1FIDA

Structure of human gamma fibrinogen 30 kd carboxyl terminal fragment
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
259
structure length
259
Chain Sequence
QIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood coagulation factor
molecule keywords GAMMA FIBRINOGEN
publication title Crystal structure of a 30 kDa C-terminal fragment from the gamma chain of human fibrinogen.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 1996-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fidA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fidA02
1N73B 1RF1C 1Z3UA 2OYIC 2D39A 1FZAC 2J5ZA 2H43B 2J0HA 1LWUB 3BVHC 1FZGC 3E1IC 2J1GA 2OYHB 4R9JA 2HPCC 3H32C 2WNPF 1LTJB 2XNXC 1FIDA 2JHIF 1FZCB 1N86B 1RF0B 2HODB 1FZFC 1RE3B 2J61A 1RE4B 1Z3SA 1LT9C 1FZDA 3HUSC 1JC9A 2GY7A 4ZFGA 2Z4EC 1RF1B 2JHKF 1FZEC 1N73C 2OYIB 4M7FA 2Q9IB 2J61B 1FZAB 2J2PA 2J3FA 1FZGB 3E1IB 2FIBA 2J60A 2JHHC 3H32B 2H43C 2J64A 2OYHC 4R9TA 3FIBA 2JHLF 2JHMF 3GHGC 1FZCC 2HLOC 1M1JC 1RF0C 2FFDC 2HODC 2J3FD 4NYTA 1FZBC 1RE3C 2Z4EB 2J3OA 2J0GA 4M7HA 2J3UA 2J0YA 1FZEB 2J3GA 3BVHB 2HPCB 1FIBA 4JYOX 1LWUC 2Q9IC 2XNXB 1FICA 1FZFB 1LTJC 4EPUA 1LT9B 1N86C 3HUSB 4JZCA 1RE4C 2HLOB 1M1JB 2FFDB 1FZBB
chains in the Genus database with same CATH superfamily
1N73B 1RF1C 1Z3UA 2OYIC 2D39A 1FZAC 2J5ZA 2H43B 2J0HA 1LWUB 3BVHC 1FZGC 3E1IC 2J1GA 2OYHB 4R9JA 2HPCC 3H32C 2WNPF 1LTJB 2XNXC 1FIDA 2JHIF 3GHGB 1FZCB 1N86B 1RF0B 2HODB 1FZFC 1RE3B 2J61A 1RE4B 1Z3SA 1LT9C 1FZDA 3HUSC 1JC9A 2GY7A 4ZFGA 2Z4EC 1RF1B 2JHKF 1FZEC 1N73C 2OYIB 4M7FA 2Q9IB 2J61B 1FZAB 2J2PA 2J3FA 1FZGB 3E1IB 2FIBA 2J60A 2JHHC 3H32B 2H43C 2J64A 2OYHC 4R9TA 3FIBA 2JHLF 2JHMF 3GHGC 1FZCC 2HLOC 1M1JC 1RF0C 2FFDC 2HODC 2J3FD 4NYTA 1FZBC 1RE3C 2Z4EB 2J3OA 2J0GA 4M7HA 2J3UA 2J0YA 1FZEB 2J3GA 3BVHB 2HPCB 1FIBA 4JYOX 1LWUC 2Q9IC 2XNXB 1FICA 1FZFB 1LTJC 4EPUA 1LT9B 1N86C 3HUSB 4JZCA 1RE4C 2HLOB 1M1JB 2FFDB 1FZBB
chains in the Genus database with same CATH topology
1N73B 1RF1C 1Z3UA 2OYIC 2D39A 1FZAC 2J5ZA 2H43B 2J0HA 1LWUB 3BVHC 1FZGC 3E1IC 2J1GA 2OYHB 4R9JA 2HPCC 3H32C 2WNPF 1LTJB 2XNXC 1FIDA 2JHIF 1FZCB 1N86B 1RF0B 2HODB 1FZFC 1RE3B 2J61A 1RE4B 1Z3SA 1LT9C 1FZDA 3HUSC 1JC9A 2GY7A 4ZFGA 2Z4EC 1RF1B 2JHKF 1FZEC 1N73C 2OYIB 4M7FA 2Q9IB 2J61B 1FZAB 2J2PA 2J3FA 1FZGB 3E1IB 2FIBA 2J60A 2JHHC 3H32B 2H43C 2J64A 2OYHC 4R9TA 3FIBA 2JHLF 2JHMF 3GHGC 1FZCC 2HLOC 1M1JC 1RF0C 2FFDC 2HODC 2J3FD 4NYTA 1FZBC 1RE3C 2Z4EB 2J3OA 2J0GA 4M7HA 2J3UA 2J0YA 1FZEB 2J3GA 3BVHB 2HPCB 1FIBA 4JYOX 1LWUC 2Q9IC 2XNXB 1FICA 1FZFB 1LTJC 4EPUA 1LT9B 1N86C 3HUSB 4JZCA 1RE4C 2HLOB 1M1JB 2FFDB 1FZBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 B;  1RF1 C;  1Z3U A;  2OYI C;  2D39 A;  1FZA C;  2J5Z A;  2H43 B;  2J0H A;  1LWU B;  3BVH C;  1FZG C;  3E1I C;  2J1G A;  2OYH B;  4R9J A;  2HPC C;  3H32 C;  2WNP F;  1LTJ B;  2XNX C;  1FID A;  2JHI F;  1FZC B;  1N86 B;  1RF0 B;  2HOD B;  1FZF C;  1RE3 B;  2J61 A;  1RE4 B;  1Z3S A;  1LT9 C;  1FZD A;  3HUS C;  1JC9 A;  2GY7 A;  4ZFG A;  2Z4E C;  1RF1 B;  2JHK F;  1FZE C;  1N73 C;  2OYI B;  4M7F A;  2Q9I B;  2J61 B;  1FZA B;  2J2P A;  2J3F A;  1FZG B;  3E1I B;  2FIB A;  2J60 A;  2JHH C;  3H32 B;  2H43 C;  2J64 A;  2OYH C;  4R9T A;  3FIB A;  2JHL F;  2JHM F;  3GHG C;  1FZC C;  2HLO C;  1M1J C;  1RF0 C;  2FFD C;  2HOD C;  2J3F D;  4NYT A;  1FZB C;  1RE3 C;  2Z4E B;  2J3O A;  2J0G A;  4M7H A;  2J3U A;  2J0Y A;  1FZE B;  2J3G A;  3BVH B;  2HPC B;  1FIB A;  4JYO X;  1LWU C;  2Q9I C;  2XNX B;  1FIC A;  1FZF B;  1LTJ C;  4EPU A;  1LT9 B;  1N86 C;  3HUS B;  4JZC A;  1RE4 C;  2HLO B;  1M1J B;  2FFD B;  1FZB B; 
#chains in the Genus database with same CATH topology
 1N73 B;  1RF1 C;  1Z3U A;  2OYI C;  2D39 A;  1FZA C;  2J5Z A;  2H43 B;  2J0H A;  1LWU B;  3BVH C;  1FZG C;  3E1I C;  2J1G A;  2OYH B;  4R9J A;  2HPC C;  3H32 C;  2WNP F;  1LTJ B;  2XNX C;  1FID A;  2JHI F;  3GHG B;  1FZC B;  1N86 B;  1RF0 B;  2HOD B;  1FZF C;  1RE3 B;  2J61 A;  1RE4 B;  1Z3S A;  1LT9 C;  1FZD A;  3HUS C;  1JC9 A;  2GY7 A;  4ZFG A;  2Z4E C;  1RF1 B;  2JHK F;  1FZE C;  1N73 C;  2OYI B;  4M7F A;  2Q9I B;  2J61 B;  1FZA B;  2J2P A;  2J3F A;  1FZG B;  3E1I B;  2FIB A;  2J60 A;  2JHH C;  3H32 B;  2H43 C;  2J64 A;  2OYH C;  4R9T A;  3FIB A;  2JHL F;  2JHM F;  3GHG C;  1FZC C;  2HLO C;  1M1J C;  1RF0 C;  2FFD C;  2HOD C;  2J3F D;  4NYT A;  1FZB C;  1RE3 C;  2Z4E B;  2J3O A;  2J0G A;  4M7H A;  2J3U A;  2J0Y A;  1FZE B;  2J3G A;  3BVH B;  2HPC B;  1FIB A;  4JYO X;  1LWU C;  2Q9I C;  2XNX B;  1FIC A;  1FZF B;  1LTJ C;  4EPU A;  1LT9 B;  1N86 C;  3HUS B;  4JZC A;  1RE4 C;  2HLO B;  1M1J B;  2FFD B;  1FZB B; 
#chains in the Genus database with same CATH homology
 1N73 B;  1RF1 C;  1Z3U A;  2OYI C;  2D39 A;  1FZA C;  2J5Z A;  2H43 B;  2J0H A;  1LWU B;  3BVH C;  1FZG C;  3E1I C;  2J1G A;  2OYH B;  4R9J A;  2HPC C;  3H32 C;  2WNP F;  1LTJ B;  2XNX C;  1FID A;  2JHI F;  1FZC B;  1N86 B;  1RF0 B;  2HOD B;  1FZF C;  1RE3 B;  2J61 A;  1RE4 B;  1Z3S A;  1LT9 C;  1FZD A;  3HUS C;  1JC9 A;  2GY7 A;  4ZFG A;  2Z4E C;  1RF1 B;  2JHK F;  1FZE C;  1N73 C;  2OYI B;  4M7F A;  2Q9I B;  2J61 B;  1FZA B;  2J2P A;  2J3F A;  1FZG B;  3E1I B;  2FIB A;  2J60 A;  2JHH C;  3H32 B;  2H43 C;  2J64 A;  2OYH C;  4R9T A;  3FIB A;  2JHL F;  2JHM F;  3GHG C;  1FZC C;  2HLO C;  1M1J C;  1RF0 C;  2FFD C;  2HOD C;  2J3F D;  4NYT A;  1FZB C;  1RE3 C;  2Z4E B;  2J3O A;  2J0G A;  4M7H A;  2J3U A;  2J0Y A;  1FZE B;  2J3G A;  3BVH B;  2HPC B;  1FIB A;  4JYO X;  1LWU C;  2Q9I C;  2XNX B;  1FIC A;  1FZF B;  1LTJ C;  4EPU A;  1LT9 B;  1N86 C;  3HUS B;  4JZC A;  1RE4 C;  2HLO B;  1M1J B;  2FFD B;  1FZB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...