4R9JA

L-ficolin complexed to glucosamine-6-sulfate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
217
structure length
217
Chain Sequence
PCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ficolin-2
publication title Human ficolin-2 recognition versatility extended: An update on the binding of ficolin-2 to sulfated/phosphated carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 72
structure length 217
sequence length 217
chains with identical sequence B, G
ec nomenclature
pdb deposition date 2014-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 4r9jA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 4r9jA02
1Z3UA 1FZBC 2J61B 3FIBA 2JHIF 4ZFGA 1RF0B 2Q9IB 1Z3SA 4R9TA 1FZBB 2XNXC 2J60A 3HUSC 2J2PA 1RF1C 2H43C 2J0HA 1LT9C 3HUSB 1RF1B 2JHKF 1FZAC 2H43B 4EPUA 1LT9B 2J3FD 2J64A 2J5ZA 4JZCA 1FZAB 1LTJC 2J61A 2OYHC 1N73C 1FIDA 1M1JC 2J3GA 2JHLF 1FZGC 1LTJB 2HODC 1FICA 2XNXB 2WNPF 2J3FA 2OYHB 1N73B 1RE3C 1M1JB 1FZGB 2J3UA 2HODB 3GHGC 2FIBA 2HPCC 3H32C 1LWUC 2JHHC 1RE3B 1FZCC 4JYOX 2FFDC 2OYIC 2HPCB 3H32B 3BVHC 4M7FA 1LWUB 1FIBA 1FZCB 4R9JA 1FZEC 2FFDB 2OYIB 1N86C 2HLOC 3BVHB 2GY7A 1RE4C 2D39A 4NYTA 1FZDA 1FZFC 1JC9A 1FZEB 2J1GA 2J3OA 1N86B 2HLOB 2JHMF 2Z4EC 4M7HA 3E1IC 1RE4B 1FZFB 2J0GA 2Z4EB 2J0YA 1RF0C 2Q9IC 3E1IB
chains in the Genus database with same CATH superfamily
1Z3UA 1FZBC 2J61B 3FIBA 2JHIF 4ZFGA 1RF0B 2Q9IB 1Z3SA 4R9TA 1FZBB 2XNXC 2J60A 3HUSC 2J2PA 1RF1C 2H43C 2J0HA 1LT9C 3HUSB 1RF1B 2JHKF 1FZAC 2H43B 4EPUA 1LT9B 2J3FD 2J64A 2J5ZA 4JZCA 1FZAB 1LTJC 2J61A 2OYHC 1N73C 1FIDA 1M1JC 2J3GA 2JHLF 1FZGC 1LTJB 2HODC 1FICA 2XNXB 2WNPF 2J3FA 2OYHB 1N73B 1RE3C 1M1JB 1FZGB 2J3UA 2HODB 3GHGC 2FIBA 2HPCC 3H32C 1LWUC 2JHHC 1RE3B 1FZCC 4JYOX 2FFDC 2OYIC 3GHGB 2HPCB 3H32B 3BVHC 4M7FA 1LWUB 1FIBA 1FZCB 4R9JA 1FZEC 2FFDB 2OYIB 1N86C 2HLOC 3BVHB 2GY7A 1RE4C 2D39A 4NYTA 1FZDA 1FZFC 1JC9A 1FZEB 2J1GA 2J3OA 1N86B 2HLOB 2JHMF 2Z4EC 4M7HA 3E1IC 1RE4B 1FZFB 2J0GA 2Z4EB 2J0YA 1RF0C 2Q9IC 3E1IB
chains in the Genus database with same CATH topology
1Z3UA 1FZBC 2J61B 3FIBA 2JHIF 4ZFGA 1RF0B 2Q9IB 1Z3SA 4R9TA 1FZBB 2XNXC 2J60A 3HUSC 2J2PA 1RF1C 2H43C 2J0HA 1LT9C 3HUSB 1RF1B 2JHKF 1FZAC 2H43B 4EPUA 1LT9B 2J3FD 2J64A 2J5ZA 4JZCA 1FZAB 1LTJC 2J61A 2OYHC 1N73C 1FIDA 1M1JC 2J3GA 2JHLF 1FZGC 1LTJB 2HODC 1FICA 2XNXB 2WNPF 2J3FA 2OYHB 1N73B 1RE3C 1M1JB 1FZGB 2J3UA 2HODB 3GHGC 2FIBA 2HPCC 3H32C 1LWUC 2JHHC 1RE3B 1FZCC 4JYOX 2FFDC 2OYIC 2HPCB 3H32B 3BVHC 4M7FA 1LWUB 1FIBA 1FZCB 4R9JA 1FZEC 2FFDB 2OYIB 1N86C 2HLOC 3BVHB 2GY7A 1RE4C 2D39A 4NYTA 1FZDA 1FZFC 1JC9A 1FZEB 2J1GA 2J3OA 1N86B 2HLOB 2JHMF 2Z4EC 4M7HA 3E1IC 1RE4B 1FZFB 2J0GA 2Z4EB 2J0YA 1RF0C 2Q9IC 3E1IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3U A;  1FZB C;  2J61 B;  3FIB A;  2JHI F;  4ZFG A;  1RF0 B;  2Q9I B;  1Z3S A;  4R9T A;  1FZB B;  2XNX C;  2J60 A;  3HUS C;  2J2P A;  1RF1 C;  2H43 C;  2J0H A;  1LT9 C;  3HUS B;  1RF1 B;  2JHK F;  1FZA C;  2H43 B;  4EPU A;  1LT9 B;  2J3F D;  2J64 A;  2J5Z A;  4JZC A;  1FZA B;  1LTJ C;  2J61 A;  2OYH C;  1N73 C;  1FID A;  1M1J C;  2J3G A;  2JHL F;  1FZG C;  1LTJ B;  2HOD C;  1FIC A;  2XNX B;  2WNP F;  2J3F A;  2OYH B;  1N73 B;  1RE3 C;  1M1J B;  1FZG B;  2J3U A;  2HOD B;  3GHG C;  2FIB A;  2HPC C;  3H32 C;  1LWU C;  2JHH C;  1RE3 B;  1FZC C;  4JYO X;  2FFD C;  2OYI C;  2HPC B;  3H32 B;  3BVH C;  4M7F A;  1LWU B;  1FIB A;  1FZC B;  4R9J A;  1FZE C;  2FFD B;  2OYI B;  1N86 C;  2HLO C;  3BVH B;  2GY7 A;  1RE4 C;  2D39 A;  4NYT A;  1FZD A;  1FZF C;  1JC9 A;  1FZE B;  2J1G A;  2J3O A;  1N86 B;  2HLO B;  2JHM F;  2Z4E C;  4M7H A;  3E1I C;  1RE4 B;  1FZF B;  2J0G A;  2Z4E B;  2J0Y A;  1RF0 C;  2Q9I C;  3E1I B; 
#chains in the Genus database with same CATH topology
 1Z3U A;  1FZB C;  2J61 B;  3FIB A;  2JHI F;  4ZFG A;  1RF0 B;  2Q9I B;  1Z3S A;  4R9T A;  1FZB B;  2XNX C;  2J60 A;  3HUS C;  2J2P A;  1RF1 C;  2H43 C;  2J0H A;  1LT9 C;  3HUS B;  1RF1 B;  2JHK F;  1FZA C;  2H43 B;  4EPU A;  1LT9 B;  2J3F D;  2J64 A;  2J5Z A;  4JZC A;  1FZA B;  1LTJ C;  2J61 A;  2OYH C;  1N73 C;  1FID A;  1M1J C;  2J3G A;  2JHL F;  1FZG C;  1LTJ B;  2HOD C;  1FIC A;  2XNX B;  2WNP F;  2J3F A;  2OYH B;  1N73 B;  1RE3 C;  1M1J B;  1FZG B;  2J3U A;  2HOD B;  3GHG C;  2FIB A;  2HPC C;  3H32 C;  1LWU C;  2JHH C;  1RE3 B;  1FZC C;  4JYO X;  2FFD C;  2OYI C;  3GHG B;  2HPC B;  3H32 B;  3BVH C;  4M7F A;  1LWU B;  1FIB A;  1FZC B;  4R9J A;  1FZE C;  2FFD B;  2OYI B;  1N86 C;  2HLO C;  3BVH B;  2GY7 A;  1RE4 C;  2D39 A;  4NYT A;  1FZD A;  1FZF C;  1JC9 A;  1FZE B;  2J1G A;  2J3O A;  1N86 B;  2HLO B;  2JHM F;  2Z4E C;  4M7H A;  3E1I C;  1RE4 B;  1FZF B;  2J0G A;  2Z4E B;  2J0Y A;  1RF0 C;  2Q9I C;  3E1I B; 
#chains in the Genus database with same CATH homology
 1Z3U A;  1FZB C;  2J61 B;  3FIB A;  2JHI F;  4ZFG A;  1RF0 B;  2Q9I B;  1Z3S A;  4R9T A;  1FZB B;  2XNX C;  2J60 A;  3HUS C;  2J2P A;  1RF1 C;  2H43 C;  2J0H A;  1LT9 C;  3HUS B;  1RF1 B;  2JHK F;  1FZA C;  2H43 B;  4EPU A;  1LT9 B;  2J3F D;  2J64 A;  2J5Z A;  4JZC A;  1FZA B;  1LTJ C;  2J61 A;  2OYH C;  1N73 C;  1FID A;  1M1J C;  2J3G A;  2JHL F;  1FZG C;  1LTJ B;  2HOD C;  1FIC A;  2XNX B;  2WNP F;  2J3F A;  2OYH B;  1N73 B;  1RE3 C;  1M1J B;  1FZG B;  2J3U A;  2HOD B;  3GHG C;  2FIB A;  2HPC C;  3H32 C;  1LWU C;  2JHH C;  1RE3 B;  1FZC C;  4JYO X;  2FFD C;  2OYI C;  2HPC B;  3H32 B;  3BVH C;  4M7F A;  1LWU B;  1FIB A;  1FZC B;  4R9J A;  1FZE C;  2FFD B;  2OYI B;  1N86 C;  2HLO C;  3BVH B;  2GY7 A;  1RE4 C;  2D39 A;  4NYT A;  1FZD A;  1FZF C;  1JC9 A;  1FZE B;  2J1G A;  2J3O A;  1N86 B;  2HLO B;  2JHM F;  2Z4E C;  4M7H A;  3E1I C;  1RE4 B;  1FZF B;  2J0G A;  2Z4E B;  2J0Y A;  1RF0 C;  2Q9I C;  3E1I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...