F J;  1KIL B;  3FWL A;  2N1T A;  2B87 A;  3Q2Y A;  5KAF H;  1S5L E;  1Q82 Q;  4WB4 A;  2M0B A;  3AE4 C;  2XND H;  2J61 A;  1JB0 J;  1YQ3 C;  3NXS A;  1NOH A;  1WMK A;  3L74 E;  3NMD A;  3HE4 B;  2QJK C;  3A0B E;  3U1C A;  1KYO H;  4QMA A;  3WMM 0;  3V2P A;  1VQL P;  3H32 A;  3GG2 A;  3Q5S A;  1URQ A;  2YKP A;  2ZXE B;  3H1I G;  3H25 A;  1LT1 A;  2WSF J;  2CPB A;  5TJH A;  1RE4 C;  3BVH A;  3L75 G;  3P32 A;  1YTZ T;  2D2C C;  1NTM J;  3O6Q B;  1SQB D;  3AEE C;  2OYI B;  4HH2 A;  5APX A;  3WUU A;  3A5T A;  2VRS A;  2C0X A;  5AVU B;  1X9V A;  1GW3 A;  1EXI A;  3L72 J;  4DT0 A;  2J61 B;  1FZB B;  2E74 B;  3M9Q A;  2K3R A;  3VMY A;  2O01 J;  1PP9 G;  1USE A;  4H13 D;  3I55 P;  1VQ4 P;  1G2C B;  3FWN A;  1EQ7 A;  1SQQ K;  4I7Z B;  1VQ6 P;  3BVH C;  1S72 P;  3FX0 A;  3D71 A;  2WZ7 A;  1LJ2 A;  1ZR4 A;  2YIU B;  1J2J B;  1T2K D;  1FOS E;  3L75 E;  4I7Z C;  2FYU D;  2JP3 A;  2N9Y B;  3F89 A;  1D7M A;  2OYO A;  2K1A A;  4WY4 A;  4JQ0 D;  3E1R A;  3NFQ A;  4IFM A;  1QVG O;  5KAI E;  3CX5 E;  4D6T J;  1JO5 A;  2J3G A;  1CSB A;  3JCU H;  1NAY A;  1LWU A;  1HGZ A;  3TNU B;  2KZJ A;  4D6T E;  3M91 A;  3H1L D;  1RF0 A;  1GL2 B;  1OWA A;  3D70 A;  2H43 A;  1K8A Q;  1LP1 A;  3PHL A;  1FDM A;  1HTL C;  5KLV E;  4WY4 B;  1SP4 A;  3HE4 A;  1H88 A;  4UB6 E;  1OZH A;  1SQV E;  1BE3 E;  1LTS C;  1ZW0 A;  2A45 H;  4KHX A;  1EC5 A;  2PP6 A;  3CCE P;  1JCD A;  1KMI Z;  3S9O A;  2Z4E C;  1BSN A;  2PFX A;  3H1K G;  2IZ1 A;  1NU1 G;  1U7M A;  2JHH C;  1FS0 E;  1PFI A;  5AW2 B;  1KQS O;  5AVT B;  1L2P A;  1RQU A;  2OQQ A;  4LLH A;  3CCR P;  1YQ4 C;  1NTM D;  1QGK B;  1YHQ P;  2E74 D;  1LTG C;  3PJS K;  2E43 A;  3H6P A;  3RK3 D;  4PV1 D;  4YXW H;  3B5N D;  5AVR B;  2KS1 B;  4Y28 J;  1SQP E;  1SQB E;  1KYO D;  3AED C;  1NTM G;  3TF5 A;  3OAK A;  3H32 B;  1N7L A;  2QRX A;  5M1B A;  1JOC A;  1IK7 A;  1JEK A;  2XDJ A;  2FKW B;  1YIJ P;  2KXP B;  3H32 C;  3BCC D;  2WIT A;  3HUS A;  3L74 J;  4ZMD A;  5AW6 B;  1SFC B;  1FZC C;  3L4F A;  2KLU A;  2QJP B;  1DEE G;  2AEM A;  2KSJ A;  3ZDM A;  2ZFC A;  4OH8 B;  1HF9 A;  1NKZ B;  2RN0 A;  2QA4 P;  2KUB A;  5CBN A;  1BCC E;  3KYQ A;  3L70 G;  3MIW A;  3B71 A;  5APS A;  1JNM A;  4PD4 D;  2KLV A;  2OTK E;  2JHK F;  3HUS C;  1M1K Q;  2IPP A;  3AE1 C;  3HD7 A;  3CCU P;  1ZV8 A;  4KJM A;  2W6A A;  4H0L D;  3C9I A;  3HUS B;  3TK1 A;  1S2E A;  1J1D C;  1RH5 B;  5AW5 B;  1L4A C;  1N86 A;  2XKM A;  2XZR A;  1NO4 A;  2GA1 A;  3PTZ A;  1IFP A;  5APW A;  3SFD C;  2YNY A;  1OXZ A;  4JYB A;  1VQM P;  2N1T B;  4Y99 C;  2K9Y A;  2W90 A;  1J1D B;  5KAI H;  3L74 G;  5AVV B;  1L4A B;  3P8M C;  1FIC A;  3AE7 C;  1MZ9 A;  3RK2 D;  1FZF B;  1KIL D;  1PGQ A;  5CMZ A;  4YPC A;  4R4M A;  4TT3 H;  5DJU B;  1N7S C;  2SPZ A;  3AE2 C;  1NHL A;  2FYN B;  2FFD A;  1OX3 A;  3L74 D;  3P8C D;  2GUV A;  3PP5 A;  1YJN P;  2HPC C;  4U7J A;  3RL0 B;  1KIL C;  4ASV A;  1JCC A;  2JR8 A;  2E75 C;  5CBO A;  1VPC A;  1FIB A;  1SQX J;  1URQ D;  3CLQ A;  3SWF A;  4HYT B;  1X22 A;  2ZVN B;  1KC8 Q;  2W6B A;  1FDO A;  1FID A;  3RK3 E;  3CCM P;  1VQP P;  1SQP J;  1VQ9 P;  4M7F A;  1FDI A;  4OGQ C;  1JY3 O;  2OYH C;  5AVQ B;  5E79 H;  5AW7 B;  1NTK J;  2M3B A;  3ITK A;  3VP8 A;  1GDT A;  1BSH A;  1RE4 B;  1KIL A;  2Q1K A;  2OYI C;  1ZLL A;  2JWA A;  2C9L Y;  3EFF K;  2J3U A;  4JYO X;  2KS1 A;  5APY A;  2HLO B;  5AW9 B;  2QJK B;  3CXH E;  2Q3E A;  4NPE A;  5GTH H;  1SLQ A;  1T6A A;  3GHG B;  2BAS A;  3MUD A;  4H0L C;  2OYH A;  3A2A A;  3PH0 A;  1EZV I;  4WWI A;  3TDK A;  4IFD K;  5CCH C;  2QJY B;  4LC1 A;  2YO3 A;  3L70 J;  3GHG C;  2QM8 A;  3E7K A;  2B88 A;  1GU4 A;  1VQ5 P;  2H7H A;  2HPC A;  1SFC A;  5KJ7 A;  5APV A;  3II6 A;  2E74 C;  4A7P A;  1S4X A;  1ZR2 A;  5KTB A;  2HR3 A;  3A7O A;  3L73 D;  2K9J B;  4EIJ A;  1RE3 C;  2KYV A;  5AVX B;  4U3F G;  2BEQ D;  1NTK G;  1NWQ A;  3IF4 A;  1M56 D;  5AW3 B;  2ZXX A;  1IJD B;  3EQ2 A;  4OVN F;  3FXE A;  3B5N C;  1L0L E;  2A06 D;  2BCC G;  1BCC J;  2IFN A;  1RE3 B;  3MHV A;  1BE3 D;  2WNP F;  3SFE C;  1H8A A;  1IZN B;  1FZA A;  2ZAE B;  1W2B O;  2IFM A;  1LTB C;  2R5D A;  2LXB A;  3O8Z A;  4XE5 B;  3P7K A;  4GOD A;  4C7N B;  2JDI H;  1RE4 A;  3L71 G;  3VYI A;  1PPJ E;  3BAS A;  4YXD C;  4N78 E;  4JPZ B;  3IN6 A;  3Q1M A;  4GT1 A;  2HG5 D;  1JMM A;  4R9J A;  2FY8 A;  2XNX C;  2RH0 A;  3MZW B;  4LGD E;  3RBX A;  1FZF A;  1UIX A;  1BDC A;  3MGN A;  4GDO A;  1K73 Q;  1GD2 E;  1KYO E;  2Y9Z A;  1EZV D;  5KJ7 C;  3BAT A;  3G6E P;  2V7Q J;  2FFD B;  1KB9 D;  2JEE A;  3OW2 O;  2JKV A;  5KLV K;  3OA7 A;  2W6J H;  1AQT A;  2Z4E B;  5CCG C;  1FJP A;  3KDP B;  4DOJ A;  4DJG A;  5KKZ C;  3M0A A;  3IR9 A;  3H1J G;  5AW1 B;  1WRG A;  1H0T B;  1W5C E;  3CXH D;  3HD7 D;  2E76 C;  4L74 A;  2R3S A;  3IAO A;  1LT9 C;  1FZE A;  4L76 A;  4XA4 A;  4JBZ A;  3TGU D;  1SVF A;  4IOI H;  4H13 B;  1JY3 N;  3AE8 C;  1S3J A;  2O3J A;  2HFE D;  2R3C A;  2NPS C;  1NU1 E;  4UB6 H;  2R44 A;  3L36 A;  5AW0 B;  3H1H D;  1DX7 A;  1SQP G;  4H13 C;  1NGM B;  1KN7 A;  3L71 D;  2FYU G;  1NJI Q;  2P1J A;  3L73 E;  1DD4 A;  3CWB D;  3AEG C;  1ZME C;  1T3U A;  1LTA C;  3L73 J;  5B5E E;  1PP9 E;  1N2D C;  2Y9Y A;  4AUW A;  1GK4 A;  1EDI A;  3RL0 D;  1L0L D;  3O6Q A;  1PZQ A;  1YBK A;  4EOT A;  2ZT9 D;  2N1T D;  2IX7 C;  3G9R A;  4BRY B;  1K9M Q;  4Z1M H;  1LWU B;  2HOD C;  2H89 C;  1QX8 A;  2N1T C;  4Y99 B;  2ZJS E;  2WWW A;  1L0L G;  2ZYD A;  4I6M C;  2JHM F;  1S9K E;  1NKN A;  3VP9 A;  1HJ0 A;  5H2F H;  1XTG B;  3TGU G;  1YJW P;  2ZYA A;  1OIP A;  3VOP A;  2GUS A;  4R9T A;  2Q5U A;  3H1J D;  5DJT B;  1PPJ G;  1K04 A;  3V2N A;  1FZD A;  2V7Q H;  1QVF O;  3H1K D;  1SQX K;  2J3F A;  5KLI C;  1FE6 A;  3USS A;  1AA0 A;  3CXH H;  2E5T A;  1CW5 A;  1IFJ A;  4K35 A;  3E1I B;  2LKM A;  4W7Y A;  1P84 D;  3AE6 C;  5E79 E;  1Z3U A;  1LTT C;  2J3O A;  2P2U A;  4HJG H;  1AJY A;  3H1H G;  3N4X A;  1GL2 A;  1SQQ D;  3QWO C;  1K05 A;  2WSC H;  4PV1 B;  1N7S D;  3BCC E;  2H43 B;  1JTH A;  3CME P;  2XNX A;  2HPC B;  4I1L A;  3WU2 H;  3H1I E;  1GZL A;  1Q2N A;  3RGU A;  1HJB A;  1BGY D;  3KHU A;  4C46 A;  3BCC J;  2A45 G;  2NPS A;  1KD1 Q;  2RKL A;  5AW8 B;  1JUN A;  1HVV A;  4OGQ B;  4H0L B;  1AQ5 A;  3VMZ A;  3UIA A;  4H44 D;  2YXR B;  2J1G A;  1Y8A A;  3AE5 C;  3EWK A;  1PGP A;  3M0D A;  4ZKP A;  2Y0D A;  2I1K A;  4JF7 A;  2E5Y A;  3CX5 H;  2J2P A;  2WSF H;  1M7L A;  2WT7 A;  3V2Q A;  3OJA B;  1XTC C;  5BU8 B;  5TIS E;  2M5A B;  2Q9I B;  2QSI A;  2QJY C;  3MD0 A;  2JJL A;  3H1J E;  4GKG A;  2W83 C; 
#chains in the Genus database with same CATH homology
 3TSI A;  3A2A A;  2KB7 P;  4WB4 A;  4WBA A;  2O01 H;  2P67 A;  1DH3 A;  2J61 A;  3NXS A;  2Q9I C;  1NOH A;  2WTY A;  3NMD A;  1GW4 A;  3HE4 B;  1FZE C;  2Q7C A;  3U1C A;  2J60 A;  3WMM 0;  1FAV A;  2WSE H;  4IFD K;  3V2P A;  5CCH C;  1IFI A;  4LC1 A;  3H32 A;  1LTJ A;  2YO3 A;  1N73 B;  3GHG C;  2QM8 A;  2OYH B;  1URQ A;  2YKP A;  2ZXE B;  3G3Z A;  3IFM A;  5AVW B;  1GU4 A;  2H7H A;  2HPC A;  2CPB A;  1SFC A;  5KJ7 A;  4I2L C;  1RE4 C;  1L4A A;  1QL2 A;  1N86 C;  5APV A;  3II6 A;  3BVH A;  2D39 A;  3P32 A;  3HRN A;  1YTZ T;  1GTW A;  1ZR2 A;  2I1J A;  5KTB A;  2GM4 A;  1N73 C;  2OYI B;  4HH2 A;  5APX A;  2XU6 A;  3A7O A;  3A5T A;  2VRS A;  1CI6 B;  2WPR A;  2NPS D;  4EIJ A;  4ZKU A;  1RE3 C;  2C0X A;  2KYV A;  5AVU B;  5AVX B;  1X9V A;  3B8E B;  2E42 A;  2Q9I A;  1GW3 A;  3RK2 B;  1NWQ A;  5AW3 B;  1IC2 A;  1M1J A;  1IJD B;  2J61 B;  4JZC A;  3EQ2 A;  2XNX B;  5CCG D;  1FZB B;  3M9Q A;  4ZFG A;  3VMY A;  3B5N C;  5AVS B;  3A3Y B;  2QM7 A;  2C9N Y;  2IFN A;  1RE3 B;  4JYC A;  1G2C B;  2Z5H A;  1GU5 A;  3RK2 C;  1EQ7 A;  1SQQ K;  1FZE B;  2H8P D;  3BVH C;  1NTZ K;  2JHI F;  2WNP F;  1H8A A;  2W27 A;  1FZB C;  2WZ7 A;  1T8Z A;  1FZC A;  1FZA A;  1ZR4 A;  4M7H A;  2IFM A;  1J2J B;  1LTB C;  2R5D A;  1T2K D;  3O8Z A;  4XE5 B;  5CJ4 A;  2J58 A;  1FOS E;  3P7K A;  4C7N B;  4N3Y B;  1SQV K;  1RE4 A;  3EFG A;  1L0L K;  5APT A;  2C0W A;  1JY2 N;  3VYI A;  1N86 B;  2M8R A;  3BVH B;  3BAS A;  1MUU A;  1IFM A;  3R2P A;  2POH A;  3P8C E;  4N78 E;  1FZG A;  4AYC A;  1KQL A;  1E5W A;  3M9H A;  4GT1 A;  2HG5 D;  1HUC A;  4WY4 A;  1JMM A;  3HE5 B;  1IFD A;  2FFD C;  4R9J A;  3NFQ A;  4IFM A;  1WT6 A;  3RK3 B;  2OYI A;  2XNX C;  4LGD E;  3B5N B;  1FZF A;  1A02 J;  3MGN A;  1JO5 A;  2J3G A;  1JY2 P;  1CSB A;  1CZQ A;  1GD2 E;  1IFN A;  1LWU A;  4AQR D;  5KJ7 C;  5APQ A;  3BAT A;  1HGZ A;  2FFD B;  2NPS B;  3TNU B;  3M91 A;  3RK3 C;  4W7Z A;  1N73 A;  2J5Z A;  2JEE A;  1RF0 A;  1GL2 B;  1OWA A;  5KLV K;  3OA7 A;  2H43 A;  2GY7 A;  1J1E C;  1SQB K;  2HOD A;  5CCG C;  2Z4E B;  1FDM A;  3M0D C;  1RY3 A;  1HTL C;  1FJP A;  3KDP B;  4DOJ A;  2R5B A;  3M0A A;  1SP4 A;  2Q3I A;  3HE4 A;  4WY4 B;  1H88 A;  3KQG A;  1LT9 B;  4IFF A;  1GL2 C;  1LTS C;  2A45 H;  3IR9 A;  4KHX A;  2PP6 A;  2YO2 A;  5BVZ A;  5AW1 B;  1JCD A;  2N9B A;  1JY2 O;  1WRG A;  3LID A;  1J1E B;  2KOG A;  2WPS A;  2Z4E C;  1ZN5 A;  3HD7 D;  5CCH A;  3BRV B;  2KP8 A;  4C7R A;  1LTI C;  2JHH C;  1LT9 C;  1FZE A;  1PFI A;  5AW2 B;  4XA4 A;  5AVT B;  2J64 A;  1IO4 A;  1X79 B;  1G2C A;  1SVF A;  1FZC B;  3GHG A;  1JY3 N;  3CI9 A;  1L0N K;  4LLH A;  1YTZ I;  2R3C A;  2HFE D;  2NPS C;  1JY3 P;  1LWU C;  2HOD B;  1T2K C;  1GK6 A;  1G1J A;  1JTH B;  3M06 A;  1RE3 A;  3T97 A;  3L36 A;  5AW0 B;  1LTG C;  2E43 A;  1DX7 A;  1FBM A;  3H6P A;  1MFZ A;  1NTM K;  2XV5 A;  3RK3 D;  3SWY A;  1FU1 A;  3TNU A;  3CL3 D;  3KPE A;  3B5N D;  5AVR B;  3I5C A;  4GIF A;  1KZU B;  4WY4 C;  4C7N A;  2P1J A;  1QL1 A;  5CHX A;  3LIE A;  3OAK A;  2J0H A;  3H32 B;  1N7L A;  3NTN A;  1JOC A;  2XDJ A;  4WY4 D;  1T3U A;  1LTA C;  1HGV A;  5CJ0 A;  1N2D C;  2FKW B;  3U1A A;  4AUW A;  2FIB A;  1L4A D;  1GK4 A;  1FZG C;  3RL0 D;  2FYU K;  5KJ7 D;  3H32 C;  2WIT A;  3HUS A;  3V4Q A;  1FOS F;  1RF0 B;  5AW6 B;  1SFC B;  4EOT A;  1Z3S A;  1FZC C;  1YYC A;  1VDF A;  3L4F A;  2Z5I A;  2N1T D;  2IX7 C;  3V5B A;  3VMX A;  3BRT B;  2KSJ A;  1LWU B;  5CCG A;  2HOD C;  2ZFC A;  4OH8 B;  2O1J A;  1NKZ B;  1M1J C;  1NH4 A;  3LW5 H;  3VN0 A;  1FZG B;  2N1T C;  2OAR A;  1IK9 A;  4Y99 B;  4GKG A;  3KYQ A;  2WWW A;  1RF0 C;  3MIW A;  4I6M C;  5APS A;  2JHM F;  1JNM A;  3E1I A;  1HWT C;  2O1K A;  2KLV A;  1S9K E;  1NKN A;  3VP9 A;  2FYZ A;  1NTK K;  1XTG B;  2WPQ A;  3N7N A;  1HBW A;  2JHK F;  3L37 A;  1M1J B;  1NU1 K;  3VOP A;  2GUS A;  4R9T A;  3HUS C;  4DZO A;  1GL2 D;  2J59 M;  1SQP K;  2Q5U A;  1URQ C;  1T3J A;  2WT7 B;  4EPU A;  3V2N A;  2IPP A;  1FZD A;  1SQX K;  3HD7 A;  5CCH D;  3HD7 C;  2J3F A;  1ZV8 A;  2W6A A;  1DEB A;  3C9I A;  3HUS B;  1IFJ A;  3TK1 A;  1J1D C;  1CW5 A;  3RL0 C;  2A45 I;  3VTP C;  4N6J A;  1SFC C;  2R32 A;  5AW5 B;  2LKM A;  3E1I B;  1L4A C;  1N86 A;  1URQ B;  4RES B;  2XKM A;  4W7Y A;  2XZR A;  1Z3U A;  1NO4 A;  2L5G B;  2J0G A;  1JC9 A;  4NYT A;  2J3F D;  2YKO A;  2H43 C;  1FZA C;  5APW A;  1Z56 A;  2YNY A;  1OXZ A;  3HD7 B;  4JYB A;  4M3L A;  1LTT C;  2N1T B;  4Y99 C;  2J3O A;  1LTJ C;  5AVY B;  2P2U A;  1J1D B;  1KFM A;  1RF1 B;  1G1I A;  3FIB A;  5AVV B;  3HE5 A;  3N4X A;  1GL2 A;  1L4A B;  3P8M C;  2PAJ A;  4O9B A;  1FIC A;  1HH0 A;  2WSC H;  3MTU E;  1MZ9 A;  1N7S D;  2H43 B;  1JTH A;  3RK2 D;  3B5N A;  2J0Y A;  1FZF B;  1KIL D;  1H89 A;  3V4W A;  5CMZ A;  3U59 A;  2XNX A;  2YKQ A;  2HPC B;  1LTJ B;  4I1L A;  2FXM A;  1N7S C;  1N7S A;  1GZL A;  1NHL A;  1HJB A;  2FFD A;  1NAF A;  4C46 A;  3P8C D;  1W2E A;  2A45 G;  2GUV A;  3PP5 A;  1FZF C;  2HLO C;  2NPS A;  2YMY A;  2HPC C;  5AW8 B;  3RL0 B;  1KIL C;  1JUN A;  1JCC A;  3E1I C;  1AFO A;  1HVV A;  1SFC D;  3HTK B;  5AVZ B;  1AQ5 A;  2Z4E A;  3VMZ A;  1VPC A;  1LT9 A;  3UIA A;  1FZA B;  1FIB A;  3V2R A;  2J1G A;  1URQ D;  3CLQ A;  3SWF A;  1FZB A;  4HYT B;  1RF1 A;  2W6B A;  1RF1 C;  1FID A;  2P7J A;  1MV8 A;  4N78 D;  3M0D A;  1KFN A;  4ZKP A;  4M7F A;  3TYY A;  1JY3 O;  2JHL F;  2I1K A;  2OYH C;  5AVQ B;  5AW7 B;  4JF7 A;  2HLO A;  2M3B A;  1X8Y A;  2CPS A;  3L35 A;  3VP8 A;  1GDT A;  1RE4 B;  3HTK A;  2J2P A;  1N7S B;  1KIL A;  2WSF H;  1M7L A;  2WT7 A;  2OYI C;  3V2Q A;  1ZLL A;  3OJA B;  5AW4 B;  4B86 A;  1CI6 A;  1A02 F;  2C9L Y;  1XTC C;  3M9B A;  2J3U A;  4JYO X;  2HYN A;  1S9K D;  5BU8 B;  5APY A;  2HLO B;  1LGH B;  1FJK A;  2Q9I B;  2MJZ A;  5AW9 B;  5BU5 A;  4W80 A;  1KIL B;  1SLQ A;  2N1T A;  3MD0 A;  5APU A;  3GHG B;  2BAS A;  2JJL A;  3MUD A;  2OYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...