1M1JB

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
402
structure length
402
Chain Sequence
IYPDAGGCKHPLDELGVLCPTGCELQTTLLKQEKTVKPVLRDLKDRVAKFSDTSTTMYQYVNMIDNKLVKTQKQRKDNDIILSEYNTEMELHYNYIKDNLDNNIPSSLRVLRAVIDSLHKKIQKLENAIATQTDYCRSPCVASCNIPVVSGRECEDIYRKGGETSEMYIIQPDPFTTPYRVYCDMETDNGGWTLIQNRQDGSVNFGRAWDEYKRGFGNIAKSGGKKYCDTPGEYWLGNDKISQLTKIGPTKVLIEMEDWNGDKVSALYGGFTIHNEGNKYQLSVSNYKGNAGNALMEGASQLYGENRTMTIHNGMYFSTYDRDNDGWLTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGTYSWDMAKHGTDDGIVWMNWKGSWYSMKKMSMKIKPYFPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha subunit
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
total genus 128
structure length 402
sequence length 402
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
B PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1m1jB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1m1jB02
2FIBA 1FZFC 1N73C 2OYHB 1FZGB 2Z4EA 1N86C 2FFDC 2J3FA 3E1IC 2J3GA 2OYIB 1JY3P 1M1JC 2JHMF 1JC9A 1RF1A 2H43C 1RF0C 2WNPF 2Q9IA 4R9JA 1RE4B 1LT9C 1FZBB 3GHGA 1RE3B 2HPCC 2XNXB 1FZFB 1FZCC 1T3UA 2J3OA 4R9TA 1FICA 1FZEB 1N86B 2FFDB 1LWUA 3BVHA 1Z3SA 2J61A 1FZAB 2Z4EC 2H43B 1RF0B 1LTJA 1JY3O 2JHHC 4JYOX 2OYHA 2HPCB 1RF1C 2Q9IC 1FZGA 3H32A 1FIBA 2HLOA 3GHGC 2J60A 2J1GA 2J64A 1W2EA 2J3UA 1Z3UA 1N73B 2JHLF 4EPUA 4M7HA 1LWUC 3BVHC 1RE3A 1FZBA 2J0GA 3E1IB 2XNXA 1JY2P 1M1JB 1JY2O 2J0HA 2J2PA 3HUSA 1RF1B 1LTJC 1FZEA 2HODA 4JZCA 2OYHC 4NYTA 2JHIF 1LT9B 1FZAA 2A45I 2J0YA 3H32C 2HLOC 1FZCB 2GY7A 1FZDA 2D39A 1LWUB 3BVHB 2OYIA 2J61B 2Z4EB 1RE3C 1FZBC 1RE4A 2XNXC 2J3FD 1JY3N 3HUSC 4M7FA 1FIDA 1FZFA 1N73A 1FZEC 3H32B 2HODC 2HLOB 2A45G 2JHKF 4ZFGA 2Q9IB 1N86A 2FFDA 3E1IA 3GHGB 2J5ZA 1M1JA 1FZAC 1FZGC 2H43A 2A45H 2OYIC 1RF0A 1LT9A 1JY2N 3HUSB 2HPCA 1FZCA 2HODB 1RE4C 3FIBA 1LTJB
chains in the Genus database with same CATH superfamily
2KIKA 3AEDC 2G3AA 1KYOD 2B88A 4Y99B 3E1IC 5B66H 1OIPA 5APVA 1NAFA 4MN4C 1VF5D 2YXQB 1FU1A 2FKWB 2FY8A 1DH3A 1NOHA 2W8ZA 3TGUG 1NGMB 3HTKA 2XDJA 1BSNA 1KYOH 1MFZA 1M8OB 1JY3O 3B71A 1S9KE 2P58A 1JOCA 1SQVD 5AVRB 1Q7YQ 3FWLA 2J3UA 2ZXXA 5CMZA 1PGJA 2JHLF 5AVTB 1JEKA 2FBWC 2XNXA 5AW7B 2KOGA 1JY2P 4U7JA 2ZYDA 1FDMA 1SS1A 4K35A 3L75D 4RJTA 1YJWP 2HODA 3IAOA 3B5NB 2N9BA 2KSEA 1SQVG 2HFED 3MUDA 2ZVNB 4BRYB 1NKZB 3P8CE 1T2KC 1YJNP 4DCKA 1VQPP 4UB6E 2Z4EB 2BCCD 3CCSP 3L75G 1FZEC 2HLOB 2A45G 3H1HD 1HTLC 4M3LA 3CC7P 3CX5I 5AVSB 3B5ND 1VQ9P 4ASVA 1VQ4P 2AXCA 2A45H 1LT1A 1RF0A 1DX7A 1SQXK 2KS1B 4AQRD 1NTKK 1G2CA 4HB1A 2PAJA 4K3AA 1M1JC 1CI6B 3A0BH 1FBMA 2WTYA 1NTZG 1FZFB 1S5LH 4R9TA 3HD7C 3L74G 2QJKC 3BVHA 4JYCA 4B86A 1ZR2A 3VMZA 3P7KA 4JYOX 1LP1B 2I1JA 5CBOA 5APYA 2QJPB 1FE6A 3WUTA 1IFJA 1W2EA 3TF5A 4WY4C 2IYPA 5DJUB 1AQTA 2JHIF 3L73D 1OX3A 1LWUB 2C9NY 1KTMA 3L72J 2J61B 3L71J 3GMAA 1WRGA 2XKMA 3CMEP 2KSJA 1HUCA 1OVUA 3KZIE 3H32B 3M9BA 2JHKF 3E1RA 1KFNA 1PP9G 5KLVG 4R4LA 1VQMP 3L72E 3D71A 1FDOA 2WT7B 3L71E 4N3YB 4ZKPA 2H43A 1CZQA 4U3FD 5BVZA 5KJ7C 3B5NA 3HUSB 3KDPB 2QIWA 4GOEA 3RL0C 1EQ7A 4BRYA 2XV5A 3QWOC 2FXOA 4KHXA 5H2FE 2O01J 2KXPB 2Z4EA 1AQ5A 2OYIB 1IFPA 1EXIA 2GUSA 3M0DA 3H1KD 3CC4P 1N7SC 1IC2A 1L4AB 2YKPA 4IL6E 2WQYC 3U1CA 2M8RA 1FZAB 2GM4A 3MGNA 1M7LA 2W6JH 4D6TG 1CI6A 4A7PA 1L4AD 1MZ9A 1N73B 1KORA 1S1CX 1J1EC 4EOTA 3KYQA 2J2PA 2ZT9C 3PH0A 3BATA 5DJTB 2I8DA 1GK6A 1OW6A 2WSFJ 1SQBG 1XTGB 1VPCA 3KPEA 1J1DC 1S4XA 2XZRA 3AE8C 1RE4A 2H7HA 3KHUA 2J3FD 1FIDA 1BCCJ 3C1LA 1D7MA 1N86A 4OWFA 2KUBA 1GDTA 2OTJP 2QJYB 1BCCE 3WU2E 1GZLA 3C8VA 2W6AA 1BE3J 4ZMDA 2KYVA 2FFDC 1JY3P 2PRRA 5APUA 1RF1A 4WVZA 3A2AA 3CWBG 1RE3B 1BE3E 2I1KA 3ITKA 1ZW0A 1HWTC 3LW5H 3CXHE 2A06E 1NTMJ 2HPCB 3H1LD 2M3BA 3A0HH 1USEA 5KAIE 1NKNA 2HR3A 1ZOYC 1GMJA 3BRTB 3G6EP 4JBZA 1NTME 1MUUA 5TISE 3S9OA 3VMXA 1QLED 1KB9I 1EDJA 5M1BA 1FZAA 3MZWB 2D39A 2WITA 1YJ9P 2FYNC 3AE4C 2WSEH 1LJ2A 1DIPA 2XNXC 1SQXG 3VOPA 1N73A 1IFIA 1NTKG 1X8YA 1L0LG 2HODC 2Y0CA 1RY3A 3AEGC 5AVQB 3A3YB 3MUDC 3TYYA 1WT6A 3VYIA 1LNQA 1S9KD 5APWA 2KZIA 2RN0A 2JWDA 1OMIA 1PL5A 5AW5B 4IL6X 2W27A 1AVOA 1NH4A 1FZGB 2WMMA 1K05A 3VP8A 1VQ5P 2R5BA 2E76C 1RF0C 2YO2A 3QH9A 1RHZB 4H0LC 1K8AQ 3P8CD 4OH8B 1T3UA 4L74A 1TU3F 2RH0A 3GG2A 3EQ2A 3TDKA 2WSCJ 1NU1J 1PGPA 1HVVA 2E75C 4I1LA 2NRGA 1URQB 3USSA 2IZ0A 4PV1B 3U59A 2OGUA 3BVHC 5AVYB 1RE3A 2J0GA 1NU1E 1GL2B 4UB6H 3BCCJ 2QE7H 2AEMA 2H89C 3SWFA 1H89A 3JCUE 5KAFE 4Y99C 4OVNF 2IPPA 4HYTB 3AEFC 5BU8B 3BCCE 1JMMA 4LC1A 1URQD 4PV1D 3Q5SA 1X9VA 3E7KA 1JY3N 2Q3EA 1GL2D 4RKUJ 3CCVP 5KTBA 1NO4A 1KQGB 1ZR4A 2YXRB 2WWWA 1HBWA 1KN7A 4I2LC 4DOJA 1FS0E 3RL0g 2HG5D 2PFXA 3FIBA 1QX8A 2D2CB 1PFIA 4PD4E 1KILE 3WUVA 2BEZF 3NTNA 4UB8E 2N9YB 1FOSE 1JC9A 2NPSB 3L35A 2H43C 1SQQG 5E79E 2QM7A 3B5NC 4KT0J 4AYCA 3G4SP 4IFDK 1Z56A 1M1KQ 3MD0A 2E74B 3AE6C 2D2CD 3AE5C 4KJMA 2Z4EC 3G3ZA 1GU5A 1BGYJ 2KLVA 3M0DC 3L72D 3D6YA 2NPSD 1FZGA 3CCLP 3MHVA 3L71D 3NMDA 1NU1K 3PRJA 1FC2C 4C7RA 1BGYE 2JR8A 3I55P 1PGQA 1OW7A 3CMAP 2E74D 4PD4I 3IR9A 3RGUA 1X79B 3IFMA 2O1KA 3BRVB 5AW9B 3L71G 2QEXP 3KZIH 1SQPJ 2N1TB 1VQNP 2KZJA 4H13B 2PGDA 3OAKA 2WPSA 1EDKA 4ASWA 1Y8AA 2JEEA 2AEJA 4RESB 4ZKUA 1SQPE 2K9JB 4DT0A 3L70J 5H2FH 1GL2A 1FOSF 5CCHD 5CCGA 5AW3B 2IYOA 3H1JJ 2N1TD 1RQVA 3Q2YA 3GF3A 1RE4C 4H13D 3L70E 3T97A 2O01H 1FJPA 4IL6H 1N86C 3H1JE 2J3GA 2JHMF 2WSSH 3LIEA 3Q3DA 2WPRA 1JO5A 1IFNA 2WPVB 2BCCG 2RKLA 2CK3H 1JUNA 3H1HG 1L0NJ 2R44A 3LIDA 3OA7A 2Q3IA 2LXBA 4ZNCA 1RF1C 2IX7C 1M56D 1EZVE 2RMZA 1QEXA 3HE5B 2NPSA 2J64A 1L0NE 1M90Q 3IN6A 1BCCD 1EC5A 1T6AA 3CCQP 1KB9D 2WSFH 4PJ0E 3MTUE 1XTCC 3F89A 1S72P 3SWKA 2BASA 4TT3H 1BCCG 1SQPK 3MP7B 3O6QB 1BE3D 1S2EA 4NPEA 2ZXEB 1LTBC 2HYNA 2L91A 4YPCA 1P84E 3WU2H 2WZ7A 2B87B 3CXHD 1MKMA 1FZAC 1KB9H 2ZVOB 2A06D 3AE9C 1EZVI 2IFNA 2N1TA 4YXDC 3G71P 1LTJB 5AW6B 1FDIA 1IFDA 5L8RJ 1N73C 3RK3C 1NTMD 2LR2A 1VQ6P 3CLQA 3L73G 4YXWH 1DD4A 3CXHH 1T2KD 1QL2A 2K9JA 3TGUJ 5AW1B 3AE1C 1CW5A 2J3OA 4HH2A 5KAIH 5APXA 3TGUE 1GTWA 1L2PA 3K5BA 1P84I 1L0NK 5TISH 4I7ZC 4U3FG 2OTLP 2HLOA 4DZOA 2W6BA 2QJKB 1RH5B 2P10A 3V2NA 1BDCA 2QJYC 4M7HA 1G1IA 3AECC 1OW8A 2KS1A 5B5EE 2OTKE 3H1KG 4OGQC 3SSUA 1FZCB 1LGHB 1DEEG 3SFDC 4QMAA 1PPJD 4GDOA 1VQKP 3H1IJ 3BASA 1HF9A 1RE3C 4XFJA 1OWAA 4O9BA 1HJBA 1FZFA 3CCRP 5APTA 2W83C 2ZAEB 3H1IE 1PPJG 2Q7CA 1LP1A 1A02J 2PP6A 3NXSA 5KLIB 3V2QA 3O6QA 1NTZJ 1NU1D 5APQA 3L74J 3L4FA 1OVRA 4IFFA 4IFMA 3VP9A 2K1AA 2ZYAA 4WWIA 2JJLA 1NTZE 1QVGO 3L74E 1NU1G 3BCCD 4XA4A 1LWUA 1KILB 2J61A 2IFMA 5AVWB 2WSCH 1LTJA 1LTTC 1H88A 4RO0A 3V6IA 1PGOA 5KJ7D 4BWNA 3H32A 3JC22 2J60A 1X22A 3JCUH 5KAFH 1VDFA 2WT7A 1ZV8A 1JY2O 3R4YA 2J0HA 3HUSA 3PP5A 4GKGA 4PD4D 1KILD 1EDIA 4JZCA 4NYTA 3M91A 2MJZA 1PP9J 1MFTA 5KLVJ 2OYIA 3AEEC 2IBZE 1L4AA 4M7FA 2Q1KA 2GUVA 3KQGA 1PP9E 2Q9IB 5KLVE 1OVVA 4PD4H 3GHGB 2J5ZA 3H1LG 1J1DB 4UB8H 3TK1A 1A02F 4EYYQ 5E79H 1FZCA 4L76A 2KK7A 1BGYD 1LTAC 2YMYA 3AE7C 2J3FA 2B89A 1GL2C 4H44B 5CCGC 1Y47A 3CXHI 2E42A 4DJGA 2G8YA 2FFDB 4D6TJ 2IBZI 1KQLA 1SQPD 2K37A 4H44D 4D6TE 2J1GA 2H8PD 5KJ7A 2QA4P 1AVYA 1SQBJ 2V4HA 3OW2O 3L70D 1ZN5A 3V4QA 2D2CC 1KILA 3H1JD 3M9QA 1SQBE 5APSA 1FZDA 2NPSC 1NTMK 3D70A 2IDBA 4AUWA 1VF5C 3HTKB 2YIUB 4Y28J 2JP3A 3PTZA 4GIFA 5AVUB 1VQ8P 1FAVA 5EFWB 1YQ3C 1RQUA 4EDFA 1YHQP 1SFCB 3GW6A 4JQ0D 1H8AA 2OARA 1EZVD 2Y9ZA 1Q81Q 1HGVA 2FYUJ 3C9IA 2HPCA 3RK3E 2R5DA 1L0ND 2HODB 1IFMA 1NJIQ 3CWBJ 3CD6P 2M3EA 1NVOA 3M9HA 5GTHE 2ITAA 3G9RA 2FYUE 3OJAB 5AVXB 2Q9IA 5AVZB 2ZFCA 3CWBE 1FZBB 3GHGA 1SFCD 1L0NG 1ZRTE 2N1TC 1AV1A 3L37A 2C9LY 2XNDH 1FICA 3CPWO 2BEQD 1AA0A 3CCJP 2DW3A 4H13C 2O1JA 2E43A 2E76B 3HRNA 1RF0B 1GW4A 1P84D 3EFGA 3V5BA 4H0LB 2JHHC 3S1KA 1G2CB 1H0TB 4PJ0H 2E5YA 5C39A 3FWNA 3SWYA 2JWAA 1NYHA 2KI7B 1S3JA 1VQLP 3O8ZA 3A7OA 5AW2B 2KP8A 3RK2B 3AE3C 1T3JA 2E76D 2E75B 4CPGA 1LT9B 1IO4A 1SQXJ 1P84H 4H0LD 1FJKA 2HLOC 1NTKJ 4TLFA 1L0LJ 3W67A 3HE4B 3BVHB 1CSBA 4NPFX 1VQ7P 1Q86Q 1NAYA 1SQXE 3P32A 2P67A 1DD3A 1Q90D 3MIWA 1NTKE 1L0LE 2P2UA 4W7ZA 3N7NA 3RK2D 1KMIZ 2J59M 2O01N 3TGUD 3CI9A 3L72G 5CJ4A 1ZP0C 2QRXA 3D6ZA 2E75D 1KV4A 2K9YA 2JO1A 4N6JA 1R5LA 2V7QJ 3CL3D 3EFFK 3FXDA 2FYUK 1FZFC 2OYHB 2VRSA 1URQA 3CX5E 5K5GB 3S4RA 4HJGH 1W5CE 3TSIA 4EI2A 3Q1MA 1PV3A 5KKZB 3L36A 1SFCA 1KQFB 2QJPC 3I5CA 1U7MA 4WBAA 2QM8A 2P7JA 1IZNB 2H43B 3V4WA 2LXCB 1ZLLA 3B8EB 5B5EH 3H1ID 4N78E 1YBKA 1UIXA 3AE2C 1LWUC 1FZBA 3E1IB 4L73A 3RBXA 1LTJC 3A5TA 1JCDA 1HGZA 1X0TA 1ZMEC 5GTIE 1OXZA 3H1IG 2GA1A 3H32C 3NFQA 1NWQA 1MV8A 4LLHA 1L0LK 1JCCA 1NTZD 1Y9BA 2MKVA 3SFEC 1H0TA 3L74D 3HUSC 4I6MC 2YNYA 1YTZT 4EIJA 3GF7A 1IK7A 2AXTE 2M5AB 2OYIC 1LT9A 1JNMA 1SQQJ 3HE4A 1L4AC 4W80A 2JKVA 4C46A 1SQQE 1KZUB 1PIXA 1RE4B 3P8MC 1WMKA 1BE3G 5CCHA 3RBZA 1K73Q 1FZCC 1JB0J 2B9BA 1FZEB 1N86B 2IBZD 5B66E 2J5UA 3ABVC 2Q5UA 2A06G 1E5WA 1PP9D 2E5TA 5KLVD 2OYHA 3JSVC 2Y0EA 3AEAC 2IBZG 2JDIH 1NTMG 1QL1A 1IJDB 1KYOE 1M1JB 1RF1B 1JMBA 5KLIC 1JTHB 1Q82Q 2Z5HA 2K3RA 3HD7B 1U57A 1YITP 1SLQA 1UIIA 3KXDA 4GT1A 1SQVJ 3ZDMA 5TJHA 1BSHA 1NHLA 1KILC 1SVFA 3E1IA 5AVVB 1SQVE 3L75J 3PLNA 4WY4B 1K9MQ 4JYBA 1JY2N 4D6TD 3HD7D 1IK9A 2LKMA 1SP4A 3HE5A 4C7NB 3L75E 4JPZB 1SQQK 2BCCJ 1GK4A 1KYOI 1YQ4C 4LGDE 5CJ0A 1LTSC 5CBNA 3H1HJ 4R9JA 1SQBD 4YTPC 2HPCC 4WY4D 1YI2P 3RK3B 2BCCE 3FXEA 2M5AA 1DEBA 2O3JA 3W68A 4WB4A 1PZQA 1Z3SA 3H1HE 3A0BE 1USDA 3I56P 2KNCB 2YKQA 2YMKA 1OFCX 1S5LE 1M57D 2Q9IC 1YYCA 1EXJA 3GHGC 3RL0B 2B87A 3VMAA 2POHA 3RK3D 4W7YA 3M06A 2L5GB 4I7ZB 3WMM0 3CC2P 1FZEA 1J2JB 2FYZA 1QVFO 3FX0A 1N7SB 3H6PA 2A45I 3R2PA 2J0YA 2FYUD 2M0BA 2WVRA 4H44C 3CWBD 3RL0D 3BCCG 1ZRTD 4NPDA 2XU6A 5AW8B 1KB9E 1SQVK 4OGQB 2FYUG 3TNUB 4Z1MH 1GD2E 1M1JA 3B4SA 1N7SD 5AW4B 1FZGC 1T8ZA 2J58A 5GTHH 1JTHA 1W2BO 1J1EB 2SPZA 3L73J 2R32A 1VQOP 2FXMA 2ZT9B 3HD7A 2FIBA 2P1JA 3IF4A 2AEFA 1R5SA 2H88C 4OGQD 3L73E 4R4MA 2WNPF 5BU5A 2Q6QA 4U3FJ 1R8EA 4WY4A 1HH0A 3CCEP 2ZT9D 2NZ2A 1VL2A 1URQC 1BDDA 2YIUC 4PV1C 3VMYA 1SQXD 1K04A 2CPSA 1NTKD 1L0LD 3VTPC 1NTZK 2R3CA 4C7NA 4U3FE 1KD1Q 2IZ1A 2CPBA 2Y9YA 3H1KJ 3V2PA 1LTGC 1SFCC 1BGYG 4EPUA 3CCUP 3PHLA 2WPQA 4JF7A 1HJ0A 3CX5D 3H1KE 3M0AA 2QSIA 1AFOA 2GY7A 2KNCA 1LTIC 2Z5IA 1N7LA 4IOIH 3V2RA 1FZBC 1SQPG 4ZFGA 2QVAA 2K88A 3CX5H 1PPJE 1N7SA 1KC8Q 2YKOA 2QG4A 2V7QH 1U7JA 3L70G 5KLVK 4N78D 3H25A 4HKZH 5CHXA 3H1JG 2E74C 3RK2C 2FYNB 1LT9C 3TNUA 1S5LX 1KQSO 3PJSK 2XNXB 1OZHA 3UIAA 2R3SA 1G1JA 1GU4A 1N2DC 1QGKB 3FGAD 2OYOA 1KFMA 3LW5J 4XE5B 1EDLA 1EZVG 1FIBA 5AW0B 1JM0A 5CCHC 3T97B 5GTIH 4GODA 1Z3UA 1AJYA 3II6A 2FXPA 3Q5RA 3VN0A 1E79H 4L75A 3WUUA 5CCGD 3CCMP 3A0HE 1YIJP 2OYHC 2OQQA 2KLUA 1SQQD 2AXTH 3GLMA 3H1LJ 4BXLA 3N4XA 4GOFA 2WSEJ 2C0XA 2YO3A 1ZXGA 3Q5PA 3AEBC 2KB7P 3U1AA 5KKZC 1SQBK 2W90A 1GW3A 1Q2NA 2FFDA 2ZJSE 3H1LE 3EWKA 1VF5B 2Y0DA 2ZYGA 1YTZI 1N8RQ 2UWJE 3F5HA 2C0WA
chains in the Genus database with same CATH topology
3V2QA 5AW5B 4W80A 2W27A 1NH4A 1FZGB 5APQA 4Y99B 3E1IC 4C46A 3VP8A 3L4FA 4IFFA 4IFMA 3VP9A 2R5BA 5APVA 1NAFA 1RF0C 1KZUB 1RE4B 2YO2A 3P8MC 2JJLA 5CCHA 3P8CD 1FZCC 1FU1A 4OH8B 1T3UA 2FKWB 1FZEB 1N86B 4XA4A 1DH3A 1LWUA 1KILB 1NOHA 2J61A 2IFMA 5AVWB 3HTKA 2WSCH 2XDJA 1LTJA 2Q5UA 3EQ2A 1LTTC 1MFZA 1E5WA 1JY3O 1S9KE 1H88A 2OYHA 1HVVA 5KJ7D 3H32A 2J60A 1JOCA 5AVRB 4I1LA 1VDFA 1URQB 2J3UA 2WT7A 5CMZA 3U59A 2JHLF 5AVTB 1ZV8A 3BVHC 5AVYB 1RE3A 2J0GA 1QL1A 1IJDB 2XNXA 2KOGA 1JY2P 1M1JB 1GL2B 1JY2O 5AW7B 2J0HA 3HUSA 1RF1B 3PP5A 4GKGA 1KILD 1FDMA 2HODA 1JTHB 4JZCA 4NYTA 3B5NB 2N9BA 3SWFA 2HFED 3MUDA 3M91A 1H89A 2Z5HA 4Y99C 2MJZA 2IPPA 4HYTB 3HD7B 1NKZB 3P8CE 1T2KC 2OYIA 1SLQA 4GT1A 5BU8B 1JMMA 4LC1A 2Z4EB 1URQD 1X9VA 1JY3N 1L4AA 4M7FA 1NHLA 1FZEC 1GL2D 2GUVA 2A45G 3KQGA 2HLOB 2Q9IB 5KTBA 1KILC 1NO4A 1SVFA 3E1IA 3GHGB 2J5ZA 1HTLC 4M3LA 5AVVB 1J1DB 5AVSB 1ZR4A 3B5ND 3TK1A 2A45H 4WY4B 1RF0A 4JYBA 1A02F 1DX7A 1SQXK 2WWWA 1JY2N 1HBWA 3HD7D 4I2LC 4DOJA 4AQRD 1IK9A 1NTKK 2LKMA 1SP4A 1FZCA 1G2CA 2HG5D 3FIBA 1PFIA 2PAJA 1LTAC 3HE5A 2YMYA 4C7NB 1SQQK 3NTNA 1GK4A 4LGDE 1FOSE 2J3FA 1M1JC 1CI6B 1GL2C 5CJ0A 1JC9A 1LTSC 2NPSB 3L35A 5CCGC 2H43C 4R9JA 2QM7A 3B5NC 1FBMA 2WTYA 4AYCA 2HPCC 4IFDK 4WY4D 1FZFB 3RK3B 2E42A 1Z56A 1DEBA 3MD0A 3HD7C 4R9TA 2FFDB 4WB4A 3BVHA 4JYCA 1Z3SA 4B86A 1KQLA 1ZR2A 2Z4EC 3G3ZA 1GU5A 3VMZA 2KLVA 2YKQA 3P7KA 4JYOX 3M0DC 2I1JA 2Q9IC 2NPSD 1FZGA 1YYCA 3NMDA 3GHGC 1NU1K 2J1GA 3RL0B 2H8PD 5KJ7A 5APYA 1IFJA 1W2EA 4C7RA 4WY4C 2POHA 3RK3D 4W7YA 3M06A 2L5GB 3WMM0 1ZN5A 3V4QA 3IR9A 1FZEA 1X79B 3IFMA 1J2JB 2FYZA 1N7SB 2O1KA 3BRVB 1KILA 5AW9B 3H6PA 3M9QA 2JHIF 2A45I 3R2PA 2J0YA 2N1TB 5APSA 1FZDA 2NPSC 1NTMK 1LWUB 2C9NY 2J61B 3RL0D 4AUWA 2WPSA 3OAKA 3HTKB 1WRGA 2XKMA 2JEEA 4GIFA 2KSJA 4RESB 4ZKUA 2XU6A 5AW8B 1HUCA 1SQVK 5AVUB 3H32B 3M9BA 2JHKF 1KFNA 1FAVA 3TNUB 1GD2E 1M1JA 1GL2A 2WT7B 1FOSF 1N7SD 5CCHD 5AW4B 5CCGA 1FZGC 1T8ZA 5AW3B 4N3YB 1SFCB 2J58A 4ZKPA 2H43A 1CZQA 1JTHA 2N1TD 5BVZA 5KJ7C 2OARA 1H8AA 1J1EB 3B5NA 2R32A 1HGVA 3HUSB 3C9IA 2FXMA 2HPCA 3KDPB 2R5DA 3RL0C 2HODB 1RE4C 1EQ7A 3HD7A 1IFMA 2XV5A 3T97A 4KHXA 2FIBA 2O01H 2P1JA 1FJPA 2Z4EA 1AQ5A 3M9HA 1N86C 2J3GA 2OYIB 2JHMF 2GUSA 3M0DA 3LIEA 3OJAB 2WNPF 5AVXB 2Q9IA 1N7SC 5AVZB 1IC2A 5BU5A 2WPRA 2ZFCA 1FZBB 3GHGA 1L4AB 1IFNA 1SFCD 1JO5A 2YKPA 2N1TC 3L37A 2C9LY 1FICA 4WY4A 1HH0A 3U1CA 1JUNA 1URQC 2M8RA 3VMYA 1FZAB 3LIDA 3OA7A 2GM4A 2O1JA 2E43A 3HRNA 2Q3IA 2CPSA 1RF0B 1GW4A 3EFGA 3V5BA 3VTPC 3MGNA 1NTZK 2JHHC 1M7LA 2R3CA 4C7NA 1RF1C 2IX7C 1G2CB 1CI6A 3HE5B 3SWYA 2CPBA 2NPSA 2J64A 3V2PA 1L4AD 1LTGC 1SFCC 1MZ9A 1N73B 4EPUA 3O8ZA 1J1EC 4EOTA 3A7OA 3KYQA 5AW2B 2J2PA 2KP8A 3RK2B 3BATA 2WPQA 4JF7A 2WSFH 1GK6A 1T3JA 3MTUE 1IO4A 1LT9B 3M0AA 1AFOA 1XTCC 1FJKA 2HLOC 1XTGB 2GY7A 1VPCA 3KPEA 3HE4B 3BVHB 1LTIC 2BASA 2Z5IA 1SQPK 1CSBA 1N7LA 1J1DC 3V2RA 2XZRA 1FZBC 1RE4A 2H7HA 2ZXEB 2J3FD 1LTBC 2HYNA 3P32A 1FIDA 2P67A 3MIWA 2P2UA 4W7ZA 4ZFGA 3N7NA 3CI9A 2J59M 2WZ7A 3RK2D 1N86A 5CJ4A 1FZAC 1GDTA 4N6JA 1N7SA 2YKOA 2IFNA 2N1TA 1GZLA 3CL3D 5KLVK 1LTJB 5AW6B 2FYUK 4N78D 1IFDA 1FZFC 2W6AA 1N73C 2OYHB 3RK3C 2VRSA 1URQA 2KYVA 5CHXA 2FFDC 3CLQA 1JY3P 3RK2C 5APUA 1T2KD 1QL2A 1RF1A 3A2AA 1LT9C 5AW1B 1RE3B 3TSIA 3TNUA 2XNXB 3UIAA 2I1KA 1CW5A 3L36A 1SFCA 2J3OA 1G1JA 1GU4A 1N2DC 4HH2A 3I5CA 5APXA 4WBAA 1HWTC 2QM8A 2P7JA 3LW5H 2H43B 1KFMA 3V4WA 1GTWA 4XE5B 1L0NK 2HPCB 1ZLLA 2M3BA 3B8EB 1FIBA 5AW0B 2HLOA 4DZOA 2W6BA 5CCHC 1NKNA 1Z3UA 3V2NA 3BRTB 3II6A 4N78E 4M7HA 1G1IA 1LWUC 1FZBA 3VN0A 3E1IB 1MUUA 1LTJC 3A5TA 3VMXA 5CCGD 1JCDA 1HGZA 2OYHC 1OXZA 1FZAA 3H32C 3NFQA 1FZCB 1LGHB 2D39A 2WITA 1NWQA 1MV8A 4LLHA 1L0LK 1JCCA 2WSEH 3N4XA 3BASA 1RE3C 2C0XA 2YO3A 2XNXC 2KB7P 3U1AA 1OWAA 4O9BA 3HUSC 3VOPA 1HJBA 1SQBK 1FZFA 1GW3A 1N73A 1IFIA 4I6MC 1X8YA 2HODC 2YNYA 1RY3A 1YTZT 5APTA 5AVQB 4EIJA 3A3YB 2FFDA 3TYYA 1WT6A 3VYIA 1S9KD 5APWA 2OYIC 1LT9A 1YTZI 2Q7CA 1JNMA 1A02J 2PP6A 2C0WA 3NXSA 3HE4A 1L4AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIB A;  1FZF C;  1N73 C;  2OYH B;  1FZG B;  2Z4E A;  1N86 C;  2FFD C;  2J3F A;  3E1I C;  2J3G A;  2OYI B;  1JY3 P;  1M1J C;  2JHM F;  1JC9 A;  1RF1 A;  2H43 C;  1RF0 C;  2WNP F;  2Q9I A;  4R9J A;  1RE4 B;  1LT9 C;  1FZB B;  3GHG A;  1RE3 B;  2HPC C;  2XNX B;  1FZF B;  1FZC C;  1T3U A;  2J3O A;  4R9T A;  1FIC A;  1FZE B;  1N86 B;  2FFD B;  1LWU A;  3BVH A;  1Z3S A;  2J61 A;  1FZA B;  2Z4E C;  2H43 B;  1RF0 B;  1LTJ A;  1JY3 O;  2JHH C;  4JYO X;  2OYH A;  2HPC B;  1RF1 C;  2Q9I C;  1FZG A;  3H32 A;  1FIB A;  2HLO A;  3GHG C;  2J60 A;  2J1G A;  2J64 A;  1W2E A;  2J3U A;  1Z3U A;  1N73 B;  2JHL F;  4EPU A;  4M7H A;  1LWU C;  3BVH C;  1RE3 A;  1FZB A;  2J0G A;  3E1I B;  2XNX A;  1JY2 P;  1M1J B;  1JY2 O;  2J0H A;  2J2P A;  3HUS A;  1RF1 B;  1LTJ C;  1FZE A;  2HOD A;  4JZC A;  2OYH C;  4NYT A;  2JHI F;  1LT9 B;  1FZA A;  2A45 I;  2J0Y A;  3H32 C;  2HLO C;  1FZC B;  2GY7 A;  1FZD A;  2D39 A;  1LWU B;  3BVH B;  2OYI A;  2J61 B;  2Z4E B;  1RE3 C;  1FZB C;  1RE4 A;  2XNX C;  2J3F D;  1JY3 N;  3HUS C;  4M7F A;  1FID A;  1FZF A;  1N73 A;  1FZE C;  3H32 B;  2HOD C;  2HLO B;  2A45 G;  2JHK F;  4ZFG A;  2Q9I B;  1N86 A;  2FFD A;  3E1I A;  3GHG B;  2J5Z A;  1M1J A;  1FZA C;  1FZG C;  2H43 A;  2A45 H;  2OYI C;  1RF0 A;  1LT9 A;  1JY2 N;  3HUS B;  2HPC A;  1FZC A;  2HOD B;  1RE4 C;  3FIB A;  1LTJ B; 
#chains in the Genus database with same CATH topology
 2KIK A;  3AED C;  2G3A A;  1KYO D;  2B88 A;  4Y99 B;  3E1I C;  5B66 H;  1OIP A;  5APV A;  1NAF A;  4MN4 C;  1VF5 D;  2YXQ B;  1FU1 A;  2FKW B;  2FY8 A;  1DH3 A;  1NOH A;  2W8Z A;  3TGU G;  1NGM B;  3HTK A;  2XDJ A;  1BSN A;  1KYO H;  1MFZ A;  1M8O B;  1JY3 O;  3B71 A;  1S9K E;  2P58 A;  1JOC A;  1SQV D;  5AVR B;  1Q7Y Q;  3FWL A;  2J3U A;  2ZXX A;  5CMZ A;  1PGJ A;  2JHL F;  5AVT B;  1JEK A;  2FBW C;  2XNX A;  5AW7 B;  2KOG A;  1JY2 P;  4U7J A;  2ZYD A;  1FDM A;  1SS1 A;  4K35 A;  3L75 D;  4RJT A;  1YJW P;  2HOD A;  3IAO A;  3B5N B;  2N9B A;  2KSE A;  1SQV G;  2HFE D;  3MUD A;  2ZVN B;  4BRY B;  1NKZ B;  3P8C E;  1T2K C;  1YJN P;  4DCK A;  1VQP P;  4UB6 E;  2Z4E B;  2BCC D;  3CCS P;  3L75 G;  1FZE C;  2HLO B;  2A45 G;  3H1H D;  1HTL C;  4M3L A;  3CC7 P;  3CX5 I;  5AVS B;  3B5N D;  1VQ9 P;  4ASV A;  1VQ4 P;  2AXC A;  2A45 H;  1LT1 A;  1RF0 A;  1DX7 A;  1SQX K;  2KS1 B;  4AQR D;  1NTK K;  1G2C A;  4HB1 A;  2PAJ A;  4K3A A;  1M1J C;  1CI6 B;  3A0B H;  1FBM A;  2WTY A;  1NTZ G;  1FZF B;  1S5L H;  4R9T A;  3HD7 C;  3L74 G;  2QJK C;  3BVH A;  4JYC A;  4B86 A;  1ZR2 A;  3VMZ A;  3P7K A;  4JYO X;  1LP1 B;  2I1J A;  5CBO A;  5APY A;  2QJP B;  1FE6 A;  3WUT A;  1IFJ A;  1W2E A;  3TF5 A;  4WY4 C;  2IYP A;  5DJU B;  1AQT A;  2JHI F;  3L73 D;  1OX3 A;  1LWU B;  2C9N Y;  1KTM A;  3L72 J;  2J61 B;  3L71 J;  3GMA A;  1WRG A;  2XKM A;  3CME P;  2KSJ A;  1HUC A;  1OVU A;  3KZI E;  3H32 B;  3M9B A;  2JHK F;  3E1R A;  1KFN A;  1PP9 G;  5KLV G;  4R4L A;  1VQM P;  3L72 E;  3D71 A;  1FDO A;  2WT7 B;  3L71 E;  4N3Y B;  4ZKP A;  2H43 A;  1CZQ A;  4U3F D;  5BVZ A;  5KJ7 C;  3B5N A;  3HUS B;  3KDP B;  2QIW A;  4GOE A;  3RL0 C;  1EQ7 A;  4BRY A;  2XV5 A;  3QWO C;  2FXO A;  4KHX A;  5H2F E;  2O01 J;  2KXP B;  2Z4E A;  1AQ5 A;  2OYI B;  1IFP A;  1EXI A;  2GUS A;  3M0D A;  3H1K D;  3CC4 P;  1N7S C;  1IC2 A;  1L4A B;  2YKP A;  4IL6 E;  2WQY C;  3U1C A;  2M8R A;  1FZA B;  2GM4 A;  3MGN A;  1M7L A;  2W6J H;  4D6T G;  1CI6 A;  4A7P A;  1L4A D;  1MZ9 A;  1N73 B;  1KOR A;  1S1C X;  1J1E C;  4EOT A;  3KYQ A;  2J2P A;  2ZT9 C;  3PH0 A;  3BAT A;  5DJT B;  2I8D A;  1GK6 A;  1OW6 A;  2WSF J;  1SQB G;  1XTG B;  1VPC A;  3KPE A;  1J1D C;  1S4X A;  2XZR A;  3AE8 C;  1RE4 A;  2H7H A;  3KHU A;  2J3F D;  1FID A;  1BCC J;  3C1L A;  1D7M A;  1N86 A;  4OWF A;  2KUB A;  1GDT A;  2OTJ P;  2QJY B;  1BCC E;  3WU2 E;  1GZL A;  3C8V A;  2W6A A;  1BE3 J;  4ZMD A;  2KYV A;  2FFD C;  1JY3 P;  2PRR A;  5APU A;  1RF1 A;  4WVZ A;  3A2A A;  3CWB G;  1RE3 B;  1BE3 E;  2I1K A;  3ITK A;  1ZW0 A;  1HWT C;  3LW5 H;  3CXH E;  2A06 E;  1NTM J;  2HPC B;  3H1L D;  2M3B A;  3A0H H;  1USE A;  5KAI E;  1NKN A;  2HR3 A;  1ZOY C;  1GMJ A;  3BRT B;  3G6E P;  4JBZ A;  1NTM E;  1MUU A;  5TIS E;  3S9O A;  3VMX A;  1QLE D;  1KB9 I;  1EDJ A;  5M1B A;  1FZA A;  3MZW B;  2D39 A;  2WIT A;  1YJ9 P;  2FYN C;  3AE4 C;  2WSE H;  1LJ2 A;  1DIP A;  2XNX C;  1SQX G;  3VOP A;  1N73 A;  1IFI A;  1NTK G;  1X8Y A;  1L0L G;  2HOD C;  2Y0C A;  1RY3 A;  3AEG C;  5AVQ B;  3A3Y B;  3MUD C;  3TYY A;  1WT6 A;  3VYI A;  1LNQ A;  1S9K D;  5APW A;  2KZI A;  2RN0 A;  2JWD A;  1OMI A;  1PL5 A;  5AW5 B;  4IL6 X;  2W27 A;  1AVO A;  1NH4 A;  1FZG B;  2WMM A;  1K05 A;  3VP8 A;  1VQ5 P;  2R5B A;  2E76 C;  1RF0 C;  2YO2 A;  3QH9 A;  1RHZ B;  4H0L C;  1K8A Q;  3P8C D;  4OH8 B;  1T3U A;  4L74 A;  1TU3 F;  2RH0 A;  3GG2 A;  3EQ2 A;  3TDK A;  2WSC J;  1NU1 J;  1PGP A;  1HVV A;  2E75 C;  4I1L A;  2NRG A;  1URQ B;  3USS A;  2IZ0 A;  4PV1 B;  3U59 A;  2OGU A;  3BVH C;  5AVY B;  1RE3 A;  2J0G A;  1NU1 E;  1GL2 B;  4UB6 H;  3BCC J;  2QE7 H;  2AEM A;  2H89 C;  3SWF A;  1H89 A;  3JCU E;  5KAF E;  4Y99 C;  4OVN F;  2IPP A;  4HYT B;  3AEF C;  5BU8 B;  3BCC E;  1JMM A;  4LC1 A;  1URQ D;  4PV1 D;  3Q5S A;  1X9V A;  3E7K A;  1JY3 N;  2Q3E A;  1GL2 D;  4RKU J;  3CCV P;  5KTB A;  1NO4 A;  1KQG B;  1ZR4 A;  2YXR B;  2WWW A;  1HBW A;  1KN7 A;  4I2L C;  4DOJ A;  1FS0 E;  3RL0 g;  2HG5 D;  2PFX A;  3FIB A;  1QX8 A;  2D2C B;  1PFI A;  4PD4 E;  1KIL E;  3WUV A;  2BEZ F;  3NTN A;  4UB8 E;  2N9Y B;  1FOS E;  1JC9 A;  2NPS B;  3L35 A;  2H43 C;  1SQQ G;  5E79 E;  2QM7 A;  3B5N C;  4KT0 J;  4AYC A;  3G4S P;  4IFD K;  1Z56 A;  1M1K Q;  3MD0 A;  2E74 B;  3AE6 C;  2D2C D;  3AE5 C;  4KJM A;  2Z4E C;  3G3Z A;  1GU5 A;  1BGY J;  2KLV A;  3M0D C;  3L72 D;  3D6Y A;  2NPS D;  1FZG A;  3CCL P;  3MHV A;  3L71 D;  3NMD A;  1NU1 K;  3PRJ A;  1FC2 C;  4C7R A;  1BGY E;  2JR8 A;  3I55 P;  1PGQ A;  1OW7 A;  3CMA P;  2E74 D;  4PD4 I;  3IR9 A;  3RGU A;  1X79 B;  3IFM A;  2O1K A;  3BRV B;  5AW9 B;  3L71 G;  2QEX P;  3KZI H;  1SQP J;  2N1T B;  1VQN P;  2KZJ A;  4H13 B;  2PGD A;  3OAK A;  2WPS A;  1EDK A;  4ASW A;  1Y8A A;  2JEE A;  2AEJ A;  4RES B;  4ZKU A;  1SQP E;  2K9J B;  4DT0 A;  3L70 J;  5H2F H;  1GL2 A;  1FOS F;  5CCH D;  5CCG A;  5AW3 B;  2IYO A;  3H1J J;  2N1T D;  1RQV A;  3Q2Y A;  3GF3 A;  1RE4 C;  4H13 D;  3L70 E;  3T97 A;  2O01 H;  1FJP A;  4IL6 H;  1N86 C;  3H1J E;  2J3G A;  2JHM F;  2WSS H;  3LIE A;  3Q3D A;  2WPR A;  1JO5 A;  1IFN A;  2WPV B;  2BCC G;  2RKL A;  2CK3 H;  1JUN A;  3H1H G;  1L0N J;  2R44 A;  3LID A;  3OA7 A;  2Q3I A;  2LXB A;  4ZNC A;  1RF1 C;  2IX7 C;  1M56 D;  1EZV E;  2RMZ A;  1QEX A;  3HE5 B;  2NPS A;  2J64 A;  1L0N E;  1M90 Q;  3IN6 A;  1BCC D;  1EC5 A;  1T6A A;  3CCQ P;  1KB9 D;  2WSF H;  4PJ0 E;  3MTU E;  1XTC C;  3F89 A;  1S72 P;  3SWK A;  2BAS A;  4TT3 H;  1BCC G;  1SQP K;  3MP7 B;  3O6Q B;  1BE3 D;  1S2E A;  4NPE A;  2ZXE B;  1LTB C;  2HYN A;  2L91 A;  4YPC A;  1P84 E;  3WU2 H;  2WZ7 A;  2B87 B;  3CXH D;  1MKM A;  1FZA C;  1KB9 H;  2ZVO B;  2A06 D;  3AE9 C;  1EZV I;  2IFN A;  2N1T A;  4YXD C;  3G71 P;  1LTJ B;  5AW6 B;  1FDI A;  1IFD A;  5L8R J;  1N73 C;  3RK3 C;  1NTM D;  2LR2 A;  1VQ6 P;  3CLQ A;  3L73 G;  4YXW H;  1DD4 A;  3CXH H;  1T2K D;  1QL2 A;  2K9J A;  3TGU J;  5AW1 B;  3AE1 C;  1CW5 A;  2J3O A;  4HH2 A;  5KAI H;  5APX A;  3TGU E;  1GTW A;  1L2P A;  3K5B A;  1P84 I;  1L0N K;  5TIS H;  4I7Z C;  4U3F G;  2OTL P;  2HLO A;  4DZO A;  2W6B A;  2QJK B;  1RH5 B;  2P10 A;  3V2N A;  1BDC A;  2QJY C;  4M7H A;  1G1I A;  3AEC C;  1OW8 A;  2KS1 A;  5B5E E;  2OTK E;  3H1K G;  4OGQ C;  3SSU A;  1FZC B;  1LGH B;  1DEE G;  3SFD C;  4QMA A;  1PPJ D;  4GDO A;  1VQK P;  3H1I J;  3BAS A;  1HF9 A;  1RE3 C;  4XFJ A;  1OWA A;  4O9B A;  1HJB A;  1FZF A;  3CCR P;  5APT A;  2W83 C;  2ZAE B;  3H1I E;  1PPJ G;  2Q7C A;  1LP1 A;  1A02 J;  2PP6 A;  3NXS A;  5KLI B;  3V2Q A;  3O6Q A;  1NTZ J;  1NU1 D;  5APQ A;  3L74 J;  3L4F A;  1OVR A;  4IFF A;  4IFM A;  3VP9 A;  2K1A A;  2ZYA A;  4WWI A;  2JJL A;  1NTZ E;  1QVG O;  3L74 E;  1NU1 G;  3BCC D;  4XA4 A;  1LWU A;  1KIL B;  2J61 A;  2IFM A;  5AVW B;  2WSC H;  1LTJ A;  1LTT C;  1H88 A;  4RO0 A;  3V6I A;  1PGO A;  5KJ7 D;  4BWN A;  3H32 A;  3JC2 2;  2J60 A;  1X22 A;  3JCU H;  5KAF H;  1VDF A;  2WT7 A;  1ZV8 A;  1JY2 O;  3R4Y A;  2J0H A;  3HUS A;  3PP5 A;  4GKG A;  4PD4 D;  1KIL D;  1EDI A;  4JZC A;  4NYT A;  3M91 A;  2MJZ A;  1PP9 J;  1MFT A;  5KLV J;  2OYI A;  3AEE C;  2IBZ E;  1L4A A;  4M7F A;  2Q1K A;  2GUV A;  3KQG A;  1PP9 E;  2Q9I B;  5KLV E;  1OVV A;  4PD4 H;  3GHG B;  2J5Z A;  3H1L G;  1J1D B;  4UB8 H;  3TK1 A;  1A02 F;  4EYY Q;  5E79 H;  1FZC A;  4L76 A;  2KK7 A;  1BGY D;  1LTA C;  2YMY A;  3AE7 C;  2J3F A;  2B89 A;  1GL2 C;  4H44 B;  5CCG C;  1Y47 A;  3CXH I;  2E42 A;  4DJG A;  2G8Y A;  2FFD B;  4D6T J;  2IBZ I;  1KQL A;  1SQP D;  2K37 A;  4H44 D;  4D6T E;  2J1G A;  2H8P D;  5KJ7 A;  2QA4 P;  1AVY A;  1SQB J;  2V4H A;  3OW2 O;  3L70 D;  1ZN5 A;  3V4Q A;  2D2C C;  1KIL A;  3H1J D;  3M9Q A;  1SQB E;  5APS A;  1FZD A;  2NPS C;  1NTM K;  3D70 A;  2IDB A;  4AUW A;  1VF5 C;  3HTK B;  2YIU B;  4Y28 J;  2JP3 A;  3PTZ A;  4GIF A;  5AVU B;  1VQ8 P;  1FAV A;  5EFW B;  1YQ3 C;  1RQU A;  4EDF A;  1YHQ P;  1SFC B;  3GW6 A;  4JQ0 D;  1H8A A;  2OAR A;  1EZV D;  2Y9Z A;  1Q81 Q;  1HGV A;  2FYU J;  3C9I A;  2HPC A;  3RK3 E;  2R5D A;  1L0N D;  2HOD B;  1IFM A;  1NJI Q;  3CWB J;  3CD6 P;  2M3E A;  1NVO A;  3M9H A;  5GTH E;  2ITA A;  3G9R A;  2FYU E;  3OJA B;  5AVX B;  2Q9I A;  5AVZ B;  2ZFC A;  3CWB E;  1FZB B;  3GHG A;  1SFC D;  1L0N G;  1ZRT E;  2N1T C;  1AV1 A;  3L37 A;  2C9L Y;  2XND H;  1FIC A;  3CPW O;  2BEQ D;  1AA0 A;  3CCJ P;  2DW3 A;  4H13 C;  2O1J A;  2E43 A;  2E76 B;  3HRN A;  1RF0 B;  1GW4 A;  1P84 D;  3EFG A;  3V5B A;  4H0L B;  2JHH C;  3S1K A;  1G2C B;  1H0T B;  4PJ0 H;  2E5Y A;  5C39 A;  3FWN A;  3SWY A;  2JWA A;  1NYH A;  2KI7 B;  1S3J A;  1VQL P;  3O8Z A;  3A7O A;  5AW2 B;  2KP8 A;  3RK2 B;  3AE3 C;  1T3J A;  2E76 D;  2E75 B;  4CPG A;  1LT9 B;  1IO4 A;  1SQX J;  1P84 H;  4H0L D;  1FJK A;  2HLO C;  1NTK J;  4TLF A;  1L0L J;  3W67 A;  3HE4 B;  3BVH B;  1CSB A;  4NPF X;  1VQ7 P;  1Q86 Q;  1NAY A;  1SQX E;  3P32 A;  2P67 A;  1DD3 A;  1Q90 D;  3MIW A;  1NTK E;  1L0L E;  2P2U A;  4W7Z A;  3N7N A;  3RK2 D;  1KMI Z;  2J59 M;  2O01 N;  3TGU D;  3CI9 A;  3L72 G;  5CJ4 A;  1ZP0 C;  2QRX A;  3D6Z A;  2E75 D;  1KV4 A;  2K9Y A;  2JO1 A;  4N6J A;  1R5L A;  2V7Q J;  3CL3 D;  3EFF K;  3FXD A;  2FYU K;  1FZF C;  2OYH B;  2VRS A;  1URQ A;  3CX5 E;  5K5G B;  3S4R A;  4HJG H;  1W5C E;  3TSI A;  4EI2 A;  3Q1M A;  1PV3 A;  5KKZ B;  3L36 A;  1SFC A;  1KQF B;  2QJP C;  3I5C A;  1U7M A;  4WBA A;  2QM8 A;  2P7J A;  1IZN B;  2H43 B;  3V4W A;  2LXC B;  1ZLL A;  3B8E B;  5B5E H;  3H1I D;  4N78 E;  1YBK A;  1UIX A;  3AE2 C;  1LWU C;  1FZB A;  3E1I B;  4L73 A;  3RBX A;  1LTJ C;  3A5T A;  1JCD A;  1HGZ A;  1X0T A;  1ZME C;  5GTI E;  1OXZ A;  3H1I G;  2GA1 A;  3H32 C;  3NFQ A;  1NWQ A;  1MV8 A;  4LLH A;  1L0L K;  1JCC A;  1NTZ D;  1Y9B A;  2MKV A;  3SFE C;  1H0T A;  3L74 D;  3HUS C;  4I6M C;  2YNY A;  1YTZ T;  4EIJ A;  3GF7 A;  1IK7 A;  2AXT E;  2M5A B;  2OYI C;  1LT9 A;  1JNM A;  1SQQ J;  3HE4 A;  1L4A C;  4W80 A;  2JKV A;  4C46 A;  1SQQ E;  1KZU B;  1PIX A;  1RE4 B;  3P8M C;  1WMK A;  1BE3 G;  5CCH A;  3RBZ A;  1K73 Q;  1FZC C;  1JB0 J;  2B9B A;  1FZE B;  1N86 B;  2IBZ D;  5B66 E;  2J5U A;  3ABV C;  2Q5U A;  2A06 G;  1E5W A;  1PP9 D;  2E5T A;  5KLV D;  2OYH A;  3JSV C;  2Y0E A;  3AEA C;  2IBZ G;  2JDI H;  1NTM G;  1QL1 A;  1IJD B;  1KYO E;  1M1J B;  1RF1 B;  1JMB A;  5KLI C;  1JTH B;  1Q82 Q;  2Z5H A;  2K3R A;  3HD7 B;  1U57 A;  1YIT P;  1SLQ A;  1UII A;  3KXD A;  4GT1 A;  1SQV J;  3ZDM A;  5TJH A;  1BSH A;  1NHL A;  1KIL C;  1SVF A;  3E1I A;  5AVV B;  1SQV E;  3L75 J;  3PLN A;  4WY4 B;  1K9M Q;  4JYB A;  1JY2 N;  4D6T D;  3HD7 D;  1IK9 A;  2LKM A;  1SP4 A;  3HE5 A;  4C7N B;  3L75 E;  4JPZ B;  1SQQ K;  2BCC J;  1GK4 A;  1KYO I;  1YQ4 C;  4LGD E;  5CJ0 A;  1LTS C;  5CBN A;  3H1H J;  4R9J A;  1SQB D;  4YTP C;  2HPC C;  4WY4 D;  1YI2 P;  3RK3 B;  2BCC E;  3FXE A;  2M5A A;  1DEB A;  2O3J A;  3W68 A;  4WB4 A;  1PZQ A;  1Z3S A;  3H1H E;  3A0B E;  1USD A;  3I56 P;  2KNC B;  2YKQ A;  2YMK A;  1OFC X;  1S5L E;  1M57 D;  2Q9I C;  1YYC A;  1EXJ A;  3GHG C;  3RL0 B;  2B87 A;  3VMA A;  2POH A;  3RK3 D;  4W7Y A;  3M06 A;  2L5G B;  4I7Z B;  3WMM 0;  3CC2 P;  1FZE A;  1J2J B;  2FYZ A;  1QVF O;  3FX0 A;  1N7S B;  3H6P A;  2A45 I;  3R2P A;  2J0Y A;  2FYU D;  2M0B A;  2WVR A;  4H44 C;  3CWB D;  3RL0 D;  3BCC G;  1ZRT D;  4NPD A;  2XU6 A;  5AW8 B;  1KB9 E;  1SQV K;  4OGQ B;  2FYU G;  3TNU B;  4Z1M H;  1GD2 E;  1M1J A;  3B4S A;  1N7S D;  5AW4 B;  1FZG C;  1T8Z A;  2J58 A;  5GTH H;  1JTH A;  1W2B O;  1J1E B;  2SPZ A;  3L73 J;  2R32 A;  1VQO P;  2FXM A;  2ZT9 B;  3HD7 A;  2FIB A;  2P1J A;  3IF4 A;  2AEF A;  1R5S A;  2H88 C;  4OGQ D;  3L73 E;  4R4M A;  2WNP F;  5BU5 A;  2Q6Q A;  4U3F J;  1R8E A;  4WY4 A;  1HH0 A;  3CCE P;  2ZT9 D;  2NZ2 A;  1VL2 A;  1URQ C;  1BDD A;  2YIU C;  4PV1 C;  3VMY A;  1SQX D;  1K04 A;  2CPS A;  1NTK D;  1L0L D;  3VTP C;  1NTZ K;  2R3C A;  4C7N A;  4U3F E;  1KD1 Q;  2IZ1 A;  2CPB A;  2Y9Y A;  3H1K J;  3V2P A;  1LTG C;  1SFC C;  1BGY G;  4EPU A;  3CCU P;  3PHL A;  2WPQ A;  4JF7 A;  1HJ0 A;  3CX5 D;  3H1K E;  3M0A A;  2QSI A;  1AFO A;  2GY7 A;  2KNC A;  1LTI C;  2Z5I A;  1N7L A;  4IOI H;  3V2R A;  1FZB C;  1SQP G;  4ZFG A;  2QVA A;  2K88 A;  3CX5 H;  1PPJ E;  1N7S A;  1KC8 Q;  2YKO A;  2QG4 A;  2V7Q H;  1U7J A;  3L70 G;  5KLV K;  4N78 D;  3H25 A;  4HKZ H;  5CHX A;  3H1J G;  2E74 C;  3RK2 C;  2FYN B;  1LT9 C;  3TNU A;  1S5L X;  1KQS O;  3PJS K;  2XNX B;  1OZH A;  3UIA A;  2R3S A;  1G1J A;  1GU4 A;  1N2D C;  1QGK B;  3FGA D;  2OYO A;  1KFM A;  3LW5 J;  4XE5 B;  1EDL A;  1EZV G;  1FIB A;  5AW0 B;  1JM0 A;  5CCH C;  3T97 B;  5GTI H;  4GOD A;  1Z3U A;  1AJY A;  3II6 A;  2FXP A;  3Q5R A;  3VN0 A;  1E79 H;  4L75 A;  3WUU A;  5CCG D;  3CCM P;  3A0H E;  1YIJ P;  2OYH C;  2OQQ A;  2KLU A;  1SQQ D;  2AXT H;  3GLM A;  3H1L J;  4BXL A;  3N4X A;  4GOF A;  2WSE J;  2C0X A;  2YO3 A;  1ZXG A;  3Q5P A;  3AEB C;  2KB7 P;  3U1A A;  5KKZ C;  1SQB K;  2W90 A;  1GW3 A;  1Q2N A;  2FFD A;  2ZJS E;  3H1L E;  3EWK A;  1VF5 B;  2Y0D A;  2ZYG A;  1YTZ I;  1N8R Q;  2UWJ E;  3F5H A;  2C0W A; 
#chains in the Genus database with same CATH homology
 3V2Q A;  5AW5 B;  4W80 A;  2W27 A;  1NH4 A;  1FZG B;  5APQ A;  4Y99 B;  3E1I C;  4C46 A;  3VP8 A;  3L4F A;  4IFF A;  4IFM A;  3VP9 A;  2R5B A;  5APV A;  1NAF A;  1RF0 C;  1KZU B;  1RE4 B;  2YO2 A;  3P8M C;  2JJL A;  5CCH A;  3P8C D;  1FZC C;  1FU1 A;  4OH8 B;  1T3U A;  2FKW B;  1FZE B;  1N86 B;  4XA4 A;  1DH3 A;  1LWU A;  1KIL B;  1NOH A;  2J61 A;  2IFM A;  5AVW B;  3HTK A;  2WSC H;  2XDJ A;  1LTJ A;  2Q5U A;  3EQ2 A;  1LTT C;  1MFZ A;  1E5W A;  1JY3 O;  1S9K E;  1H88 A;  2OYH A;  1HVV A;  5KJ7 D;  3H32 A;  2J60 A;  1JOC A;  5AVR B;  4I1L A;  1VDF A;  1URQ B;  2J3U A;  2WT7 A;  5CMZ A;  3U59 A;  2JHL F;  5AVT B;  1ZV8 A;  3BVH C;  5AVY B;  1RE3 A;  2J0G A;  1QL1 A;  1IJD B;  2XNX A;  2KOG A;  1JY2 P;  1M1J B;  1GL2 B;  1JY2 O;  5AW7 B;  2J0H A;  3HUS A;  1RF1 B;  3PP5 A;  4GKG A;  1KIL D;  1FDM A;  2HOD A;  1JTH B;  4JZC A;  4NYT A;  3B5N B;  2N9B A;  3SWF A;  2HFE D;  3MUD A;  3M91 A;  1H89 A;  2Z5H A;  4Y99 C;  2MJZ A;  2IPP A;  4HYT B;  3HD7 B;  1NKZ B;  3P8C E;  1T2K C;  2OYI A;  1SLQ A;  4GT1 A;  5BU8 B;  1JMM A;  4LC1 A;  2Z4E B;  1URQ D;  1X9V A;  1JY3 N;  1L4A A;  4M7F A;  1NHL A;  1FZE C;  1GL2 D;  2GUV A;  2A45 G;  3KQG A;  2HLO B;  2Q9I B;  5KTB A;  1KIL C;  1NO4 A;  1SVF A;  3E1I A;  3GHG B;  2J5Z A;  1HTL C;  4M3L A;  5AVV B;  1J1D B;  5AVS B;  1ZR4 A;  3B5N D;  3TK1 A;  2A45 H;  4WY4 B;  1RF0 A;  4JYB A;  1A02 F;  1DX7 A;  1SQX K;  2WWW A;  1JY2 N;  1HBW A;  3HD7 D;  4I2L C;  4DOJ A;  4AQR D;  1IK9 A;  1NTK K;  2LKM A;  1SP4 A;  1FZC A;  1G2C A;  2HG5 D;  3FIB A;  1PFI A;  2PAJ A;  1LTA C;  3HE5 A;  2YMY A;  4C7N B;  1SQQ K;  3NTN A;  1GK4 A;  4LGD E;  1FOS E;  2J3F A;  1M1J C;  1CI6 B;  1GL2 C;  5CJ0 A;  1JC9 A;  1LTS C;  2NPS B;  3L35 A;  5CCG C;  2H43 C;  4R9J A;  2QM7 A;  3B5N C;  1FBM A;  2WTY A;  4AYC A;  2HPC C;  4IFD K;  4WY4 D;  1FZF B;  3RK3 B;  2E42 A;  1Z56 A;  1DEB A;  3MD0 A;  3HD7 C;  4R9T A;  2FFD B;  4WB4 A;  3BVH A;  4JYC A;  1Z3S A;  4B86 A;  1KQL A;  1ZR2 A;  2Z4E C;  3G3Z A;  1GU5 A;  3VMZ A;  2KLV A;  2YKQ A;  3P7K A;  4JYO X;  3M0D C;  2I1J A;  2Q9I C;  2NPS D;  1FZG A;  1YYC A;  3NMD A;  3GHG C;  1NU1 K;  2J1G A;  3RL0 B;  2H8P D;  5KJ7 A;  5APY A;  1IFJ A;  1W2E A;  4C7R A;  4WY4 C;  2POH A;  3RK3 D;  4W7Y A;  3M06 A;  2L5G B;  3WMM 0;  1ZN5 A;  3V4Q A;  3IR9 A;  1FZE A;  1X79 B;  3IFM A;  1J2J B;  2FYZ A;  1N7S B;  2O1K A;  3BRV B;  1KIL A;  5AW9 B;  3H6P A;  3M9Q A;  2JHI F;  2A45 I;  3R2P A;  2J0Y A;  2N1T B;  5APS A;  1FZD A;  2NPS C;  1NTM K;  1LWU B;  2C9N Y;  2J61 B;  3RL0 D;  4AUW A;  2WPS A;  3OAK A;  3HTK B;  1WRG A;  2XKM A;  2JEE A;  4GIF A;  2KSJ A;  4RES B;  4ZKU A;  2XU6 A;  5AW8 B;  1HUC A;  1SQV K;  5AVU B;  3H32 B;  3M9B A;  2JHK F;  1KFN A;  1FAV A;  3TNU B;  1GD2 E;  1M1J A;  1GL2 A;  2WT7 B;  1FOS F;  1N7S D;  5CCH D;  5AW4 B;  5CCG A;  1FZG C;  1T8Z A;  5AW3 B;  4N3Y B;  1SFC B;  2J58 A;  4ZKP A;  2H43 A;  1CZQ A;  1JTH A;  2N1T D;  5BVZ A;  5KJ7 C;  2OAR A;  1H8A A;  1J1E B;  3B5N A;  2R32 A;  1HGV A;  3HUS B;  3C9I A;  2FXM A;  2HPC A;  3KDP B;  2R5D A;  3RL0 C;  2HOD B;  1RE4 C;  1EQ7 A;  3HD7 A;  1IFM A;  2XV5 A;  3T97 A;  4KHX A;  2FIB A;  2O01 H;  2P1J A;  1FJP A;  2Z4E A;  1AQ5 A;  3M9H A;  1N86 C;  2J3G A;  2OYI B;  2JHM F;  2GUS A;  3M0D A;  3LIE A;  3OJA B;  2WNP F;  5AVX B;  2Q9I A;  1N7S C;  5AVZ B;  1IC2 A;  5BU5 A;  2WPR A;  2ZFC A;  1FZB B;  3GHG A;  1L4A B;  1IFN A;  1SFC D;  1JO5 A;  2YKP A;  2N1T C;  3L37 A;  2C9L Y;  1FIC A;  4WY4 A;  1HH0 A;  3U1C A;  1JUN A;  1URQ C;  2M8R A;  3VMY A;  1FZA B;  3LID A;  3OA7 A;  2GM4 A;  2O1J A;  2E43 A;  3HRN A;  2Q3I A;  2CPS A;  1RF0 B;  1GW4 A;  3EFG A;  3V5B A;  3VTP C;  3MGN A;  1NTZ K;  2JHH C;  1M7L A;  2R3C A;  4C7N A;  1RF1 C;  2IX7 C;  1G2C B;  1CI6 A;  3HE5 B;  3SWY A;  2CPB A;  2NPS A;  2J64 A;  3V2P A;  1L4A D;  1LTG C;  1SFC C;  1MZ9 A;  1N73 B;  4EPU A;  3O8Z A;  1J1E C;  4EOT A;  3A7O A;  3KYQ A;  5AW2 B;  2J2P A;  2KP8 A;  3RK2 B;  3BAT A;  2WPQ A;  4JF7 A;  2WSF H;  1GK6 A;  1T3J A;  3MTU E;  1IO4 A;  1LT9 B;  3M0A A;  1AFO A;  1XTC C;  1FJK A;  2HLO C;  1XTG B;  2GY7 A;  1VPC A;  3KPE A;  3HE4 B;  3BVH B;  1LTI C;  2BAS A;  2Z5I A;  1SQP K;  1CSB A;  1N7L A;  1J1D C;  3V2R A;  2XZR A;  1FZB C;  1RE4 A;  2H7H A;  2ZXE B;  2J3F D;  1LTB C;  2HYN A;  3P32 A;  1FID A;  2P67 A;  3MIW A;  2P2U A;  4W7Z A;  4ZFG A;  3N7N A;  3CI9 A;  2J59 M;  2WZ7 A;  3RK2 D;  1N86 A;  5CJ4 A;  1FZA C;  1GDT A;  4N6J A;  1N7S A;  2YKO A;  2IFN A;  2N1T A;  1GZL A;  3CL3 D;  5KLV K;  1LTJ B;  5AW6 B;  2FYU K;  4N78 D;  1IFD A;  1FZF C;  2W6A A;  1N73 C;  2OYH B;  3RK3 C;  2VRS A;  1URQ A;  2KYV A;  5CHX A;  2FFD C;  3CLQ A;  1JY3 P;  3RK2 C;  5APU A;  1T2K D;  1QL2 A;  1RF1 A;  3A2A A;  1LT9 C;  5AW1 B;  1RE3 B;  3TSI A;  3TNU A;  2XNX B;  3UIA A;  2I1K A;  1CW5 A;  3L36 A;  1SFC A;  2J3O A;  1G1J A;  1GU4 A;  1N2D C;  4HH2 A;  3I5C A;  5APX A;  4WBA A;  1HWT C;  2QM8 A;  2P7J A;  3LW5 H;  2H43 B;  1KFM A;  3V4W A;  1GTW A;  4XE5 B;  1L0N K;  2HPC B;  1ZLL A;  2M3B A;  3B8E B;  1FIB A;  5AW0 B;  2HLO A;  4DZO A;  2W6B A;  5CCH C;  1NKN A;  1Z3U A;  3V2N A;  3BRT B;  3II6 A;  4N78 E;  4M7H A;  1G1I A;  1LWU C;  1FZB A;  3VN0 A;  3E1I B;  1MUU A;  1LTJ C;  3A5T A;  3VMX A;  5CCG D;  1JCD A;  1HGZ A;  2OYH C;  1OXZ A;  1FZA A;  3H32 C;  3NFQ A;  1FZC B;  1LGH B;  2D39 A;  2WIT A;  1NWQ A;  1MV8 A;  4LLH A;  1L0L K;  1JCC A;  2WSE H;  3N4X A;  3BAS A;  1RE3 C;  2C0X A;  2YO3 A;  2XNX C;  2KB7 P;  3U1A A;  1OWA A;  4O9B A;  3HUS C;  3VOP A;  1HJB A;  1SQB K;  1FZF A;  1GW3 A;  1N73 A;  1IFI A;  4I6M C;  1X8Y A;  2HOD C;  2YNY A;  1RY3 A;  1YTZ T;  5APT A;  5AVQ B;  4EIJ A;  3A3Y B;  2FFD A;  3TYY A;  1WT6 A;  3VYI A;  1S9K D;  5APW A;  2OYI C;  1LT9 A;  1YTZ I;  2Q7C A;  1JNM A;  1A02 J;  2PP6 A;  2C0W A;  3NXS A;  3HE4 A;  1L4A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...