1M1JB

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
402
structure length
402
Chain Sequence
IYPDAGGCKHPLDELGVLCPTGCELQTTLLKQEKTVKPVLRDLKDRVAKFSDTSTTMYQYVNMIDNKLVKTQKQRKDNDIILSEYNTEMELHYNYIKDNLDNNIPSSLRVLRAVIDSLHKKIQKLENAIATQTDYCRSPCVASCNIPVVSGRECEDIYRKGGETSEMYIIQPDPFTTPYRVYCDMETDNGGWTLIQNRQDGSVNFGRAWDEYKRGFGNIAKSGGKKYCDTPGEYWLGNDKISQLTKIGPTKVLIEMEDWNGDKVSALYGGFTIHNEGNKYQLSVSNYKGNAGNALMEGASQLYGENRTMTIHNGMYFSTYDRDNDGWLTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGTYSWDMAKHGTDDGIVWMNWKGSWYSMKKMSMKIKPYFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha subunit
total genus 128
structure length 402
sequence length 402
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
B PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1m1jB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1m1jB02
1Z3SA 1JY2P 3E1IB 3GHGB 3BVHA 2J64A 1FZBC 1LWUC 1RE4A 2OYHB 1FIBA 2FFDA 2JHHC 2A45G 2HODA 2J1GA 2XNXA 2Q9IA 2JHLF 2OYIB 2J0GA 1T3UA 1LTJB 1FZAB 1RF1A 1N86C 2Z4EB 2HLOB 1RF0C 4JYOX 2J0HA 2HLOC 1FZGB 2J0YA 2XNXB 1LWUA 4R9JA 1N86B 1FICA 1JC9A 3HUSB 2HPCC 2J2PA 2OYIA 3H32A 1M1JB 2A45H 1RF1C 2JHMF 1FZAA 1RF1B 2HPCA 1LT9A 1FZEC 1JY3N 2GY7A 1M1JC 2WNPF 4EPUA 4ZFGA 2OYHC 2A45I 1LWUB 3E1IA 3GHGA 2XNXC 3BVHB 2D39A 3HUSC 4R9TA 1FZCB 3GHGC 1JY2N 3E1IC 1FZGC 1W2EA 1JY2O 1FZCC 1LTJC 1FZDA 3BVHC 3H32C 2J5ZA 1FZEB 1JY3P 2JHIF 1LTJA 1N73A 1FZCA 2H43B 2HLOA 4JZCA 4NYTA 2J3UA 1JY3O 4M7FA 1FZFA 4M7HA 1FIDA 1N86A 1RE3A 1RF0B 2Z4EC 1FZEA 1LT9C 1FZAC 2J61A 1N73B 2HPCB 2Q9IC 2OYIC 1Z3UA 2FFDB 2HODC 2FFDC 1RE4C 1FZFB 2Q9IB 1N73C 2JHKF 1RF0A 2J3FA 1FZBB 2J61B 2J3FD 2Z4EA 2J3OA 1RE3C 1FZGA 2H43C 1FZFC 2FIBA 3HUSA 3FIBA 2H43A 2J3GA 2OYHA 1RE4B 3H32B 1M1JA 2HODB 1FZBA 1LT9B 2J60A 1RE3B
chains in the Genus database with same CATH superfamily
1BE3J 1BCCJ 3CXHD 1L0LE 3V2RA 1T6AA 1MFTA 4HB1A 3H1KJ 3RK2D 2FFDA 1YITP 2P2UA 3PH0A 1AV1A 1SQBD 1FJKA 3HD7D 4R4MA 4BRYB 1U57A 3BATA 1T3UA 1Q86Q 2RH0A 1RY3A 2Z4EB 1SQPJ 4IOIH 2FYNB 4EI2A 2KUBA 4XFJA 1Q82Q 3V4QA 5AW6B 1IZNB 1DH3A 1BGYJ 4U7JA 2IYOA 4EPUA 3V5BA 3E1IA 3FWLA 3HUSC 3AE1C 1VQPP 1R8EA 3I5CA 1FZDA 2XU6A 1NVOA 2QG4A 2YXRB 1J2JB 3VP8A 2BCCE 4JZCA 1RQUA 3H1HE 1JY3O 1LT1A 4M7HA 1NTKG 3MHVA 2XKMA 4DT0A 2B87B 3M91A 2NPSC 3AEFC 3D70A 1NTMK 3T97A 1GW3A 3WMM0 1AJYA 3G4SP 2W8ZA 1JB0J 2J3FD 4PV1D 1H88A 2MKVA 5AW9B 3SSUA 2ZFCA 1IC2A 1URQA 3AE4C 1YJWP 1DEEG 2Q3EA 4EDFA 1LT9B 2UWJE 2RMZA 3L71G 1Z3SA 4EYYQ 1VQNP 5AVQB 1JUNA 3R2PA 3KZIH 1FZBC 3HE4B 1KZUB 1KQFB 1E79H 3V6IA 1RF1A 5GTHE 2C0WA 4L75A 3L75E 1FICA 3HE5A 1DD4A 3GMAA 3HUSB 2A45H 1JO5A 4DOJA 1JY3N 5KJ7A 1FZCB 2WMMA 3MUDC 1ZRTE 3VMXA 4I1LA 3WU2E 1KILB 2A06G 3G3ZA 1FZEB 3CX5D 2M8RA 5BU5A 2BCCD 3RL0g 1SQQD 3KYQA 1LTIC 1SQPK 3RL0B 2AEJA 1S5LH 4UB8E 3VP9A 1CI6B 2Q9IB 3IR9A 1S2EA 4PV1C 1RF0A 2J3FA 2LR2A 3CMAP 1VQMP 1NYHA 2KSEA 1KILD 1RE3C 3JC22 2H43C 2M3EA 2OYHA 1SQXJ 1MKMA 2ZAEB 3LIDA 1L0NE 2KIKA 3BCCE 2V7QJ 3I56P 3U1CA 2A45G 3TGUJ 2HODA 3FX0A 3GW6A 1Y47A 1KTMA 3S4RA 2E74C 3H1ID 2LKMA 3L70J 2WSEH 5K5GB 4R9JA 1JC9A 1L0NJ 2A06D 2PAJA 4XE5B 3VMZA 4C7NA 1FZAA 2Y9ZA 2ZXEB 1M1KQ 2ZXXA 2WSSH 3P7KA 3WU2H 1N8RQ 1SQQG 1JY2O 1FS0E 2P7JA 4ZKUA 2R5BA 1LTJA 1K05A 1YTZT 1Q2NA 2OYOA 1RQVA 1GTWA 4KJMA 5KLVE 2HODC 4W80A 2BCCJ 4DZOA 2CPBA 4D6TD 1QEXA 1KB9E 2LXCB 1NU1G 2AEMA 1SLQA 1HH0A 2JDIH 1VQLP 1GD2E 5H2FE 5KAFH 1SQBE 4RESB 1KYOE 3BVHA 5M1BA 4D6TJ 2KOGA 2J1GA 3CXHE 1T2KC 5KLIC 3AE3C 2WVRA 2IDBA 1MUUA 2WSCH 2B9BA 2ZT9D 1VQKP 3HD7A 1Q81Q 3H32A 1SQVG 3H1IJ 3HTKB 4UB8H 5CCGC 1FZEC 1L4AD 2W6AA 4PD4D 1EDJA 1KILA 2XNXC 3WUVA 3C8VA 3NXSA 2D39A 2FYNC 1Y9BA 1HGZA 2N1TC 1W2EA 1FZCC 3CWBG 3RK3D 2J5ZA 2H7HA 1Q90D 1L2PA 3UIAA 2H43B 4NYTA 5AVZB 3L74J 1DD3A 3GF3A 4M7FA 1GW4A 3MP7B 1JM0A 5APWA 1HBWA 4IL6E 2Q9IC 1Z3UA 3HD7C 1GK6A 3D71A 3CCUP 4OH8B 1GU5A 1FOSE 1FZBB 4H44D 1VQOP 2K3RA 3NFQA 3RK3B 5KJ7D 3RGUA 4HYTB 1E5WA 1QLED 4OGQD 4H0LC 5KKZC 2HODB 3M0DC 5CCGA 2QJPB 3IN6A 2O3JA 3EWKA 1LGHB 2WPRA 1BGYD 1M90Q 1EZVD 4WBAA 2WSEJ 2Y0CA 5CBOA 1G1IA 3V2QA 3VYIA 1MFZA 1KV4A 2KZIA 3Q2YA 4OGQC 1VL2A 4YXDC 1KC8Q 3F89A 3L4FA 5CBNA 1Z56A 2HPCA 3H1LJ 2CPSA 1SP4A 3JSVC 4LC1A 3TYYA 1LNQA 4QMAA 1VQ8P 1JY2N 3V2PA 3A7OA 3LW5J 2KP8A 4NPFX 1G2CB 2ZVNB 5KKZB 3G6EP 2Z5HA 1SQQE 3GLMA 1LTSC 3CC4P 1N7LA 3JCUH 4YXWH 3L71E 1HF9A 1W5CE 5C39A 1FZFA 1FIDA 3E1RA 5GTIH 2R3CA 2Z4EC 2YMYA 1N73B 4IFMA 1WRGA 2FFDC 5APUA 2C9NY 3AE9C 1GZLA 1OVUA 1OXZA 1BE3E 1EC5A 2J61B 3CXHI 3KZIE 1NTZK 3L71J 2J5UA 4UB6E 3SFEC 5KLVK 1JMMA 2H89C 2IPPA 3RL0C 3PJSK 3CCLP 1M1JA 3L73G 2WWWA 3O6QA 3ZDMA 3CCJP 3L70E 4B86A 5GTIE 3TF5A 2C0XA 5CJ0A 3MZWB 3W68A 2Q9IA 3TGUE 3CX5I 3EFFK 1QL1A 1S9KD 4HKZH 3K5BA 2YKPA 2HLOB 1FZGB 2WQYC 4L74A 3C1LA 2N9YB 5L8RJ 1FBMA 5APVA 1M1JC 1N7SD 2Q6QA 1GU4A 3GHGA 5E79E 3S1KA 5APTA 3Q1MA 1L4AA 2POHA 1T8ZA 3H32C 1L4AC 3H1HD 1K04A 4PJ0E 1URQD 1BSNA 4UB6H 1KYOD 5APSA 3BCCG 1SQPG 4H44C 4WY4A 3L35A 2WTYA 5E79H 3H1KG 2W83C 3N7NA 1IFPA 1SQVE 3CCEP 4N6JA 1BE3D 4AUWA 1H0TA 3L74G 3A0BE 3FIBA 1N7SC 1OFCX 4I7ZC 2E76C 1X22A 2J60A 4DJGA 5B5EH 1EZVE 3H1IE 1ZXGA 3L70G 2GA1A 1NTZE 3W67A 4RKUJ 3GF7A 1IK9A 3L71D 1USEA 1XTCC 1DIPA 4W7ZA 3NMDA 2YMKA 1LTAC 1KFMA 2RN0A 1N86B 1SQXD 1J1DC 3SWYA 1X79B 1X9VA 2YIUC 2H88C 4K3AA 1AQ5A 1AVYA 1GL2C 4O9BA 2Y0EA 3L75G 3VTPC 3BVHB 4R9TA 3SFDC 2OTLP 5TISE 1WMKA 4KHXA 1NU1D 1S9KE 2IFMA 1SFCA 2E76D 4CPGA 3MD0A 1N73A 2P10A 2P58A 1JTHA 4C7RA 2E75D 2J59M 1RE3A 3O8ZA 3AE6C 2FYUD 1OZHA 5CCGD 1NH4A 2SPZA 1QGKB 2ZT9C 4L76A 3L72G 2WITA 1UIIA 3LW5H 2ZVOB 3L36A 2M5AB 3A5TA 2K1AA 1NKZB 2I1JA 2B89A 3L73J 4I2LC 2E76B 4I7ZB 3NTNA 3HE4A 1JMBA 2H43A 1KILC 2E75B 2DW3A 1S72P 3CCVP 3AEAC 1OW8A 1EZVG 2O01N 1H8AA 2KS1B 2ZYGA 1KQGB 1QVGO 2HR3A 1L0ND 2J58A 1EDKA 2L91A 2KXPB 1N86C 3WUTA 1L0LK 1KORA 3CL3D 1KB9H 3VMYA 3R4YA 2OYIA 2K37A 1L4AB 3U1AA 2FXMA 4EIJA 3H6PA 1RH5B 3GHGC 3OJAB 3OW2O 4JYCA 3E7KA 2KB7P 1USDA 4WY4B 1YYCA 1PFIA 1BGYE 1CI6A 1KQSO 5TJHA 4MN4C 4IL6X 1RF0B 2QJKC 1PGQA 5AW0B 4Y99B 1SQPE 1X8YA 2B88A 2PFXA 1KB9D 1LTGC 2JHKF 3B5NA 3AEBC 3RBXA 3EFGA 4RO0A 3SWKA 3H1KE 1FZFC 4Z1MH 1CW5A 3QH9A 4DCKA 1LJ2A 2IBZI 1JOCA 3AEGC 1IFNA 3AE2C 1N7SA 3II6A 1XTGB 5B66H 1VQ7P 3MIWA 4U3FG 4ZMDA 1EXIA 4N78E 1FZAB 2N1TB 1RF0C 1FDIA 2HYNA 2XNXB 5CCHA 2IFNA 3M0AA 4WY4C 2W27A 2QA4P 1NO4A 1RF1C 1M7LA 2JHMF 1PPJD 1LT9A 1SFCB 2OARA 4IFFA 1S5LE 1KN7A 1KD1Q 3H1JJ 3PHLA 2WT7A 3RBZA 2I1KA 2AXCA 2HG5D 4IL6H 1PP9J 1OW7A 1M8OB 1ZP0C 2V7QH 2GUSA 3OAKA 2FFDB 3N4XA 1HJ0A 1SFCD 2FY8A 2Q3IA 3H1LG 1S4XA 1N73C 2FKWB 4D6TG 1SQBJ 4BRYA 2GM4A 2Y9YA 5EFWB 4XA4A 1GK4A 2QJYB 2O1JA 3M9BA 1GDTA 1PGPA 2BASA 1BSHA 3CCRP 1NU1J 4C46A 3KDPB 2IBZE 1JY2P 2R32A 2J64A 1A02J 1AA0A 3RK2B 3L75J 5AW7B 4H13D 1SQXK 2XNDH 4WY4D 1YJNP 4PD4H 2MJZA 3HD7B 2OYIB 3WUUA 2OTKE 4PJ0H 4BWNA 2QRXA 3P8MC 3JCUE 1K9MQ 1IFIA 4GIFA 1L0LJ 1SFCC 2HFED 1MZ9A 4PD4E 2OTJP 1ZV8A 5TISH 3IFMA 1NHLA 4AQRD 4ZFGA 2K9YA 1G1JA 3VMAA 3Q3DA 3CC2P 1HJBA 4RJTA 2W90A 3L37A 1FZGC 3CWBD 1ZW0A 4H13B 2NZ2A 4N78D 1A02F 3BVHC 3MGNA 1PZQA 2JO1A 1VQ4P 3AECC 3CLQA 3MUDA 1URQB 2YO3A 5AW3B 3Q5PA 1PP9G 2I8DA 1P84I 4C7NB 1QX8A 1R5SA 3CMEP 2Z5IA 1R5LA 1JCDA 1PGJA 1L0LG 3OA7A 5B5EE 3H25A 3TNUB 1NGMB 2IZ1A 2K9JA 3BCCJ 4PV1B 3KHUA 1SQXE 2QM7A 1FOSF 1ZMEC 1LP1A 3V4WA 1NWQA 1OVVA 1N7SB 1NU1K 4HH2A 1VF5B 2XZRA 5KAIH 3BASA 3HRNA 3CXHH 2PRRA 2VRSA 3CCSP 2FYZA 5CCHC 5CJ4A 2N1TA 4JF7A 1KB9I 2H8PD 2KNCA 2PGDA 2XNXA 1FJPA 3AE8C 2L5GB 4ASWA 3M06A 3Q5RA 1J1EC 5AVSB 3QWOC 2E5TA 2FBWC 2J0YA 2WZ7A 3IF4A 1NTMG 4LGDE 3L72E 1KFNA 2BCCG 1PP9D 2GY7A 4H0LD 5DJUB 5CCHD 2WT7B 1LWUB 3B71A 2JP3A 5KLVD 4EOTA 3I55P 1SQQK 2FYUG 2BEQD 5CMZA 3KPEA 1U7MA 1FE6A 2J3UA 5BVZA 2E43A 3FGAD 4R4LA 1LT9C 4L73A 2CK3H 2J61A 2XV5A 1J1EB 2QJPC 1P84E 4H0LB 1RE4C 2D2CC 3AEEC 2YNYA 4H44B 2G3AA 5AVXB 3O6QB 4GKGA 2YXQB 2J3OA 2YKQA 1JNMA 3T97B 5KLVG 2HPCC 2KLUA 1YHQP 5AVUB 3A0BH 2R3SA 3TGUD 1IFDA 3CX5H 4GT1A 1FIBA 1PL5A 1OX3A 1GL2A 1FAVA 1NU1E 3B5NB 1OW6A 1T2KD 2JKVA 1NTKJ 3PLNA 1ZRTD 1KYOH 2HLOC 2GUVA 3MTUE 3P8CD 2C9LY 3H1LE 3Q5SA 2E74B 2O01H 1D7MA 1RF1B 3KXDA 2A45I 1Y8AA 2O1KA 4H13C 3H1HJ 3E1IC 2ZJSE 4N3YB 5AVYB 2KZJA 1M56D 2WSFH 4GOEA 1VF5D 3F5HA 3BRVB 3AE7C 3L74D 4AYCA 1MV8A 2JHIF 2FYUE 5KLIB 1FZCA 1NTKK 2QIWA 4GDOA 2KYVA 3BCCD 1QVFO 1YIJP 3L70D 3TNUA 4U3FE 2HPCB 3RK3E 2WPVB 4WB4A 3CWBE 1TU3F 4TT3H 4GOFA 3S9OA 3L72D 2KK7A 2Y0DA 1BCCG 1W2BO 5H2FH 1G2CA 1SQVK 1S1CX 2OQQA 1URQC 1ZOYC 3A0HH 1AQTA 2JJLA 1JCCA 2J3GA 3P32A 1NJIQ 2ZYDA 1VPCA 1IK7A 4LLHA 2N9BA 4YPCA 1ZR2A 4Y28J 4U3FD 2KLVA 1M57D 2OYHB 2JHHC 1NOHA 1PV3A 3CX5E 1L0LD 1N2DC 2WPQA 1PPJG 1LWUA 3A3YB 4NPEA 3CCMP 1EDLA 3A0HE 1NTZG 5AW8B 3D6YA 1RHZB 1M1JB 5B66E 4D6TE 1VQ6P 3KQGA 5APQA 2OYHC 2YKOA 3L75D 5AVVB 1PGOA 1AVOA 2R5DA 1S5LX 3AE5C 3V2NA 1P84H 1NAYA 1NTKD 1ZR4A 1IO4A 3M0DA 1HWTC 2QJYC 2HLOA 1LTTC 5AW2B 1YTZI 2BEZF 3CD6P 1ZN5A 2M0BA 1SS1A 2E75C 2IBZG 1FZAC 1VF5C 3B5ND 2ITAA 3IAOA 2N1TD 4KT0J 1BGYG 3C9IA 2D2CD 2Z4EA 1NKNA 2FIBA 1YI2P 2PP6A 1FDOA 1SQPD 5KJ7C 1OWAA 4JBZA 4WWIA 3D6ZA 1GL2D 2E5YA 1IJDB 3TDKA 1P84D 3GG2A 1L0NK 1YJ9P 3E1IB 2AXTE 1EQ7A 4IFDK 2P1JA 1NTZD 1RE4A 5BU8B 1BE3G 2K88A 4Y99C 2J0GA 1HUCA 1YQ3C 1EDIA 5APXA 1NTMD 3H1JE 2K9JB 3G9RA 2YO2A 1K8AQ 1H0TB 1S3JA 2J2PA 1SQVD 2YIUB 1KYOI 4K35A 4I6MC 2IX7C 2QM8A 3TGUG 4BXLA 4JPZB 1QL2A 5DJTB 1HGVA 2G8YA 1ZLLA 3U59A 1EXJA 1SQXG 4OWFA 2ZYAA 5GTHH 1VQ9P 1OIPA 3L74E 1N86A 3RK2C 2Q5UA 3SWFA 4JYBA 1VDFA 2V4HA 1KMIZ 3AEDC 1EZVI 4U3FJ 1OVRA 5KTBA 1Q7YQ 2JEEA 1IFMA 5AVTB 2IYPA 2A06E 3H1LD 2E42A 1FZGA 1VQ5P 1H89A 3HE5B 4M3LA 3HUSA 1NTMJ 2NPSB 4GODA 4ZKPA 1JTHB 1FZBA 1NTME 2NRGA 1RE3B 2KSJA 3EQ2A 2M3BA 4TLFA 4W7YA 1BDDA 2WPSA 3GHGB 3H1HG 1LWUC 1GMJA 3TK1A 1AFOA 3CPWO 2LXBA 2R44A 5KAIE 1KILE 1DEBA 3FXEA 5KAFE 2NPSD 5AW5B 3H1KD 5CHXA 2QE7H 1DX7A 2WNPF 1FDMA 1U7JA 1KQLA 1NAFA 1GL2B 3LIEA 2JR8A 5KLVJ 3B5NC 1JY3P 4ASVA 1FC2C 4WVZA 2FYUK 2QSIA 1J1DB 3B4SA 3CI9A 4ZNCA 2AXTH 1CZQA 2IBZD 2JWDA 2QVAA 2OYIC 3L73E 2ZT9B 1FZFB 3CWBJ 1PP9E 2QEXP 2AEFA 3PRJA 3BRTB 2IZ0A 1PIXA 2B87A 2WSFJ 3PP5A 4JQ0D 2JWAA 1YBKA 2D2CB 1RE4B 4OVNF 3L73D 2FYUJ 3H1JD 2QJKB 2W6JH 4PD4I 3M9QA 3L72J 5AVRB 2W6BA 2JHLF 3PTZA 1LTJB 4JYOX 2J0HA 4NPDA 1WT6A 3VOPA 1HTLC 3VN0A 1JEKA 3A2AA 3B8EB 1UIXA 2WSCJ 1LTBC 4A7PA 1CSBA 4OGQB 3USSA 1SQBG 1X0TA 3P8CE 1BCCE 2M5AA 1OMIA 1LTJC 2Q7CA 3FXDA 4YTPC 5AVWB 2OGUA 1NTZJ 2RKLA 1BDCA 5APYA 4HJGH 1T3JA 3CCQP 3ABVC 3RL0D 1NTKE 2Q1KA 1FZEA 5AW1B 2O01J 2P67A 2FXOA 2KS1A 1BCCD 3FWNA 3H1JG 1IFJA 1LP1B 1SVFA 2NPSA 1SQQJ 3CC7P 1SQVJ 3H1IG 3RK3C 1FU1A 3M9HA 2E74D 3ITKA 1PPJE 1YQ4C 1HVVA 2FXPA 2XDJA 1L0NG 3H32B 2KI7B 3HTKA 1K73Q 3TSIA 1SQBK 2KNCB 3G71P 5AW4B
chains in the Genus database with same CATH topology
1JOCA 3V2RA 1IFNA 1LGHB 2WPRA 2KLVA 3RK2D 1N7SA 3II6A 2OYHB 2FFDA 2JHHC 1NOHA 1XTGB 2P2UA 3MIWA 4WBAA 1FJKA 3HD7D 1G1IA 4N78E 3BATA 1T3UA 3V2QA 3VYIA 1N2DC 2WPQA 1FZAB 1MFZA 1RY3A 2Z4EB 2N1TB 1RF0C 2HYNA 2XNXB 1LWUA 5CCHA 2IFNA 3M0AA 3A3YB 5AW8B 4WY4C 2W27A 3L4FA 3V4QA 1M1JB 1NO4A 1RF1C 1M7LA 2JHMF 5AW6B 1DH3A 1Z56A 2HPCA 1LT9A 2CPSA 1SP4A 3KQGA 1SFCB 4EPUA 3V5BA 5APQA 2OYHC 3E1IA 2YKOA 4LC1A 3TYYA 2OARA 4IFFA 5AVVB 3HUSC 1JY2N 3V2PA 2R5DA 3A7OA 3I5CA 1FZDA 2KP8A 2XU6A 1G2CB 3V2NA 2Z5HA 2WT7A 1J2JB 1ZR4A 1IO4A 3M0DA 1LTSC 1N7LA 3VP8A 1HWTC 2HLOA 4JZCA 2I1KA 2HG5D 1LTTC 1JY3O 1FZFA 5AW2B 1YTZI 1FIDA 4M7HA 1ZN5A 2R3CA 2Z4EC 2XKMA 2YMYA 1FZAC 1N73B 3M91A 4IFMA 3B5ND 2GUSA 3OAKA 2FFDB 3N4XA 2NPSC 1WRGA 1SFCD 2FFDC 5APUA 2N1TD 2Q3IA 1NTMK 3T97A 1GW3A 3WMM0 1N73C 2FKWB 2C9NY 3C9IA 1GZLA 1OXZA 2J61B 2GM4A 2J3FD 2Z4EA 1NTZK 4XA4A 1GK4A 1H88A 1NKNA 5AW9B 2O1JA 3M9BA 2FIBA 2PP6A 1IC2A 2ZFCA 5KLVK 1JMMA 1GDTA 5KJ7C 1OWAA 1URQA 2IPPA 2BASA 3RL0C 1M1JA 1GL2D 2WWWA 1IJDB 1LT9B 4C46A 1L0NK 1Z3SA 3KDPB 1JY2P 2R32A 4B86A 3E1IB 5AVQB 1JUNA 3R2PA 2J64A 1A02J 1FZBC 1EQ7A 3HE4B 2C0XA 2P1JA 3RK2B 4IFDK 1KZUB 5CJ0A 1RE4A 5AW7B 5BU8B 1SQXK 4WY4D 2Q9IA 1QL1A 2MJZA 1S9KD 4Y99C 3HD7B 2OYIB 2J0GA 1RF1A 1HUCA 5APXA 2YKPA 2HLOB 2C0WA 2YO2A 1FZGB 1FICA 3HE5A 3P8MC 3HUSB 2J2PA 1IFIA 4GIFA 1SFCC 2A45H 1MZ9A 2HFED 1ZV8A 1JO5A 3IFMA 1FBMA 1JY3N 1NHLA 4I6MC 5APVA 1M1JC 4AQRD 4DOJA 4ZFGA 2IX7C 1N7SD 1G1JA 1GU4A 2QM8A 3GHGA 5KJ7A 1HJBA 1FZCB 1QL2A 1HGVA 3L37A 1FZGC 5APTA 1ZLLA 4N78D 1A02F 3U59A 3BVHC 1L4AA 3VMXA 4I1LA 2POHA 1KILB 3MGNA 3G3ZA 1T8ZA 3H32C 1FZEB 1L4AC 3CLQA 3MUDA 1URQB 2M8RA 2YO3A 1URQD 5AW3B 5APSA 5BU5A 1N86A 3RK2C 2Q5UA 3SWFA 4JYBA 1VDFA 3KYQA 4C7NB 1LTIC 1SQPK 3RL0B 4WY4A 3L35A 3VP9A 1CI6B 2Q9IB 3IR9A 5KTBA 2WTYA 2Z5IA 1JCDA 1RF0A 2JEEA 3OA7A 2J3FA 1IFMA 3N7NA 3TNUB 5AVTB 4N6JA 2E42A 4AUWA 1KILD 1RE3C 2QM7A 1H89A 1FZGA 1FOSF 2H43C 3HE5B 4M3LA 3HUSA 1NWQA 3V4WA 1N7SB 2NPSB 3FIBA 4ZKPA 2OYHA 1NU1K 1JTHB 1N7SC 4HH2A 1FZBA 2J60A 2XZRA 1RE3B 3LIDA 2KSJA 3BASA 2M3BA 3EQ2A 3HRNA 4W7YA 2VRSA 2WPSA 3GHGB 2FYZA 1LWUC 5CCHC 3U1CA 3TK1A 5CJ4A 2N1TA 2A45G 4JF7A 2HODA 1IK9A 2H8PD 1AFOA 2XNXA 1FJPA 1XTCC 2L5GB 4W7ZA 3M06A 1J1EC 3NMDA 2LKMA 5AVSB 1LTAC 2WSEH 1KFMA 2J0YA 4R9JA 1N86B 1JC9A 1DEBA 1J1DC 2PAJA 2NPSD 2WZ7A 4XE5B 5AW5B 3SWYA 3VMZA 1X79B 5CHXA 4LGDE 4C7NA 1KFNA 1X9VA 1FZAA 2ZXEB 1DX7A 1AQ5A 2GY7A 2WNPF 1GL2C 4O9BA 5CCHD 2WT7B 1LWUB 3P7KA 1FDMA 3VTPC 3BVHB 4R9TA 1KQLA 1JY2O 1NAFA 2P7JA 4EOTA 4KHXA 1GL2B 1S9KE 1SQQK 3LIEA 2IFMA 1SFCA 4ZKUA 3B5NC 5CMZA 2R5BA 1JY3P 3KPEA 1LTJA 3MD0A 1N73A 2FYUK 1JTHA 1YTZT 1J1DB 2J3UA 5BVZA 3CI9A 4C7RA 2J59M 1GTWA 2E43A 1RE3A 3O8ZA 1CZQA 5CCGD 1LT9C 1NH4A 2J61A 2XV5A 1J1EB 2OYIC 2HODC 2WITA 4W80A 1RE4C 1FZFB 4DZOA 3LW5H 2CPBA 3L36A 2YNYA 3BRTB 5AVXB 3A5TA 4GKGA 1NKZB 3PP5A 2J3OA 2YKQA 2I1JA 1JNMA 4I2LC 1SLQA 3NTNA 1HH0A 3HE4A 2H43A 1RE4B 1GD2E 1KILC 2HPCC 5AVUB 4RESB 3BVHA 1IFDA 1H8AA 4GT1A 1FIBA 3M9QA 2KOGA 2J1GA 1T2KC 1GL2A 5AVRB 2W6BA 1FAVA 2JHLF 2J58A 3B5NB 1LTJB 1T2KD 1N86C 4JYOX 2J0HA 1L0LK 3CL3D 2HLOC 2GUVA 3MTUE 1MUUA 2WSCH 3P8CD 3VMYA 2C9LY 1WT6A 3HD7A 2OYIA 3H32A 3HTKB 3VOPA 1HTLC 2O01H 3VN0A 3A2AA 3B8EB 1RF1B 5CCGC 1L4AB 1FZEC 1L4AD 2FXMA 3U1AA 1LTBC 2W6AA 1KILA 1CSBA 2A45I 2XNXC 2O1KA 4EIJA 3H6PA 3NXSA 2D39A 3P8CE 1HGZA 3GHGC 3E1IC 2N1TC 1W2EA 3OJAB 1FZCC 4N3YB 1LTJC 5AVYB 2Q7CA 4JYCA 2WSFH 3RK3D 5AVWB 3BRVB 2J5ZA 4AYCA 1MV8A 2KB7P 2H7HA 2JHIF 1FZCA 3UIAA 2H43B 4WY4B 4NYTA 5AVZB 5APYA 1NTKK 1YYCA 1T3JA 1CI6A 1PFIA 4M7FA 2KYVA 1GW4A 3RL0D 5APWA 1RF0B 1HBWA 1FZEA 5AW1B 3TNUA 2P67A 5AW0B 2HPCB 2Q9IC 1Z3UA 3HD7C 4Y99B 1X8YA 4WB4A 1IFJA 1GK6A 1LTGC 1SVFA 2JHKF 2NPSA 3RK3C 3B5NA 4OH8B 1FU1A 1GU5A 1FOSE 1FZBB 3M9HA 3EFGA 3NFQA 3RK3B 5KJ7D 1G2CA 4HYTB 1SQVK 1E5WA 1URQC 1FZFC 1HVVA 2JJLA 1JCCA 2XDJA 1CW5A 2J3GA 3HTKA 3H32B 3P32A 2HODB 1VPCA 3TSIA 3M0DC 4LLHA 2N9BA 1SQBK 1ZR2A 5CCGA 5AW4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3S A;  1JY2 P;  3E1I B;  3GHG B;  3BVH A;  2J64 A;  1FZB C;  1LWU C;  1RE4 A;  2OYH B;  1FIB A;  2FFD A;  2JHH C;  2A45 G;  2HOD A;  2J1G A;  2XNX A;  2Q9I A;  2JHL F;  2OYI B;  2J0G A;  1T3U A;  1LTJ B;  1FZA B;  1RF1 A;  1N86 C;  2Z4E B;  2HLO B;  1RF0 C;  4JYO X;  2J0H A;  2HLO C;  1FZG B;  2J0Y A;  2XNX B;  1LWU A;  4R9J A;  1N86 B;  1FIC A;  1JC9 A;  3HUS B;  2HPC C;  2J2P A;  2OYI A;  3H32 A;  1M1J B;  2A45 H;  1RF1 C;  2JHM F;  1FZA A;  1RF1 B;  2HPC A;  1LT9 A;  1FZE C;  1JY3 N;  2GY7 A;  1M1J C;  2WNP F;  4EPU A;  4ZFG A;  2OYH C;  2A45 I;  1LWU B;  3E1I A;  3GHG A;  2XNX C;  3BVH B;  2D39 A;  3HUS C;  4R9T A;  1FZC B;  3GHG C;  1JY2 N;  3E1I C;  1FZG C;  1W2E A;  1JY2 O;  1FZC C;  1LTJ C;  1FZD A;  3BVH C;  3H32 C;  2J5Z A;  1FZE B;  1JY3 P;  2JHI F;  1LTJ A;  1N73 A;  1FZC A;  2H43 B;  2HLO A;  4JZC A;  4NYT A;  2J3U A;  1JY3 O;  4M7F A;  1FZF A;  4M7H A;  1FID A;  1N86 A;  1RE3 A;  1RF0 B;  2Z4E C;  1FZE A;  1LT9 C;  1FZA C;  2J61 A;  1N73 B;  2HPC B;  2Q9I C;  2OYI C;  1Z3U A;  2FFD B;  2HOD C;  2FFD C;  1RE4 C;  1FZF B;  2Q9I B;  1N73 C;  2JHK F;  1RF0 A;  2J3F A;  1FZB B;  2J61 B;  2J3F D;  2Z4E A;  2J3O A;  1RE3 C;  1FZG A;  2H43 C;  1FZF C;  2FIB A;  3HUS A;  3FIB A;  2H43 A;  2J3G A;  2OYH A;  1RE4 B;  3H32 B;  1M1J A;  2HOD B;  1FZB A;  1LT9 B;  2J60 A;  1RE3 B; 
#chains in the Genus database with same CATH topology
 1BE3 J;  1BCC J;  3CXH D;  1L0L E;  3V2R A;  1T6A A;  1MFT A;  4HB1 A;  3H1K J;  3RK2 D;  2FFD A;  1YIT P;  2P2U A;  3PH0 A;  1AV1 A;  1SQB D;  1FJK A;  3HD7 D;  4R4M A;  4BRY B;  1U57 A;  3BAT A;  1T3U A;  1Q86 Q;  2RH0 A;  1RY3 A;  2Z4E B;  1SQP J;  4IOI H;  2FYN B;  4EI2 A;  2KUB A;  4XFJ A;  1Q82 Q;  3V4Q A;  5AW6 B;  1IZN B;  1DH3 A;  1BGY J;  4U7J A;  2IYO A;  4EPU A;  3V5B A;  3E1I A;  3FWL A;  3HUS C;  3AE1 C;  1VQP P;  1R8E A;  3I5C A;  1FZD A;  2XU6 A;  1NVO A;  2QG4 A;  2YXR B;  1J2J B;  3VP8 A;  2BCC E;  4JZC A;  1RQU A;  3H1H E;  1JY3 O;  1LT1 A;  4M7H A;  1NTK G;  3MHV A;  2XKM A;  4DT0 A;  2B87 B;  3M91 A;  2NPS C;  3AEF C;  3D70 A;  1NTM K;  3T97 A;  1GW3 A;  3WMM 0;  1AJY A;  3G4S P;  2W8Z A;  1JB0 J;  2J3F D;  4PV1 D;  1H88 A;  2MKV A;  5AW9 B;  3SSU A;  2ZFC A;  1IC2 A;  1URQ A;  3AE4 C;  1YJW P;  1DEE G;  2Q3E A;  4EDF A;  1LT9 B;  2UWJ E;  2RMZ A;  3L71 G;  1Z3S A;  4EYY Q;  1VQN P;  5AVQ B;  1JUN A;  3R2P A;  3KZI H;  1FZB C;  3HE4 B;  1KZU B;  1KQF B;  1E79 H;  3V6I A;  1RF1 A;  5GTH E;  2C0W A;  4L75 A;  3L75 E;  1FIC A;  3HE5 A;  1DD4 A;  3GMA A;  3HUS B;  2A45 H;  1JO5 A;  4DOJ A;  1JY3 N;  5KJ7 A;  1FZC B;  2WMM A;  3MUD C;  1ZRT E;  3VMX A;  4I1L A;  3WU2 E;  1KIL B;  2A06 G;  3G3Z A;  1FZE B;  3CX5 D;  2M8R A;  5BU5 A;  2BCC D;  3RL0 g;  1SQQ D;  3KYQ A;  1LTI C;  1SQP K;  3RL0 B;  2AEJ A;  1S5L H;  4UB8 E;  3VP9 A;  1CI6 B;  2Q9I B;  3IR9 A;  1S2E A;  4PV1 C;  1RF0 A;  2J3F A;  2LR2 A;  3CMA P;  1VQM P;  1NYH A;  2KSE A;  1KIL D;  1RE3 C;  3JC2 2;  2H43 C;  2M3E A;  2OYH A;  1SQX J;  1MKM A;  2ZAE B;  3LID A;  1L0N E;  2KIK A;  3BCC E;  2V7Q J;  3I56 P;  3U1C A;  2A45 G;  3TGU J;  2HOD A;  3FX0 A;  3GW6 A;  1Y47 A;  1KTM A;  3S4R A;  2E74 C;  3H1I D;  2LKM A;  3L70 J;  2WSE H;  5K5G B;  4R9J A;  1JC9 A;  1L0N J;  2A06 D;  2PAJ A;  4XE5 B;  3VMZ A;  4C7N A;  1FZA A;  2Y9Z A;  2ZXE B;  1M1K Q;  2ZXX A;  2WSS H;  3P7K A;  3WU2 H;  1N8R Q;  1SQQ G;  1JY2 O;  1FS0 E;  2P7J A;  4ZKU A;  2R5B A;  1LTJ A;  1K05 A;  1YTZ T;  1Q2N A;  2OYO A;  1RQV A;  1GTW A;  4KJM A;  5KLV E;  2HOD C;  4W80 A;  2BCC J;  4DZO A;  2CPB A;  4D6T D;  1QEX A;  1KB9 E;  2LXC B;  1NU1 G;  2AEM A;  1SLQ A;  1HH0 A;  2JDI H;  1VQL P;  1GD2 E;  5H2F E;  5KAF H;  1SQB E;  4RES B;  1KYO E;  3BVH A;  5M1B A;  4D6T J;  2KOG A;  2J1G A;  3CXH E;  1T2K C;  5KLI C;  3AE3 C;  2WVR A;  2IDB A;  1MUU A;  2WSC H;  2B9B A;  2ZT9 D;  1VQK P;  3HD7 A;  1Q81 Q;  3H32 A;  1SQV G;  3H1I J;  3HTK B;  4UB8 H;  5CCG C;  1FZE C;  1L4A D;  2W6A A;  4PD4 D;  1EDJ A;  1KIL A;  2XNX C;  3WUV A;  3C8V A;  3NXS A;  2D39 A;  2FYN C;  1Y9B A;  1HGZ A;  2N1T C;  1W2E A;  1FZC C;  3CWB G;  3RK3 D;  2J5Z A;  2H7H A;  1Q90 D;  1L2P A;  3UIA A;  2H43 B;  4NYT A;  5AVZ B;  3L74 J;  1DD3 A;  3GF3 A;  4M7F A;  1GW4 A;  3MP7 B;  1JM0 A;  5APW A;  1HBW A;  4IL6 E;  2Q9I C;  1Z3U A;  3HD7 C;  1GK6 A;  3D71 A;  3CCU P;  4OH8 B;  1GU5 A;  1FOS E;  1FZB B;  4H44 D;  1VQO P;  2K3R A;  3NFQ A;  3RK3 B;  5KJ7 D;  3RGU A;  4HYT B;  1E5W A;  1QLE D;  4OGQ D;  4H0L C;  5KKZ C;  2HOD B;  3M0D C;  5CCG A;  2QJP B;  3IN6 A;  2O3J A;  3EWK A;  1LGH B;  2WPR A;  1BGY D;  1M90 Q;  1EZV D;  4WBA A;  2WSE J;  2Y0C A;  5CBO A;  1G1I A;  3V2Q A;  3VYI A;  1MFZ A;  1KV4 A;  2KZI A;  3Q2Y A;  4OGQ C;  1VL2 A;  4YXD C;  1KC8 Q;  3F89 A;  3L4F A;  5CBN A;  1Z56 A;  2HPC A;  3H1L J;  2CPS A;  1SP4 A;  3JSV C;  4LC1 A;  3TYY A;  1LNQ A;  4QMA A;  1VQ8 P;  1JY2 N;  3V2P A;  3A7O A;  3LW5 J;  2KP8 A;  4NPF X;  1G2C B;  2ZVN B;  5KKZ B;  3G6E P;  2Z5H A;  1SQQ E;  3GLM A;  1LTS C;  3CC4 P;  1N7L A;  3JCU H;  4YXW H;  3L71 E;  1HF9 A;  1W5C E;  5C39 A;  1FZF A;  1FID A;  3E1R A;  5GTI H;  2R3C A;  2Z4E C;  2YMY A;  1N73 B;  4IFM A;  1WRG A;  2FFD C;  5APU A;  2C9N Y;  3AE9 C;  1GZL A;  1OVU A;  1OXZ A;  1BE3 E;  1EC5 A;  2J61 B;  3CXH I;  3KZI E;  1NTZ K;  3L71 J;  2J5U A;  4UB6 E;  3SFE C;  5KLV K;  1JMM A;  2H89 C;  2IPP A;  3RL0 C;  3PJS K;  3CCL P;  1M1J A;  3L73 G;  2WWW A;  3O6Q A;  3ZDM A;  3CCJ P;  3L70 E;  4B86 A;  5GTI E;  3TF5 A;  2C0X A;  5CJ0 A;  3MZW B;  3W68 A;  2Q9I A;  3TGU E;  3CX5 I;  3EFF K;  1QL1 A;  1S9K D;  4HKZ H;  3K5B A;  2YKP A;  2HLO B;  1FZG B;  2WQY C;  4L74 A;  3C1L A;  2N9Y B;  5L8R J;  1FBM A;  5APV A;  1M1J C;  1N7S D;  2Q6Q A;  1GU4 A;  3GHG A;  5E79 E;  3S1K A;  5APT A;  3Q1M A;  1L4A A;  2POH A;  1T8Z A;  3H32 C;  1L4A C;  3H1H D;  1K04 A;  4PJ0 E;  1URQ D;  1BSN A;  4UB6 H;  1KYO D;  5APS A;  3BCC G;  1SQP G;  4H44 C;  4WY4 A;  3L35 A;  2WTY A;  5E79 H;  3H1K G;  2W83 C;  3N7N A;  1IFP A;  1SQV E;  3CCE P;  4N6J A;  1BE3 D;  4AUW A;  1H0T A;  3L74 G;  3A0B E;  3FIB A;  1N7S C;  1OFC X;  4I7Z C;  2E76 C;  1X22 A;  2J60 A;  4DJG A;  5B5E H;  1EZV E;  3H1I E;  1ZXG A;  3L70 G;  2GA1 A;  1NTZ E;  3W67 A;  4RKU J;  3GF7 A;  1IK9 A;  3L71 D;  1USE A;  1XTC C;  1DIP A;  4W7Z A;  3NMD A;  2YMK A;  1LTA C;  1KFM A;  2RN0 A;  1N86 B;  1SQX D;  1J1D C;  3SWY A;  1X79 B;  1X9V A;  2YIU C;  2H88 C;  4K3A A;  1AQ5 A;  1AVY A;  1GL2 C;  4O9B A;  2Y0E A;  3L75 G;  3VTP C;  3BVH B;  4R9T A;  3SFD C;  2OTL P;  5TIS E;  1WMK A;  4KHX A;  1NU1 D;  1S9K E;  2IFM A;  1SFC A;  2E76 D;  4CPG A;  3MD0 A;  1N73 A;  2P10 A;  2P58 A;  1JTH A;  4C7R A;  2E75 D;  2J59 M;  1RE3 A;  3O8Z A;  3AE6 C;  2FYU D;  1OZH A;  5CCG D;  1NH4 A;  2SPZ A;  1QGK B;  2ZT9 C;  4L76 A;  3L72 G;  2WIT A;  1UII A;  3LW5 H;  2ZVO B;  3L36 A;  2M5A B;  3A5T A;  2K1A A;  1NKZ B;  2I1J A;  2B89 A;  3L73 J;  4I2L C;  2E76 B;  4I7Z B;  3NTN A;  3HE4 A;  1JMB A;  2H43 A;  1KIL C;  2E75 B;  2DW3 A;  1S72 P;  3CCV P;  3AEA C;  1OW8 A;  1EZV G;  2O01 N;  1H8A A;  2KS1 B;  2ZYG A;  1KQG B;  1QVG O;  2HR3 A;  1L0N D;  2J58 A;  1EDK A;  2L91 A;  2KXP B;  1N86 C;  3WUT A;  1L0L K;  1KOR A;  3CL3 D;  1KB9 H;  3VMY A;  3R4Y A;  2OYI A;  2K37 A;  1L4A B;  3U1A A;  2FXM A;  4EIJ A;  3H6P A;  1RH5 B;  3GHG C;  3OJA B;  3OW2 O;  4JYC A;  3E7K A;  2KB7 P;  1USD A;  4WY4 B;  1YYC A;  1PFI A;  1BGY E;  1CI6 A;  1KQS O;  5TJH A;  4MN4 C;  4IL6 X;  1RF0 B;  2QJK C;  1PGQ A;  5AW0 B;  4Y99 B;  1SQP E;  1X8Y A;  2B88 A;  2PFX A;  1KB9 D;  1LTG C;  2JHK F;  3B5N A;  3AEB C;  3RBX A;  3EFG A;  4RO0 A;  3SWK A;  3H1K E;  1FZF C;  4Z1M H;  1CW5 A;  3QH9 A;  4DCK A;  1LJ2 A;  2IBZ I;  1JOC A;  3AEG C;  1IFN A;  3AE2 C;  1N7S A;  3II6 A;  1XTG B;  5B66 H;  1VQ7 P;  3MIW A;  4U3F G;  4ZMD A;  1EXI A;  4N78 E;  1FZA B;  2N1T B;  1RF0 C;  1FDI A;  2HYN A;  2XNX B;  5CCH A;  2IFN A;  3M0A A;  4WY4 C;  2W27 A;  2QA4 P;  1NO4 A;  1RF1 C;  1M7L A;  2JHM F;  1PPJ D;  1LT9 A;  1SFC B;  2OAR A;  4IFF A;  1S5L E;  1KN7 A;  1KD1 Q;  3H1J J;  3PHL A;  2WT7 A;  3RBZ A;  2I1K A;  2AXC A;  2HG5 D;  4IL6 H;  1PP9 J;  1OW7 A;  1M8O B;  1ZP0 C;  2V7Q H;  2GUS A;  3OAK A;  2FFD B;  3N4X A;  1HJ0 A;  1SFC D;  2FY8 A;  2Q3I A;  3H1L G;  1S4X A;  1N73 C;  2FKW B;  4D6T G;  1SQB J;  4BRY A;  2GM4 A;  2Y9Y A;  5EFW B;  4XA4 A;  1GK4 A;  2QJY B;  2O1J A;  3M9B A;  1GDT A;  1PGP A;  2BAS A;  1BSH A;  3CCR P;  1NU1 J;  4C46 A;  3KDP B;  2IBZ E;  1JY2 P;  2R32 A;  2J64 A;  1A02 J;  1AA0 A;  3RK2 B;  3L75 J;  5AW7 B;  4H13 D;  1SQX K;  2XND H;  4WY4 D;  1YJN P;  4PD4 H;  2MJZ A;  3HD7 B;  2OYI B;  3WUU A;  2OTK E;  4PJ0 H;  4BWN A;  2QRX A;  3P8M C;  3JCU E;  1K9M Q;  1IFI A;  4GIF A;  1L0L J;  1SFC C;  2HFE D;  1MZ9 A;  4PD4 E;  2OTJ P;  1ZV8 A;  5TIS H;  3IFM A;  1NHL A;  4AQR D;  4ZFG A;  2K9Y A;  1G1J A;  3VMA A;  3Q3D A;  3CC2 P;  1HJB A;  4RJT A;  2W90 A;  3L37 A;  1FZG C;  3CWB D;  1ZW0 A;  4H13 B;  2NZ2 A;  4N78 D;  1A02 F;  3BVH C;  3MGN A;  1PZQ A;  2JO1 A;  1VQ4 P;  3AEC C;  3CLQ A;  3MUD A;  1URQ B;  2YO3 A;  5AW3 B;  3Q5P A;  1PP9 G;  2I8D A;  1P84 I;  4C7N B;  1QX8 A;  1R5S A;  3CME P;  2Z5I A;  1R5L A;  1JCD A;  1PGJ A;  1L0L G;  3OA7 A;  5B5E E;  3H25 A;  3TNU B;  1NGM B;  2IZ1 A;  2K9J A;  3BCC J;  4PV1 B;  3KHU A;  1SQX E;  2QM7 A;  1FOS F;  1ZME C;  1LP1 A;  3V4W A;  1NWQ A;  1OVV A;  1N7S B;  1NU1 K;  4HH2 A;  1VF5 B;  2XZR A;  5KAI H;  3BAS A;  3HRN A;  3CXH H;  2PRR A;  2VRS A;  3CCS P;  2FYZ A;  5CCH C;  5CJ4 A;  2N1T A;  4JF7 A;  1KB9 I;  2H8P D;  2KNC A;  2PGD A;  2XNX A;  1FJP A;  3AE8 C;  2L5G B;  4ASW A;  3M06 A;  3Q5R A;  1J1E C;  5AVS B;  3QWO C;  2E5T A;  2FBW C;  2J0Y A;  2WZ7 A;  3IF4 A;  1NTM G;  4LGD E;  3L72 E;  1KFN A;  2BCC G;  1PP9 D;  2GY7 A;  4H0L D;  5DJU B;  5CCH D;  2WT7 B;  1LWU B;  3B71 A;  2JP3 A;  5KLV D;  4EOT A;  3I55 P;  1SQQ K;  2FYU G;  2BEQ D;  5CMZ A;  3KPE A;  1U7M A;  1FE6 A;  2J3U A;  5BVZ A;  2E43 A;  3FGA D;  4R4L A;  1LT9 C;  4L73 A;  2CK3 H;  2J61 A;  2XV5 A;  1J1E B;  2QJP C;  1P84 E;  4H0L B;  1RE4 C;  2D2C C;  3AEE C;  2YNY A;  4H44 B;  2G3A A;  5AVX B;  3O6Q B;  4GKG A;  2YXQ B;  2J3O A;  2YKQ A;  1JNM A;  3T97 B;  5KLV G;  2HPC C;  2KLU A;  1YHQ P;  5AVU B;  3A0B H;  2R3S A;  3TGU D;  1IFD A;  3CX5 H;  4GT1 A;  1FIB A;  1PL5 A;  1OX3 A;  1GL2 A;  1FAV A;  1NU1 E;  3B5N B;  1OW6 A;  1T2K D;  2JKV A;  1NTK J;  3PLN A;  1ZRT D;  1KYO H;  2HLO C;  2GUV A;  3MTU E;  3P8C D;  2C9L Y;  3H1L E;  3Q5S A;  2E74 B;  2O01 H;  1D7M A;  1RF1 B;  3KXD A;  2A45 I;  1Y8A A;  2O1K A;  4H13 C;  3H1H J;  3E1I C;  2ZJS E;  4N3Y B;  5AVY B;  2KZJ A;  1M56 D;  2WSF H;  4GOE A;  1VF5 D;  3F5H A;  3BRV B;  3AE7 C;  3L74 D;  4AYC A;  1MV8 A;  2JHI F;  2FYU E;  5KLI B;  1FZC A;  1NTK K;  2QIW A;  4GDO A;  2KYV A;  3BCC D;  1QVF O;  1YIJ P;  3L70 D;  3TNU A;  4U3F E;  2HPC B;  3RK3 E;  2WPV B;  4WB4 A;  3CWB E;  1TU3 F;  4TT3 H;  4GOF A;  3S9O A;  3L72 D;  2KK7 A;  2Y0D A;  1BCC G;  1W2B O;  5H2F H;  1G2C A;  1SQV K;  1S1C X;  2OQQ A;  1URQ C;  1ZOY C;  3A0H H;  1AQT A;  2JJL A;  1JCC A;  2J3G A;  3P32 A;  1NJI Q;  2ZYD A;  1VPC A;  1IK7 A;  4LLH A;  2N9B A;  4YPC A;  1ZR2 A;  4Y28 J;  4U3F D;  2KLV A;  1M57 D;  2OYH B;  2JHH C;  1NOH A;  1PV3 A;  3CX5 E;  1L0L D;  1N2D C;  2WPQ A;  1PPJ G;  1LWU A;  3A3Y B;  4NPE A;  3CCM P;  1EDL A;  3A0H E;  1NTZ G;  5AW8 B;  3D6Y A;  1RHZ B;  1M1J B;  5B66 E;  4D6T E;  1VQ6 P;  3KQG A;  5APQ A;  2OYH C;  2YKO A;  3L75 D;  5AVV B;  1PGO A;  1AVO A;  2R5D A;  1S5L X;  3AE5 C;  3V2N A;  1P84 H;  1NAY A;  1NTK D;  1ZR4 A;  1IO4 A;  3M0D A;  1HWT C;  2QJY C;  2HLO A;  1LTT C;  5AW2 B;  1YTZ I;  2BEZ F;  3CD6 P;  1ZN5 A;  2M0B A;  1SS1 A;  2E75 C;  2IBZ G;  1FZA C;  1VF5 C;  3B5N D;  2ITA A;  3IAO A;  2N1T D;  4KT0 J;  1BGY G;  3C9I A;  2D2C D;  2Z4E A;  1NKN A;  2FIB A;  1YI2 P;  2PP6 A;  1FDO A;  1SQP D;  5KJ7 C;  1OWA A;  4JBZ A;  4WWI A;  3D6Z A;  1GL2 D;  2E5Y A;  1IJD B;  3TDK A;  1P84 D;  3GG2 A;  1L0N K;  1YJ9 P;  3E1I B;  2AXT E;  1EQ7 A;  4IFD K;  2P1J A;  1NTZ D;  1RE4 A;  5BU8 B;  1BE3 G;  2K88 A;  4Y99 C;  2J0G A;  1HUC A;  1YQ3 C;  1EDI A;  5APX A;  1NTM D;  3H1J E;  2K9J B;  3G9R A;  2YO2 A;  1K8A Q;  1H0T B;  1S3J A;  2J2P A;  1SQV D;  2YIU B;  1KYO I;  4K35 A;  4I6M C;  2IX7 C;  2QM8 A;  3TGU G;  4BXL A;  4JPZ B;  1QL2 A;  5DJT B;  1HGV A;  2G8Y A;  1ZLL A;  3U59 A;  1EXJ A;  1SQX G;  4OWF A;  2ZYA A;  5GTH H;  1VQ9 P;  1OIP A;  3L74 E;  1N86 A;  3RK2 C;  2Q5U A;  3SWF A;  4JYB A;  1VDF A;  2V4H A;  1KMI Z;  3AED C;  1EZV I;  4U3F J;  1OVR A;  5KTB A;  1Q7Y Q;  2JEE A;  1IFM A;  5AVT B;  2IYP A;  2A06 E;  3H1L D;  2E42 A;  1FZG A;  1VQ5 P;  1H89 A;  3HE5 B;  4M3L A;  3HUS A;  1NTM J;  2NPS B;  4GOD A;  4ZKP A;  1JTH B;  1FZB A;  1NTM E;  2NRG A;  1RE3 B;  2KSJ A;  3EQ2 A;  2M3B A;  4TLF A;  4W7Y A;  1BDD A;  2WPS A;  3GHG B;  3H1H G;  1LWU C;  1GMJ A;  3TK1 A;  1AFO A;  3CPW O;  2LXB A;  2R44 A;  5KAI E;  1KIL E;  1DEB A;  3FXE A;  5KAF E;  2NPS D;  5AW5 B;  3H1K D;  5CHX A;  2QE7 H;  1DX7 A;  2WNP F;  1FDM A;  1U7J A;  1KQL A;  1NAF A;  1GL2 B;  3LIE A;  2JR8 A;  5KLV J;  3B5N C;  1JY3 P;  4ASV A;  1FC2 C;  4WVZ A;  2FYU K;  2QSI A;  1J1D B;  3B4S A;  3CI9 A;  4ZNC A;  2AXT H;  1CZQ A;  2IBZ D;  2JWD A;  2QVA A;  2OYI C;  3L73 E;  2ZT9 B;  1FZF B;  3CWB J;  1PP9 E;  2QEX P;  2AEF A;  3PRJ A;  3BRT B;  2IZ0 A;  1PIX A;  2B87 A;  2WSF J;  3PP5 A;  4JQ0 D;  2JWA A;  1YBK A;  2D2C B;  1RE4 B;  4OVN F;  3L73 D;  2FYU J;  3H1J D;  2QJK B;  2W6J H;  4PD4 I;  3M9Q A;  3L72 J;  5AVR B;  2W6B A;  2JHL F;  3PTZ A;  1LTJ B;  4JYO X;  2J0H A;  4NPD A;  1WT6 A;  3VOP A;  1HTL C;  3VN0 A;  1JEK A;  3A2A A;  3B8E B;  1UIX A;  2WSC J;  1LTB C;  4A7P A;  1CSB A;  4OGQ B;  3USS A;  1SQB G;  1X0T A;  3P8C E;  1BCC E;  2M5A A;  1OMI A;  1LTJ C;  2Q7C A;  3FXD A;  4YTP C;  5AVW B;  2OGU A;  1NTZ J;  2RKL A;  1BDC A;  5APY A;  4HJG H;  1T3J A;  3CCQ P;  3ABV C;  3RL0 D;  1NTK E;  2Q1K A;  1FZE A;  5AW1 B;  2O01 J;  2P67 A;  2FXO A;  2KS1 A;  1BCC D;  3FWN A;  3H1J G;  1IFJ A;  1LP1 B;  1SVF A;  2NPS A;  1SQQ J;  3CC7 P;  1SQV J;  3H1I G;  3RK3 C;  1FU1 A;  3M9H A;  2E74 D;  3ITK A;  1PPJ E;  1YQ4 C;  1HVV A;  2FXP A;  2XDJ A;  1L0N G;  3H32 B;  2KI7 B;  3HTK A;  1K73 Q;  3TSI A;  1SQB K;  2KNC B;  3G71 P;  5AW4 B; 
#chains in the Genus database with same CATH homology
 1JOC A;  3V2R A;  1IFN A;  1LGH B;  2WPR A;  2KLV A;  3RK2 D;  1N7S A;  3II6 A;  2OYH B;  2FFD A;  2JHH C;  1NOH A;  1XTG B;  2P2U A;  3MIW A;  4WBA A;  1FJK A;  3HD7 D;  1G1I A;  4N78 E;  3BAT A;  1T3U A;  3V2Q A;  3VYI A;  1N2D C;  2WPQ A;  1FZA B;  1MFZ A;  1RY3 A;  2Z4E B;  2N1T B;  1RF0 C;  2HYN A;  2XNX B;  1LWU A;  5CCH A;  2IFN A;  3M0A A;  3A3Y B;  5AW8 B;  4WY4 C;  2W27 A;  3L4F A;  3V4Q A;  1M1J B;  1NO4 A;  1RF1 C;  1M7L A;  2JHM F;  5AW6 B;  1DH3 A;  1Z56 A;  2HPC A;  1LT9 A;  2CPS A;  1SP4 A;  3KQG A;  1SFC B;  4EPU A;  3V5B A;  5APQ A;  2OYH C;  3E1I A;  2YKO A;  4LC1 A;  3TYY A;  2OAR A;  4IFF A;  5AVV B;  3HUS C;  1JY2 N;  3V2P A;  2R5D A;  3A7O A;  3I5C A;  1FZD A;  2KP8 A;  2XU6 A;  1G2C B;  3V2N A;  2Z5H A;  2WT7 A;  1J2J B;  1ZR4 A;  1IO4 A;  3M0D A;  1LTS C;  1N7L A;  3VP8 A;  1HWT C;  2HLO A;  4JZC A;  2I1K A;  2HG5 D;  1LTT C;  1JY3 O;  1FZF A;  5AW2 B;  1YTZ I;  1FID A;  4M7H A;  1ZN5 A;  2R3C A;  2Z4E C;  2XKM A;  2YMY A;  1FZA C;  1N73 B;  3M91 A;  4IFM A;  3B5N D;  2GUS A;  3OAK A;  2FFD B;  3N4X A;  2NPS C;  1WRG A;  1SFC D;  2FFD C;  5APU A;  2N1T D;  2Q3I A;  1NTM K;  3T97 A;  1GW3 A;  3WMM 0;  1N73 C;  2FKW B;  2C9N Y;  3C9I A;  1GZL A;  1OXZ A;  2J61 B;  2GM4 A;  2J3F D;  2Z4E A;  1NTZ K;  4XA4 A;  1GK4 A;  1H88 A;  1NKN A;  5AW9 B;  2O1J A;  3M9B A;  2FIB A;  2PP6 A;  1IC2 A;  2ZFC A;  5KLV K;  1JMM A;  1GDT A;  5KJ7 C;  1OWA A;  1URQ A;  2IPP A;  2BAS A;  3RL0 C;  1M1J A;  1GL2 D;  2WWW A;  1IJD B;  1LT9 B;  4C46 A;  1L0N K;  1Z3S A;  3KDP B;  1JY2 P;  2R32 A;  4B86 A;  3E1I B;  5AVQ B;  1JUN A;  3R2P A;  2J64 A;  1A02 J;  1FZB C;  1EQ7 A;  3HE4 B;  2C0X A;  2P1J A;  3RK2 B;  4IFD K;  1KZU B;  5CJ0 A;  1RE4 A;  5AW7 B;  5BU8 B;  1SQX K;  4WY4 D;  2Q9I A;  1QL1 A;  2MJZ A;  1S9K D;  4Y99 C;  3HD7 B;  2OYI B;  2J0G A;  1RF1 A;  1HUC A;  5APX A;  2YKP A;  2HLO B;  2C0W A;  2YO2 A;  1FZG B;  1FIC A;  3HE5 A;  3P8M C;  3HUS B;  2J2P A;  1IFI A;  4GIF A;  1SFC C;  2A45 H;  1MZ9 A;  2HFE D;  1ZV8 A;  1JO5 A;  3IFM A;  1FBM A;  1JY3 N;  1NHL A;  4I6M C;  5APV A;  1M1J C;  4AQR D;  4DOJ A;  4ZFG A;  2IX7 C;  1N7S D;  1G1J A;  1GU4 A;  2QM8 A;  3GHG A;  5KJ7 A;  1HJB A;  1FZC B;  1QL2 A;  1HGV A;  3L37 A;  1FZG C;  5APT A;  1ZLL A;  4N78 D;  1A02 F;  3U59 A;  3BVH C;  1L4A A;  3VMX A;  4I1L A;  2POH A;  1KIL B;  3MGN A;  3G3Z A;  1T8Z A;  3H32 C;  1FZE B;  1L4A C;  3CLQ A;  3MUD A;  1URQ B;  2M8R A;  2YO3 A;  1URQ D;  5AW3 B;  5APS A;  5BU5 A;  1N86 A;  3RK2 C;  2Q5U A;  3SWF A;  4JYB A;  1VDF A;  3KYQ A;  4C7N B;  1LTI C;  1SQP K;  3RL0 B;  4WY4 A;  3L35 A;  3VP9 A;  1CI6 B;  2Q9I B;  3IR9 A;  5KTB A;  2WTY A;  2Z5I A;  1JCD A;  1RF0 A;  2JEE A;  3OA7 A;  2J3F A;  1IFM A;  3N7N A;  3TNU B;  5AVT B;  4N6J A;  2E42 A;  4AUW A;  1KIL D;  1RE3 C;  2QM7 A;  1H89 A;  1FZG A;  1FOS F;  2H43 C;  3HE5 B;  4M3L A;  3HUS A;  1NWQ A;  3V4W A;  1N7S B;  2NPS B;  3FIB A;  4ZKP A;  2OYH A;  1NU1 K;  1JTH B;  1N7S C;  4HH2 A;  1FZB A;  2J60 A;  2XZR A;  1RE3 B;  3LID A;  2KSJ A;  3BAS A;  2M3B A;  3EQ2 A;  3HRN A;  4W7Y A;  2VRS A;  2WPS A;  3GHG B;  2FYZ A;  1LWU C;  5CCH C;  3U1C A;  3TK1 A;  5CJ4 A;  2N1T A;  2A45 G;  4JF7 A;  2HOD A;  1IK9 A;  2H8P D;  1AFO A;  2XNX A;  1FJP A;  1XTC C;  2L5G B;  4W7Z A;  3M06 A;  1J1E C;  3NMD A;  2LKM A;  5AVS B;  1LTA C;  2WSE H;  1KFM A;  2J0Y A;  4R9J A;  1N86 B;  1JC9 A;  1DEB A;  1J1D C;  2PAJ A;  2NPS D;  2WZ7 A;  4XE5 B;  5AW5 B;  3SWY A;  3VMZ A;  1X79 B;  5CHX A;  4LGD E;  4C7N A;  1KFN A;  1X9V A;  1FZA A;  2ZXE B;  1DX7 A;  1AQ5 A;  2GY7 A;  2WNP F;  1GL2 C;  4O9B A;  5CCH D;  2WT7 B;  1LWU B;  3P7K A;  1FDM A;  3VTP C;  3BVH B;  4R9T A;  1KQL A;  1JY2 O;  1NAF A;  2P7J A;  4EOT A;  4KHX A;  1GL2 B;  1S9K E;  1SQQ K;  3LIE A;  2IFM A;  1SFC A;  4ZKU A;  3B5N C;  5CMZ A;  2R5B A;  1JY3 P;  3KPE A;  1LTJ A;  3MD0 A;  1N73 A;  2FYU K;  1JTH A;  1YTZ T;  1J1D B;  2J3U A;  5BVZ A;  3CI9 A;  4C7R A;  2J59 M;  1GTW A;  2E43 A;  1RE3 A;  3O8Z A;  1CZQ A;  5CCG D;  1LT9 C;  1NH4 A;  2J61 A;  2XV5 A;  1J1E B;  2OYI C;  2HOD C;  2WIT A;  4W80 A;  1RE4 C;  1FZF B;  4DZO A;  3LW5 H;  2CPB A;  3L36 A;  2YNY A;  3BRT B;  5AVX B;  3A5T A;  4GKG A;  1NKZ B;  3PP5 A;  2J3O A;  2YKQ A;  2I1J A;  1JNM A;  4I2L C;  1SLQ A;  3NTN A;  1HH0 A;  3HE4 A;  2H43 A;  1RE4 B;  1GD2 E;  1KIL C;  2HPC C;  5AVU B;  4RES B;  3BVH A;  1IFD A;  1H8A A;  4GT1 A;  1FIB A;  3M9Q A;  2KOG A;  2J1G A;  1T2K C;  1GL2 A;  5AVR B;  2W6B A;  1FAV A;  2JHL F;  2J58 A;  3B5N B;  1LTJ B;  1T2K D;  1N86 C;  4JYO X;  2J0H A;  1L0L K;  3CL3 D;  2HLO C;  2GUV A;  3MTU E;  1MUU A;  2WSC H;  3P8C D;  3VMY A;  2C9L Y;  1WT6 A;  3HD7 A;  2OYI A;  3H32 A;  3HTK B;  3VOP A;  1HTL C;  2O01 H;  3VN0 A;  3A2A A;  3B8E B;  1RF1 B;  5CCG C;  1L4A B;  1FZE C;  1L4A D;  2FXM A;  3U1A A;  1LTB C;  2W6A A;  1KIL A;  1CSB A;  2A45 I;  2XNX C;  2O1K A;  4EIJ A;  3H6P A;  3NXS A;  2D39 A;  3P8C E;  1HGZ A;  3GHG C;  3E1I C;  2N1T C;  1W2E A;  3OJA B;  1FZC C;  4N3Y B;  1LTJ C;  5AVY B;  2Q7C A;  4JYC A;  2WSF H;  3RK3 D;  5AVW B;  3BRV B;  2J5Z A;  4AYC A;  1MV8 A;  2KB7 P;  2H7H A;  2JHI F;  1FZC A;  3UIA A;  2H43 B;  4WY4 B;  4NYT A;  5AVZ B;  5APY A;  1NTK K;  1YYC A;  1T3J A;  1CI6 A;  1PFI A;  4M7F A;  2KYV A;  1GW4 A;  3RL0 D;  5APW A;  1RF0 B;  1HBW A;  1FZE A;  5AW1 B;  3TNU A;  2P67 A;  5AW0 B;  2HPC B;  2Q9I C;  1Z3U A;  3HD7 C;  4Y99 B;  1X8Y A;  4WB4 A;  1IFJ A;  1GK6 A;  1LTG C;  1SVF A;  2JHK F;  2NPS A;  3RK3 C;  3B5N A;  4OH8 B;  1FU1 A;  1GU5 A;  1FOS E;  1FZB B;  3M9H A;  3EFG A;  3NFQ A;  3RK3 B;  5KJ7 D;  1G2C A;  4HYT B;  1SQV K;  1E5W A;  1URQ C;  1FZF C;  1HVV A;  2JJL A;  1JCC A;  2XDJ A;  1CW5 A;  2J3G A;  3HTK A;  3H32 B;  3P32 A;  2HOD B;  1VPC A;  3TSI A;  3M0D C;  4LLH A;  2N9B A;  1SQB K;  1ZR2 A;  5CCG A;  5AW4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...