2FFDB

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
303
structure length
303
Chain Sequence
VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E Chain
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2ffdB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2ffdB03
2J61A 4M7FA 2J0YA 2JHLF 2OYHA 1M1JA 3HUSA 1LTJC 1RF1B 2HPCA 1Z3UA 4JYOX 1FZCC 3E1IA 1FZGB 2XNXA 4R9JA 1FZEB 2WNPF 3E1IC 2H43A 2JHMF 4M7HA 2H43C 1RE3A 1N73B 1JC9A 2OYIA 1RF0B 3FIBA 1FZFC 2Z4EB 4NYTA 1FZBA 3H32C 1LT9B 1LTJB 2J5ZA 2J3OA 1W2EA 1FZAC 1RF1A 2HLOA 2HODB 2FFDA 2J3GA 2J0GA 2OYHC 1M1JC 3HUSC 2Q9IA 1LWUB 2JHKF 1FZGA 2J3UA 2JHHC 2HPCC 2J0HA 1RE4B 3BVHA 2XNXC 1N73A 1FIDA 1N86B 3GHGB 2Z4EA 2D39A 1LT9A 1RE3C 2J3FA 1JY3N 2OYIC 1FZDA 2A45I 2A45G 1FZBC 2OYHB 2HODA 2J2PA 1JY2N 1FZCB 1LWUA 2HPCB 1RF1C 2HLOC 2JHIF 2FFDC 1RE4A 3E1IB 2J3FD 2Q9IC 1JY3P 1FZEA 2GY7A 4R9TA 1T3UA 1FZGC 2H43B 4JZCA 1N86A 4EPUA 3GHGA 1FZFB 1RF0A 1JY2P 3H32B 2FIBA 4ZFGA 3BVHC 1N73C 2J1GA 1FZBB 2J64A 2Z4EC 1LTJA 1FICA 1FZAB 1LT9C 2J61B 2HLOB 1FZCA 1M1JB 3HUSB 2FFDB 2HODC 1FIBA 1Z3SA 2Q9IB 1LWUC 2J60A 2A45H 2XNXB 1JY3O 1RE4C 1FZFA 3BVHB 3H32A 1FZEC 1RE3B 2OYIB 1JY2O 1N86C 3GHGC 1FZAA 1RF0C
chains in the Genus database with same CATH superfamily
1MUUA 2QJKC 1GL2B 1M1JA 1LTJC 1L4AB 1FZCC 1AJYA 3HE4B 1NU1E 1TU3F 1RY3A 4KT0J 3CI9A 3IFMA 2JKVA 3L74D 2OTLP 1Q90D 1ZR4A 5APVA 1BSNA 2WSSH 1NU1D 2N1TB 1YJNP 3BATA 1KB9I 4Y28J 4UB8E 1SQXK 4GKGA 2GA1A 2M3EA 4OVNF 2FBWC 1AQ5A 3M9BA 1JCDA 4DOJA 2J0HA 1RE4B 1FU1A 1LNQA 3JCUH 1SQPG 2ZYGA 1NTMG 5KLIB 1IFDA 1JTHB 3Q2YA 2YIUB 1S5LE 1NTZG 5M1BA 1SQQG 2KIKA 5CCHA 2H43B 3AE1C 1AA0A 2Z5HA 2FXMA 2ZAEB 1JY2P 2QEXP 1U7MA 3VMXA 1OVUA 1K04A 3G3ZA 1T6AA 1DD4A 1RH5B 4PJ0H 3TDKA 2GUSA 4UB8H 4C7NA 2R3SA 3AE8C 4U3FG 3EWKA 1CSBA 4WY4A 3G9RA 2QJPB 3BVHB 2K37A 1SVFA 2RKLA 1RF0C 2QRXA 2E5TA 1ZR2A 3L75J 1FZGB 2KZJA 4NPDA 1FZEB 2QG4A 1KILA 1S5LH 4L73A 3L72G 5APXA 1PP9J 1JEKA 1FC2C 3LW5H 1PPJD 2LXBA 3GF7A 1VF5D 2YMYA 2FYUE 1M7LA 3QWOC 1N73A 1KB9D 1S1CX 3GHGB 1LT9A 2FYUD 1JNMA 1BCCG 4I7ZB 3PRJA 1N7SD 3VMYA 4I2LC 4PD4I 1IC2A 3CWBG 2YMKA 3E1IB 2J3FD 3MIWA 3V4QA 3CXHI 2BCCG 1VF5B 1L0NG 5L8RJ 2JDIH 3W68A 1FDOA 1HUCA 1YHQP 5AVUB 1VQ6P 3BASA 3M0AA 1S9KE 3KXDA 1L4AC 2E42A 2J60A 1NGMB 3G4SP 2QJYC 2ZVOB 1N7SB 1S9KD 1GK4A 1PGQA 1HTLC 3L35A 5AW7B 2W27A 1BGYJ 2NPSA 2B87B 3M06A 3C1LA 1VDFA 3HD7A 2Y0CA 3AE2C 3FIBA 1IK7A 3JSVC 1YJWP 1PP9E 5AW3B 1KC8Q 1YTZI 3AE3C 1VQ7P 1RF1A 5KLIC 2WSFH 4W7ZA 2J0GA 3L71G 1W2BO 2Q9IA 2JHKF 2VRSA 1T2KD 5TISE 1PP9D 2KUBA 1ZOYC 4DCKA 1SQVJ 3WUUA 2W6AA 5GTIE 2OYHB 3S9OA 1L0LG 2DW3A 4OH8B 1DD3A 2AEMA 2IPPA 4TT3H 1J1EC 1DEEG 4PD4E 2Q6QA 2GY7A 3GG2A 4JZCA 1SQQE 1FZFB 2KNCB 2QJPC 2AEJA 4ZFGA 4XA4A 3BVHC 5AVVB 1N7LA 4PD4D 5C39A 3TNUB 2KZIA 1SQQD 2JWAA 2HLOB 1T8ZA 5AVTB 2A45H 3L4FA 3VMZA 3H1HE 5TISH 1FZEC 1Z56A 1SQBJ 2CPBA 2OYIB 5AW5B 3H1HD 2KS1A 2PRRA 1OW8A 2LR2A 2N9YB 5AW2B 3RL0D 1BGYE 5GTIH 1KTMA 2PFXA 2HPCA 1XTCC 1DH3A 3USSA 2E76B 2KLUA 4R9JA 3KZIE 1KV4A 4PV1C 1BGYD 1A02F 3AE6C 2LKMA 4PD4H 4XE5B 4C7RA 5KTBA 5AVWB 3H25A 1X0TA 1NU1G 4WB4A 1OFCX 3AE4C 3B4SA 2WT7B 1OXZA 4L76A 3RL0B 1SQPK 2ZYAA 4IL6E 1VQLP 1S4XA 2IZ0A 1OW6A 2IFNA 2YXQB 1NTMK 2E74C 1OVRA 1FZCB 2JR8A 1URQD 2Q5UA 2HFED 2JJLA 3CWBE 3H1KG 1NTZK 3RK3E 3KZIH 2KB7P 1LTAC 2BCCE 3CWBD 4HH2A 2J61B 2QIWA 3RK3D 1SQXJ 3I56P 5EFWB 2BCCD 1ZMEC 1L0ND 2L5GB 1M8OB 3M0DA 2Q3EA 2Y9YA 4DT0A 4WBAA 2O3JA 1SQBE 3H32A 3CMEP 3ITKA 1GU4A 4GOEA 1Q7YQ 1KFMA 1SQBD 2WPQA 4O9BA 1SFCC 4IL6H 4BRYA 4HJGH 3P8CE 3AECC 1USDA 3GW6A 4AUWA 4LLHA 4IL6X 3RK3B 3SWKA 2O1JA 5AW4B 3FGAD 3CCUP 1JUNA 3P8CD 3CCEP 2J5ZA 3WUVA 1AVOA 3OAKA 3CCJP 2QSIA 2J3GA 2OYHC 3MZWB 3NTNA 3MHVA 1HH0A 5KJ7D 3D70A 1NWQA 4N3YB 1VQPP 1FOSF 2HYNA 1T2KC 3FXDA 4RJTA 2P7JA 2HLOC 3MUDC 3A0BE 1OVVA 1JY3P 1T3UA 4LC1A 2KOGA 1L0LD 5APSA 3M9HA 3O6QB 2FFDB 2HODC 1KD1Q 5AVYB 1LWUC 2E75D 2Y9ZA 3P7KA 3EFGA 4H0LC 1Q86Q 1JY2O 5GTHH 2V4HA 1LTTC 2W6BA 2R3CA 2O1KA 3CC7P 1QVGO 3VP9A 2XNXA 1IFJA 1PFIA 2GUVA 4Z1MH 4C46A 3A0BH 2H88C 1VQOP 3KDPB 3L75G 2E75B 2XZRA 3CCQP 3AEBC 1KQSO 1GDTA 2QJYB 3PP5A 1YITP 1PGJA 1NKZB 3B5NA 4L74A 3PHLA 2E5YA 1PP9G 2N1TA 2K88A 1LP1B 4PJ0E 2A45G 3PJSK 3PTZA 1IFIA 4BWNA 4Y99C 1JCCA 4OGQC 3A0HE 1K73Q 2WITA 1RE4A 3Q5PA 3TGUJ 4YXDC 1LGHB 1VL2A 3HE5A 3H1KE 5E79E 1EDJA 4CPGA 1URQC 5CCHD 3TYYA 1JTHA 3H1KD 3V4WA 3EFFK 1KYOE 1MFTA 2W6JH 1N2DC 1H88A 1OZHA 3RK3C 1KYOD 1M1KQ 2KSJA 3H1IJ 1GW3A 1FDMA 2O01H 2J0YA 3S1KA 5AVRB 1J1EB 1PZQA 4LGDE 1NAYA 5KKZB 2WPSA 3W67A 3H1HG 3H1JJ 2YXRB 4A7PA 3MGNA 2E43A 3VN0A 1KORA 3A0HH 2PAJA 4M7HA 1KILE 2YKOA 1YBKA 2KSEA 3M9QA 4PV1D 1NOHA 2XDJA 3OJAB 1FZAC 1BGYG 5E79H 1KILD 2RMZA 3T97B 1EXIA 3RL0g 3HUSC 1RHZB 3AE5C 3RBXA 5APTA 3PH0A 1FZGA 2XNDH 1FOSE 4OWFA 1NU1K 1Q2NA 1E5WA 1KYOH 2JO1A 2R5BA 1RE3C 4JPZB 2A45I 3H6PA 3H1LJ 5KJ7C 1PV3A 1FBMA 2FFDC 3SSUA 1FS0E 1SQVG 4PV1B 1BE3J 1SLQA 1HVVA 2E74D 3LIEA 2K9JA 3U59A 3GHGA 2IBZE 4I6MC 2Z4EC 1S3JA 2FY8A 2YKQA 2IBZD 3SFEC 1M57D 2PP6A 1OX3A 3F5HA 1G2CA 2IYPA 2D2CD 5AW9B 5AW6B 5KAFE 3L37A 3H1IE 1D7MA 1N86C 1IZNB 5AVZB 1FJPA 2E74B 3AEGC 2IYOA 4YXWH 2E75C 4R4MA 2M5AB 4IFDK 2CPSA 1IK9A 1H0TA 1SQBG 1N7SA 1YQ4C 1SFCD 3AEEC 1NTZJ 4YTPC 2OTKE 1VPCA 1FZBA 3WMM0 2NPSD 2A06E 2D2CB 4GOFA 2KK7A 3L75E 3HD7D 4AYCA 1M1JC 4ZNCA 4QMAA 1KFNA 2A06D 3C8VA 3L75D 3CC4P 1Y9BA 1H89A 5KAFH 1EXJA 1SFCB 4EOTA 1NTKJ 2AXCA 1BE3E 3L70J 2XV5A 2NPSB 1Q82Q 1GK6A 1ZP0C 2L91A 3KQGA 2FYUK 3RBZA 3HD7B 1NKNA 1BE3D 5KAIE 2WSEJ 3L72J 1G1JA 1NVOA 3Q1MA 1NYHA 2Q9IB 2K9YA 5CCGA 2WQYC 5KKZC 1FZFA 2LXCB 1GTWA 5AVXB 1G1IA 5CCHC 2H7HA 1DX7A 1IO4A 1SQXG 3U1AA 1VQKP 4U7JA 5APQA 4H0LD 2HR3A 1NH4A 3RK2C 1IFNA 4WY4C 2OYIA 1J2JB 3I55P 4NPEA 2OGUA 5CBNA 1PGPA 2HODB 5KAIH 5KLVJ 4HYTB 1LWUB 2PGDA 1AV1A 1IJDB 4RESB 1LTSC 5CJ4A 5TJHA 3BCCJ 3IR9A 4H0LB 1HJBA 1KILC 2MKVA 2B88A 1AVYA 1CI6B 1NHLA 1NTKE 1JY2N 3L70E 4MN4C 2HPCB 2HG5D 1HGVA 5CBOA 2BEZF 2WT7A 1JB0J 1NTKD 1SQVE 4N78E 4OGQD 2W83C 3GMAA 5CHXA 1ZLLA 3ZDMA 1N73C 1PL5A 1LTJA 1FICA 1SQVD 1LT9C 4N78D 1OMIA 1FZCA 1U7JA 5B66E 3VMAA 2QM8A 2C0XA 4EDFA 1FIBA 4IFMA 3NFQA 3E7KA 1BSHA 1JY3O 1SQQK 1XTGB 1VQ9P 4JYCA 1SS1A 2J61A 4ZMDA 2D2CC 4Y99B 4OGQB 3CCLP 1J1DC 4K35A 2KP8A 1FE6A 2QA4P 1FDIA 1EDLA 1MZ9A 3HRNA 1ZN5A 3CPWO 2J5UA 3SWFA 1KMIZ 1URQB 1EZVE 5KLVE 2R32A 1A02J 3AE9C 3BCCE 5B66H 2WPRA 4YPCA 2NPSC 5KLVD 2B89A 3K5BA 3HD7C 3HTKB 3L73J 4W7YA 1FZDA 3L36A 1HBWA 4JF7A 3I5CA 3MP7B 1K05A 3KPEA 5B5EE 1X8YA 1RF1C 4BRYB 1QEXA 1ZV8A 1WMKA 2Q9IC 1WRGA 4R9TA 3VTPC 1JM0A 4H44D 4H13C 1RF0A 3LIDA 5GTHE 2ZT9D 2W8ZA 1FZAB 1ZW0A 3HUSB 3MD0A 2AEFA 2ZYDA 3TGUG 1Z3SA 3L74J 1P84I 3B71A 1T3JA 2BASA 3TF5A 2P2UA 2IBZG 3G71P 1RE3B 1QX8A 4D6TJ 3O6QA 1L0NK 1SQXE 4HKZH 4H44B 2G3AA 1KYOI 1EQ7A 2ZT9B 1UIXA 5AW0B 3ABVC 1IFMA 1SQXD 5B5EH 1LTGC 2FKWB 3H1IG 4IFFA 1HF9A 1SQBK 2SPZA 3CX5E 3O8ZA 2Z4EB 4NYTA 2OTJP 2J3OA 1EDIA 3FX0A 3A5TA 3CX5D 3H1JG 3WUTA 1E79H 3AEAC 2HPCC 4R4LA 4EIJA 3L73E 1N86B 2A06G 1BDCA 2QM7A 1GW4A 1KN7A 1GL2A 3OA7A 3B5ND 3L73D 1L4AA 2N9BA 3HE4A 1NJIQ 2N1TD 1GD2E 2FXPA 2ZJSE 1HJ0A 5CJ0A 1HGZA 2J1GA 1LP1A 3H1LG 4BXLA 1BDDA 2C9LY 3CX5H 2RH0A 1M1JB 1BE3G 2WSCJ 3L74E 1DIPA 1L0LK 1MV8A 2IBZI 1P84E 3A2AA 2IDBA 3V2NA 3B5NB 2P58A 4D6TE 1VQMP 1IFPA 1P84D 3RGUA 3TSIA 3FWLA 1Z3UA 4RKUJ 4D6TD 4JYOX 4GODA 2H89C 2FYUJ 2ZXXA 2H43A 3CC2P 3RK2D 2M3BA 3M0DC 3HE5B 1KQGB 2J59M 1QL2A 1LJ2A 3S4RA 3H32C 1KZUB 1OIPA 2W90A 4WY4D 2R44A 5BVZA 1OWAA 2QVAA 2MJZA 3BVHA 1JMBA 3BRVB 3C9IA 2POHA 3G6EP 1P84H 2WSFJ 4DZOA 2YO2A 1YI2P 1AFOA 2V7QJ 3CL3D 3RK2B 5DJUB 3T97A 1X9VA 4TLFA 4K3AA 1U57A 3CCRP 3VOPA 4C7NB 1FZEA 4WY4B 2KI7B 3D71A 4M3LA 2R5DA 1NTKG 3FXEA 1LT1A 3IF4A 3L70G 3GF3A 4H44C 4GIFA 2ZT9C 3TGUE 3CMAP 1R5SA 1KILB 1PPJE 2Q1KA 2P1JA 3TGUD 4I1LA 3VYIA 1EDKA 2FYNC 2Y0DA 1S5LX 3NXSA 4M7FA 4XFJA 1PGOA 4GDOA 1KB9E 1S2EA 1LTBC 1JMMA 3E1IA 1FJKA 2K9JB 3V2QA 1N73B 1JC9A 3MTUE 4UB6E 3R4YA 1OW7A 3IN6A 4N6JA 1LT9B 1SQPJ 1RQVA 1CZQA 3D6ZA 5BU8B 2I1KA 1W2EA 1NTMJ 4AQRD 1YYCA 2M5AA 4RO0A 3H1ID 2H8PD 3U1CA 2WSCH 2ZXEB 1G2CB 2FXOA 3H1JE 2JP3A 2Q7CA 3A3YB 2XU6A 2XNXC 1SQQJ 1EZVG 3H1JD 2J3FA 1JY3N 5KLVG 3GLMA 3P8MC 1J1DB 1X22A 1GL2C 2P10A 3BCCG 2B87A 1H0TB 1HWTC 3V2RA 5BU5A 3M91A 1KB9H 2KXPB 1GZLA 1Y8AA 1SP4A 4U3FJ 3H1HJ 2YO3A 2Q3IA 3B5NC 2KLVA 1FZBB 2BEQD 4NPFX 2WTYA 1SFCA 3N7NA 3VP8A 3H1LE 4UB6H 2N1TC 4H13D 3Q3DA 2RN0A 3H1LD 1JOCA 2Z5IA 3AEFC 1RE4C 2M8RA 3Q5SA 1MFZA 1YQ3C 2WPVB 2CK3H 4JYBA 3UIAA 2NRGA 1M90Q 5CCGD 2OYHA 1CW5A 2V7QH 1RF1B 1ZRTE 1EC5A 1GMJA 2YIUC 3QH9A 1KQFB 4H13B 1Y47A 3B8EB 2H43C 2KNCA 2FYZA 1ZRTD 3P32A 1SQPE 3CCMP 1NTME 3TNUA 2HLOA 3MUDA 1BCCJ 1SQPD 2IZ1A 3TK1A 1YJ9P 1X79B 2JHHC 1NTMD 4HB1A 4EI2A 1NTZE 3CWBJ 1FIDA 3EQ2A 2D39A 1EZVI 2E76D 3CXHE 2BCCJ 1NTZD 1L0NJ 2HODA 2J2PA 1L2PA 1KQLA 1LWUA 2J58A 2AXTE 1QLED 2JHIF 3CXHD 1R5LA 1M56D 1K8AQ 1NO4A 1FZGC 4U3FE 3FWNA 3L73G 5APUA 4EPUA 1VQ4P 2K3RA 4ASWA 3D6YA 4U3FD 1CI6A 5APYA 3AE7C 2JWDA 2KS1B 2IFMA 3OW2O 1NAFA 5DJTB 3SWYA 5K5GB 4WVZA 1VQ8P 3L70D 1WT6A 2WVRA 3V6IA 3L72E 3GHGC 1S72P 5CMZA 2C9NY 2JHLF 3AEDC 3L74G 1RQUA 4I7ZC 3CXHH 3L72D 1PIXA 2ZVNB 3L71J 1AQTA 3E1IC 2AXTH 1W5CE 4D6TG 4KHXA 2QJKB 4L75A 1VF5C 3CCSP 1LTJB 4WWIA 5AW1B 3Q5RA 1BCCE 5AVQB 2GM4A 1YTZT 2M0BA 4B86A 2J3UA 1L0LJ 2C0WA 1BCCD 3R2PA 2YNYA 3CX5I 5AW8B 3WU2E 1ZXGA 1N7SC 1FAVA 1URQA 2O01N 1L0NE 1FZBC 2WSEH 5AVSB 1QVFO 3E1RA 4ASVA 1EZVD 3IAOA 1QGKB 2I1JA 1USEA 3SFDC 3H32B 3HTKA 2FIBA 4DJGA 2NZ2A 1VQNP 3CLQA 1Q81Q 3BCCD 3CD6P 2ZFCA 2YKPA 3PLNA 2I8DA 2WZ7A 1JO5A 4EYYQ 1NTKK 2JEEA 4IOIH 2P67A 3KHUA 1SQVK 2OQQA 4KJMA 2B9BA 1FZAA 3N4XA 3KYQA 3A7OA 3WU2H 3V5BA 3HUSA 4ZKPA 1QL1A 1GU5A 3V2PA 3F89A 3L71E 1DEBA 3NMDA 2WNPF 1NU1J 1PPJG 3CCVP 5CCGC 2JHMF 1RE3A 1RF0B 2O01J 3L71D 4GT1A 1FZFC 2XKMA 2WMMA 5KJ7A 5H2FE 1YIJP 2FFDA 1UIIA 1L0LE 3BRTB 2FYUG 2OYOA 4ZKUA 1R8EA 1K9MQ 2OARA 2G8YA 4W80A 2Z4EA 2FYNB 2WWWA 3H1KJ 2OYIC 1H8AA 2QE7H 1MKMA 5KLVK 3JC22 2E76C 1GL2D 3II6A 1N86A 1L4AD 4JBZA 2J64A 1VQ5P 2KYVA 3LW5J 2K1AA 3JCUE 5H2FH 4JQ0D 2Y0EA 5APWA 2XNXB 2IX7C 2ITAA 2UWJE 3RL0C 1N8RQ 1LTIC
chains in the Genus database with same CATH topology
1MUUA 3U1AA 3NXSA 4M7FA 1GL2B 1KFMA 1M1JA 2WPQA 4O9BA 1LTJC 5APQA 1SFCC 1L4AB 1NH4A 3RK2C 1LTBC 1JMMA 1FZCC 3E1IA 3P8CE 3HE4B 1RY3A 1FJKA 3CI9A 4AUWA 1IFNA 3IFMA 4LLHA 3RK3B 3V2QA 2O1JA 1N73B 4WY4C 2OYIA 3MTUE 5AW4B 1JC9A 1ZR4A 5APVA 1JUNA 1J2JB 3P8CD 4N6JA 1LT9B 1CZQA 2N1TB 2J5ZA 3BATA 5BU8B 2I1KA 3OAKA 1W2EA 4AQRD 1SQXK 2HODB 1YYCA 4GKGA 2J3GA 2OYHC 4HYTB 1LWUB 1AQ5A 3M9BA 2H8PD 3U1CA 1IJDB 2WSCH 2ZXEB 4RESB 1JCDA 3NTNA 1G2CB 1HH0A 1LTSC 4DOJA 5CJ4A 2J0HA 1RE4B 1FU1A 5KJ7D 2Q7CA 3A3YB 2XU6A 2XNXC 3IR9A 1HJBA 1KILC 1NWQA 4N3YB 2J3FA 1JY3N 1FOSF 2HYNA 1T2KC 1CI6B 1NHLA 1GU4A 3P8MC 1J1DB 1IFDA 1JY2N 1JTHB 1GL2C 2HPCB 2P7JA 2HLOC 2HG5D 1HGVA 1HWTC 3V2RA 5BU5A 1JY3P 3M91A 2WT7A 1T3UA 5CCHA 1GZLA 2H43B 4LC1A 1SP4A 4N78E 2YO3A 2KOGA 2Z5HA 2FXMA 1JY2P 2Q3IA 5CHXA 1ZLLA 3B5NC 2KLVA 1N73C 3VMXA 1FZBB 5APSA 1LTJA 1FICA 3M9HA 2WTYA 1SFCA 3G3ZA 3N7NA 3VP8A 1LT9C 4N78D 2N1TC 1FZCA 2FFDB 2GUSA 2QM8A 2C0XA 2HODC 1FIBA 5AVYB 4IFMA 4C7NA 1LWUC 3NFQA 1JOCA 2Z5IA 1CSBA 4WY4A 1JY3O 1RE4C 3P7KA 2M8RA 3BVHB 1SVFA 1MFZA 3EFGA 1SQQK 1JY2O 1XTGB 4JYCA 1RF0C 4JYBA 3UIAA 2J61A 5CCGD 1LTTC 2OYHA 1ZR2A 1CW5A 2W6BA 4Y99B 1RF1B 2R3CA 1J1DC 2O1KA 2KP8A 3VP9A 1FZGB 2XNXA 1MZ9A 1IFJA 1PFIA 1FZEB 2GUVA 1ZN5A 3HRNA 1KILA 4C46A 3B8EB 2H43C 3SWFA 2FYZA 3P32A 5APXA 3KDPB 1URQB 2XZRA 3TNUA 2HLOA 2R32A 3MUDA 3LW5H 1A02J 3TK1A 2YMYA 1GDTA 1X79B 2JHHC 3PP5A 1M7LA 2WPRA 2NPSC 1NKZB 3B5NA 1N73A 1FIDA 3EQ2A 3GHGB 3HD7C 2D39A 3HTKB 1LT9A 4W7YA 2N1TA 1JNMA 1FZDA 3L36A 2A45G 2HODA 2J2PA 1HBWA 4JF7A 3I5CA 1N7SD 3VMYA 1IFIA 1KQLA 3KPEA 1LWUA 4I2LC 2J58A 4Y99C 1IC2A 1JCCA 1X8YA 1RF1C 2JHIF 1ZV8A 2WITA 1RE4A 3E1IB 2J3FD 3MIWA 1NO4A 2Q9IC 1WRGA 4R9TA 1FZGC 3VTPC 3V4QA 1LGHB 3HE5A 5APUA 4EPUA 1RF0A 3LIDA 1FZAB 1CI6A 5APYA 1URQC 5CCHD 1HUCA 3TYYA 1JTHA 3HUSB 3MD0A 5AVUB 2IFMA 3BASA 3M0AA 3V4WA 1Z3SA 1S9KE 1L4AC 1NAFA 2E42A 2J60A 1T3JA 2BASA 3SWYA 2P2UA 1N7SB 1N2DC 1WT6A 1S9KD 1H88A 1RE3B 3RK3C 1GK4A 3GHGC 2KSJA 1GW3A 1HTLC 3L35A 2O01H 5CMZA 1FDMA 2C9NY 5AW7B 1L0NK 2J0YA 2JHLF 5AVRB 1J1EB 1EQ7A 2W27A 4LGDE 2NPSA 5AW0B 1IFMA 2WPSA 3M06A 1VDFA 3E1IC 3HD7A 3MGNA 2E43A 1LTGC 2FKWB 3VN0A 2PAJA 4IFFA 4M7HA 2YKOA 1SQBK 4KHXA 3FIBA 3O8ZA 2Z4EB 4NYTA 3M9QA 1LTJB 1NOHA 5AW3B 2J3OA 1YTZI 2XDJA 3OJAB 5AW1B 1FZAC 1RF1A 1KILD 2WSFH 4W7ZA 5AVQB 2GM4A 1YTZT 3A5TA 2J0GA 3HUSC 2Q9IA 2JHKF 4B86A 2VRSA 5APTA 1FZGA 2J3UA 1T2KD 1FOSE 2C0WA 2HPCC 1NU1K 3R2PA 2YNYA 4EIJA 5AW8B 1E5WA 1N86B 1N7SC 1FAVA 2R5BA 2W6AA 1RE3C 1URQA 2A45I 2QM7A 1GW4A 1FZBC 3H6PA 1GL2A 3OA7A 2OYHB 2WSEH 3B5ND 1L4AA 5KJ7C 5AVSB 4OH8B 2IPPA 1FBMA 2N9BA 2FFDC 1J1EC 3HE4A 2N1TD 1SLQA 1HVVA 2GY7A 3LIEA 1GD2E 2I1JA 4JZCA 5CJ0A 3U59A 3GHGA 1FZFB 4I6MC 3H32B 1HGZA 3HTKA 2FIBA 4XA4A 4ZFGA 3BVHC 5AVVB 2J1GA 3CLQA 1N7LA 2Z4EC 2ZFCA 2YKPA 3TNUB 2WZ7A 2YKQA 1JO5A 2C9LY 2HLOB 1M1JB 1NTKK 1T8ZA 2PP6A 2JEEA 5AVTB 1L0LK 1MV8A 1G2CA 2A45H 3L4FA 3VMZA 5AW9B 3A2AA 2P67A 3V2NA 5AW6B 3B5NB 1SQVK 1FZEC 1Z56A 3L37A 2CPBA 2OYIB 1N86C 1FZAA 5AVZB 1FJPA 3N4XA 3KYQA 3A7OA 5AW5B 3V5BA 3HUSA 3TSIA 4ZKPA 5AW2B 3RL0D 1QL1A 1GU5A 2HPCA 1Z3UA 4IFDK 4JYOX 3V2PA 1XTCC 1DH3A 2CPSA 1IK9A 4R9JA 1DEBA 3NMDA 2WNPF 1N7SA 2H43A 1SFCD 5CCGC 2M3BA 3M0DC 3RK2D 1A02F 3HE5B 2JHMF 1RE3A 2J59M 2LKMA 1QL2A 1RF0B 1VPCA 4GT1A 1FZFC 4XE5B 1FZBA 3WMM0 3H32C 2XKMA 1KZUB 2NPSD 4C7RA 5KJ7A 5KTBA 5AVWB 3HD7D 4WY4D 2FFDA 5BVZA 4AYCA 3BRTB 1M1JC 4ZKUA 1OWAA 1KFNA 4WB4A 2MJZA 2WT7B 1OXZA 3BVHA 3RL0B 3BRVB 2OARA 3C9IA 4W80A 2POHA 2Z4EA 1H89A 2WWWA 1SQPK 4DZOA 2YO2A 2OYIC 1AFOA 2IFNA 1H8AA 1SFCB 1NTMK 4EOTA 3CL3D 3RK2B 3T97A 5KLVK 1FZCB 1X9VA 2XV5A 2NPSB 3VOPA 1GK6A 1URQD 2Q5UA 2HFED 2JJLA 4C7NB 1FZEA 3KQGA 2FYUK 3HD7B 1GL2D 3II6A 4WY4B 1N86A 1NTZK 1NKNA 1L4AD 2KB7P 4M3LA 2J64A 1LTAC 4HH2A 2R5DA 2KYVA 1G1JA 2J61B 3RK3D 4GIFA 2Q9IB 2L5GB 5CCGA 3M0DA 5APWA 2XNXB 2IX7C 4WBAA 1FZFA 1KILB 1GTWA 5AVXB 3H32A 1G1IA 5CCHC 3RL0C 1LTIC 2H7HA 1DX7A 1IO4A 2P1JA 4I1LA 3VYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J61 A;  4M7F A;  2J0Y A;  2JHL F;  2OYH A;  1M1J A;  3HUS A;  1LTJ C;  1RF1 B;  2HPC A;  1Z3U A;  4JYO X;  1FZC C;  3E1I A;  1FZG B;  2XNX A;  4R9J A;  1FZE B;  2WNP F;  3E1I C;  2H43 A;  2JHM F;  4M7H A;  2H43 C;  1RE3 A;  1N73 B;  1JC9 A;  2OYI A;  1RF0 B;  3FIB A;  1FZF C;  2Z4E B;  4NYT A;  1FZB A;  3H32 C;  1LT9 B;  1LTJ B;  2J5Z A;  2J3O A;  1W2E A;  1FZA C;  1RF1 A;  2HLO A;  2HOD B;  2FFD A;  2J3G A;  2J0G A;  2OYH C;  1M1J C;  3HUS C;  2Q9I A;  1LWU B;  2JHK F;  1FZG A;  2J3U A;  2JHH C;  2HPC C;  2J0H A;  1RE4 B;  3BVH A;  2XNX C;  1N73 A;  1FID A;  1N86 B;  3GHG B;  2Z4E A;  2D39 A;  1LT9 A;  1RE3 C;  2J3F A;  1JY3 N;  2OYI C;  1FZD A;  2A45 I;  2A45 G;  1FZB C;  2OYH B;  2HOD A;  2J2P A;  1JY2 N;  1FZC B;  1LWU A;  2HPC B;  1RF1 C;  2HLO C;  2JHI F;  2FFD C;  1RE4 A;  3E1I B;  2J3F D;  2Q9I C;  1JY3 P;  1FZE A;  2GY7 A;  4R9T A;  1T3U A;  1FZG C;  2H43 B;  4JZC A;  1N86 A;  4EPU A;  3GHG A;  1FZF B;  1RF0 A;  1JY2 P;  3H32 B;  2FIB A;  4ZFG A;  3BVH C;  1N73 C;  2J1G A;  1FZB B;  2J64 A;  2Z4E C;  1LTJ A;  1FIC A;  1FZA B;  1LT9 C;  2J61 B;  2HLO B;  1FZC A;  1M1J B;  3HUS B;  2FFD B;  2HOD C;  1FIB A;  1Z3S A;  2Q9I B;  1LWU C;  2J60 A;  2A45 H;  2XNX B;  1JY3 O;  1RE4 C;  1FZF A;  3BVH B;  3H32 A;  1FZE C;  1RE3 B;  2OYI B;  1JY2 O;  1N86 C;  3GHG C;  1FZA A;  1RF0 C; 
#chains in the Genus database with same CATH topology
 1MUU A;  2QJK C;  1GL2 B;  1M1J A;  1LTJ C;  1L4A B;  1FZC C;  1AJY A;  3HE4 B;  1NU1 E;  1TU3 F;  1RY3 A;  4KT0 J;  3CI9 A;  3IFM A;  2JKV A;  3L74 D;  2OTL P;  1Q90 D;  1ZR4 A;  5APV A;  1BSN A;  2WSS H;  1NU1 D;  2N1T B;  1YJN P;  3BAT A;  1KB9 I;  4Y28 J;  4UB8 E;  1SQX K;  4GKG A;  2GA1 A;  2M3E A;  4OVN F;  2FBW C;  1AQ5 A;  3M9B A;  1JCD A;  4DOJ A;  2J0H A;  1RE4 B;  1FU1 A;  1LNQ A;  3JCU H;  1SQP G;  2ZYG A;  1NTM G;  5KLI B;  1IFD A;  1JTH B;  3Q2Y A;  2YIU B;  1S5L E;  1NTZ G;  5M1B A;  1SQQ G;  2KIK A;  5CCH A;  2H43 B;  3AE1 C;  1AA0 A;  2Z5H A;  2FXM A;  2ZAE B;  1JY2 P;  2QEX P;  1U7M A;  3VMX A;  1OVU A;  1K04 A;  3G3Z A;  1T6A A;  1DD4 A;  1RH5 B;  4PJ0 H;  3TDK A;  2GUS A;  4UB8 H;  4C7N A;  2R3S A;  3AE8 C;  4U3F G;  3EWK A;  1CSB A;  4WY4 A;  3G9R A;  2QJP B;  3BVH B;  2K37 A;  1SVF A;  2RKL A;  1RF0 C;  2QRX A;  2E5T A;  1ZR2 A;  3L75 J;  1FZG B;  2KZJ A;  4NPD A;  1FZE B;  2QG4 A;  1KIL A;  1S5L H;  4L73 A;  3L72 G;  5APX A;  1PP9 J;  1JEK A;  1FC2 C;  3LW5 H;  1PPJ D;  2LXB A;  3GF7 A;  1VF5 D;  2YMY A;  2FYU E;  1M7L A;  3QWO C;  1N73 A;  1KB9 D;  1S1C X;  3GHG B;  1LT9 A;  2FYU D;  1JNM A;  1BCC G;  4I7Z B;  3PRJ A;  1N7S D;  3VMY A;  4I2L C;  4PD4 I;  1IC2 A;  3CWB G;  2YMK A;  3E1I B;  2J3F D;  3MIW A;  3V4Q A;  3CXH I;  2BCC G;  1VF5 B;  1L0N G;  5L8R J;  2JDI H;  3W68 A;  1FDO A;  1HUC A;  1YHQ P;  5AVU B;  1VQ6 P;  3BAS A;  3M0A A;  1S9K E;  3KXD A;  1L4A C;  2E42 A;  2J60 A;  1NGM B;  3G4S P;  2QJY C;  2ZVO B;  1N7S B;  1S9K D;  1GK4 A;  1PGQ A;  1HTL C;  3L35 A;  5AW7 B;  2W27 A;  1BGY J;  2NPS A;  2B87 B;  3M06 A;  3C1L A;  1VDF A;  3HD7 A;  2Y0C A;  3AE2 C;  3FIB A;  1IK7 A;  3JSV C;  1YJW P;  1PP9 E;  5AW3 B;  1KC8 Q;  1YTZ I;  3AE3 C;  1VQ7 P;  1RF1 A;  5KLI C;  2WSF H;  4W7Z A;  2J0G A;  3L71 G;  1W2B O;  2Q9I A;  2JHK F;  2VRS A;  1T2K D;  5TIS E;  1PP9 D;  2KUB A;  1ZOY C;  4DCK A;  1SQV J;  3WUU A;  2W6A A;  5GTI E;  2OYH B;  3S9O A;  1L0L G;  2DW3 A;  4OH8 B;  1DD3 A;  2AEM A;  2IPP A;  4TT3 H;  1J1E C;  1DEE G;  4PD4 E;  2Q6Q A;  2GY7 A;  3GG2 A;  4JZC A;  1SQQ E;  1FZF B;  2KNC B;  2QJP C;  2AEJ A;  4ZFG A;  4XA4 A;  3BVH C;  5AVV B;  1N7L A;  4PD4 D;  5C39 A;  3TNU B;  2KZI A;  1SQQ D;  2JWA A;  2HLO B;  1T8Z A;  5AVT B;  2A45 H;  3L4F A;  3VMZ A;  3H1H E;  5TIS H;  1FZE C;  1Z56 A;  1SQB J;  2CPB A;  2OYI B;  5AW5 B;  3H1H D;  2KS1 A;  2PRR A;  1OW8 A;  2LR2 A;  2N9Y B;  5AW2 B;  3RL0 D;  1BGY E;  5GTI H;  1KTM A;  2PFX A;  2HPC A;  1XTC C;  1DH3 A;  3USS A;  2E76 B;  2KLU A;  4R9J A;  3KZI E;  1KV4 A;  4PV1 C;  1BGY D;  1A02 F;  3AE6 C;  2LKM A;  4PD4 H;  4XE5 B;  4C7R A;  5KTB A;  5AVW B;  3H25 A;  1X0T A;  1NU1 G;  4WB4 A;  1OFC X;  3AE4 C;  3B4S A;  2WT7 B;  1OXZ A;  4L76 A;  3RL0 B;  1SQP K;  2ZYA A;  4IL6 E;  1VQL P;  1S4X A;  2IZ0 A;  1OW6 A;  2IFN A;  2YXQ B;  1NTM K;  2E74 C;  1OVR A;  1FZC B;  2JR8 A;  1URQ D;  2Q5U A;  2HFE D;  2JJL A;  3CWB E;  3H1K G;  1NTZ K;  3RK3 E;  3KZI H;  2KB7 P;  1LTA C;  2BCC E;  3CWB D;  4HH2 A;  2J61 B;  2QIW A;  3RK3 D;  1SQX J;  3I56 P;  5EFW B;  2BCC D;  1ZME C;  1L0N D;  2L5G B;  1M8O B;  3M0D A;  2Q3E A;  2Y9Y A;  4DT0 A;  4WBA A;  2O3J A;  1SQB E;  3H32 A;  3CME P;  3ITK A;  1GU4 A;  4GOE A;  1Q7Y Q;  1KFM A;  1SQB D;  2WPQ A;  4O9B A;  1SFC C;  4IL6 H;  4BRY A;  4HJG H;  3P8C E;  3AEC C;  1USD A;  3GW6 A;  4AUW A;  4LLH A;  4IL6 X;  3RK3 B;  3SWK A;  2O1J A;  5AW4 B;  3FGA D;  3CCU P;  1JUN A;  3P8C D;  3CCE P;  2J5Z A;  3WUV A;  1AVO A;  3OAK A;  3CCJ P;  2QSI A;  2J3G A;  2OYH C;  3MZW B;  3NTN A;  3MHV A;  1HH0 A;  5KJ7 D;  3D70 A;  1NWQ A;  4N3Y B;  1VQP P;  1FOS F;  2HYN A;  1T2K C;  3FXD A;  4RJT A;  2P7J A;  2HLO C;  3MUD C;  3A0B E;  1OVV A;  1JY3 P;  1T3U A;  4LC1 A;  2KOG A;  1L0L D;  5APS A;  3M9H A;  3O6Q B;  2FFD B;  2HOD C;  1KD1 Q;  5AVY B;  1LWU C;  2E75 D;  2Y9Z A;  3P7K A;  3EFG A;  4H0L C;  1Q86 Q;  1JY2 O;  5GTH H;  2V4H A;  1LTT C;  2W6B A;  2R3C A;  2O1K A;  3CC7 P;  1QVG O;  3VP9 A;  2XNX A;  1IFJ A;  1PFI A;  2GUV A;  4Z1M H;  4C46 A;  3A0B H;  2H88 C;  1VQO P;  3KDP B;  3L75 G;  2E75 B;  2XZR A;  3CCQ P;  3AEB C;  1KQS O;  1GDT A;  2QJY B;  3PP5 A;  1YIT P;  1PGJ A;  1NKZ B;  3B5N A;  4L74 A;  3PHL A;  2E5Y A;  1PP9 G;  2N1T A;  2K88 A;  1LP1 B;  4PJ0 E;  2A45 G;  3PJS K;  3PTZ A;  1IFI A;  4BWN A;  4Y99 C;  1JCC A;  4OGQ C;  3A0H E;  1K73 Q;  2WIT A;  1RE4 A;  3Q5P A;  3TGU J;  4YXD C;  1LGH B;  1VL2 A;  3HE5 A;  3H1K E;  5E79 E;  1EDJ A;  4CPG A;  1URQ C;  5CCH D;  3TYY A;  1JTH A;  3H1K D;  3V4W A;  3EFF K;  1KYO E;  1MFT A;  2W6J H;  1N2D C;  1H88 A;  1OZH A;  3RK3 C;  1KYO D;  1M1K Q;  2KSJ A;  3H1I J;  1GW3 A;  1FDM A;  2O01 H;  2J0Y A;  3S1K A;  5AVR B;  1J1E B;  1PZQ A;  4LGD E;  1NAY A;  5KKZ B;  2WPS A;  3W67 A;  3H1H G;  3H1J J;  2YXR B;  4A7P A;  3MGN A;  2E43 A;  3VN0 A;  1KOR A;  3A0H H;  2PAJ A;  4M7H A;  1KIL E;  2YKO A;  1YBK A;  2KSE A;  3M9Q A;  4PV1 D;  1NOH A;  2XDJ A;  3OJA B;  1FZA C;  1BGY G;  5E79 H;  1KIL D;  2RMZ A;  3T97 B;  1EXI A;  3RL0 g;  3HUS C;  1RHZ B;  3AE5 C;  3RBX A;  5APT A;  3PH0 A;  1FZG A;  2XND H;  1FOS E;  4OWF A;  1NU1 K;  1Q2N A;  1E5W A;  1KYO H;  2JO1 A;  2R5B A;  1RE3 C;  4JPZ B;  2A45 I;  3H6P A;  3H1L J;  5KJ7 C;  1PV3 A;  1FBM A;  2FFD C;  3SSU A;  1FS0 E;  1SQV G;  4PV1 B;  1BE3 J;  1SLQ A;  1HVV A;  2E74 D;  3LIE A;  2K9J A;  3U59 A;  3GHG A;  2IBZ E;  4I6M C;  2Z4E C;  1S3J A;  2FY8 A;  2YKQ A;  2IBZ D;  3SFE C;  1M57 D;  2PP6 A;  1OX3 A;  3F5H A;  1G2C A;  2IYP A;  2D2C D;  5AW9 B;  5AW6 B;  5KAF E;  3L37 A;  3H1I E;  1D7M A;  1N86 C;  1IZN B;  5AVZ B;  1FJP A;  2E74 B;  3AEG C;  2IYO A;  4YXW H;  2E75 C;  4R4M A;  2M5A B;  4IFD K;  2CPS A;  1IK9 A;  1H0T A;  1SQB G;  1N7S A;  1YQ4 C;  1SFC D;  3AEE C;  1NTZ J;  4YTP C;  2OTK E;  1VPC A;  1FZB A;  3WMM 0;  2NPS D;  2A06 E;  2D2C B;  4GOF A;  2KK7 A;  3L75 E;  3HD7 D;  4AYC A;  1M1J C;  4ZNC A;  4QMA A;  1KFN A;  2A06 D;  3C8V A;  3L75 D;  3CC4 P;  1Y9B A;  1H89 A;  5KAF H;  1EXJ A;  1SFC B;  4EOT A;  1NTK J;  2AXC A;  1BE3 E;  3L70 J;  2XV5 A;  2NPS B;  1Q82 Q;  1GK6 A;  1ZP0 C;  2L91 A;  3KQG A;  2FYU K;  3RBZ A;  3HD7 B;  1NKN A;  1BE3 D;  5KAI E;  2WSE J;  3L72 J;  1G1J A;  1NVO A;  3Q1M A;  1NYH A;  2Q9I B;  2K9Y A;  5CCG A;  2WQY C;  5KKZ C;  1FZF A;  2LXC B;  1GTW A;  5AVX B;  1G1I A;  5CCH C;  2H7H A;  1DX7 A;  1IO4 A;  1SQX G;  3U1A A;  1VQK P;  4U7J A;  5APQ A;  4H0L D;  2HR3 A;  1NH4 A;  3RK2 C;  1IFN A;  4WY4 C;  2OYI A;  1J2J B;  3I55 P;  4NPE A;  2OGU A;  5CBN A;  1PGP A;  2HOD B;  5KAI H;  5KLV J;  4HYT B;  1LWU B;  2PGD A;  1AV1 A;  1IJD B;  4RES B;  1LTS C;  5CJ4 A;  5TJH A;  3BCC J;  3IR9 A;  4H0L B;  1HJB A;  1KIL C;  2MKV A;  2B88 A;  1AVY A;  1CI6 B;  1NHL A;  1NTK E;  1JY2 N;  3L70 E;  4MN4 C;  2HPC B;  2HG5 D;  1HGV A;  5CBO A;  2BEZ F;  2WT7 A;  1JB0 J;  1NTK D;  1SQV E;  4N78 E;  4OGQ D;  2W83 C;  3GMA A;  5CHX A;  1ZLL A;  3ZDM A;  1N73 C;  1PL5 A;  1LTJ A;  1FIC A;  1SQV D;  1LT9 C;  4N78 D;  1OMI A;  1FZC A;  1U7J A;  5B66 E;  3VMA A;  2QM8 A;  2C0X A;  4EDF A;  1FIB A;  4IFM A;  3NFQ A;  3E7K A;  1BSH A;  1JY3 O;  1SQQ K;  1XTG B;  1VQ9 P;  4JYC A;  1SS1 A;  2J61 A;  4ZMD A;  2D2C C;  4Y99 B;  4OGQ B;  3CCL P;  1J1D C;  4K35 A;  2KP8 A;  1FE6 A;  2QA4 P;  1FDI A;  1EDL A;  1MZ9 A;  3HRN A;  1ZN5 A;  3CPW O;  2J5U A;  3SWF A;  1KMI Z;  1URQ B;  1EZV E;  5KLV E;  2R32 A;  1A02 J;  3AE9 C;  3BCC E;  5B66 H;  2WPR A;  4YPC A;  2NPS C;  5KLV D;  2B89 A;  3K5B A;  3HD7 C;  3HTK B;  3L73 J;  4W7Y A;  1FZD A;  3L36 A;  1HBW A;  4JF7 A;  3I5C A;  3MP7 B;  1K05 A;  3KPE A;  5B5E E;  1X8Y A;  1RF1 C;  4BRY B;  1QEX A;  1ZV8 A;  1WMK A;  2Q9I C;  1WRG A;  4R9T A;  3VTP C;  1JM0 A;  4H44 D;  4H13 C;  1RF0 A;  3LID A;  5GTH E;  2ZT9 D;  2W8Z A;  1FZA B;  1ZW0 A;  3HUS B;  3MD0 A;  2AEF A;  2ZYD A;  3TGU G;  1Z3S A;  3L74 J;  1P84 I;  3B71 A;  1T3J A;  2BAS A;  3TF5 A;  2P2U A;  2IBZ G;  3G71 P;  1RE3 B;  1QX8 A;  4D6T J;  3O6Q A;  1L0N K;  1SQX E;  4HKZ H;  4H44 B;  2G3A A;  1KYO I;  1EQ7 A;  2ZT9 B;  1UIX A;  5AW0 B;  3ABV C;  1IFM A;  1SQX D;  5B5E H;  1LTG C;  2FKW B;  3H1I G;  4IFF A;  1HF9 A;  1SQB K;  2SPZ A;  3CX5 E;  3O8Z A;  2Z4E B;  4NYT A;  2OTJ P;  2J3O A;  1EDI A;  3FX0 A;  3A5T A;  3CX5 D;  3H1J G;  3WUT A;  1E79 H;  3AEA C;  2HPC C;  4R4L A;  4EIJ A;  3L73 E;  1N86 B;  2A06 G;  1BDC A;  2QM7 A;  1GW4 A;  1KN7 A;  1GL2 A;  3OA7 A;  3B5N D;  3L73 D;  1L4A A;  2N9B A;  3HE4 A;  1NJI Q;  2N1T D;  1GD2 E;  2FXP A;  2ZJS E;  1HJ0 A;  5CJ0 A;  1HGZ A;  2J1G A;  1LP1 A;  3H1L G;  4BXL A;  1BDD A;  2C9L Y;  3CX5 H;  2RH0 A;  1M1J B;  1BE3 G;  2WSC J;  3L74 E;  1DIP A;  1L0L K;  1MV8 A;  2IBZ I;  1P84 E;  3A2A A;  2IDB A;  3V2N A;  3B5N B;  2P58 A;  4D6T E;  1VQM P;  1IFP A;  1P84 D;  3RGU A;  3TSI A;  3FWL A;  1Z3U A;  4RKU J;  4D6T D;  4JYO X;  4GOD A;  2H89 C;  2FYU J;  2ZXX A;  2H43 A;  3CC2 P;  3RK2 D;  2M3B A;  3M0D C;  3HE5 B;  1KQG B;  2J59 M;  1QL2 A;  1LJ2 A;  3S4R A;  3H32 C;  1KZU B;  1OIP A;  2W90 A;  4WY4 D;  2R44 A;  5BVZ A;  1OWA A;  2QVA A;  2MJZ A;  3BVH A;  1JMB A;  3BRV B;  3C9I A;  2POH A;  3G6E P;  1P84 H;  2WSF J;  4DZO A;  2YO2 A;  1YI2 P;  1AFO A;  2V7Q J;  3CL3 D;  3RK2 B;  5DJU B;  3T97 A;  1X9V A;  4TLF A;  4K3A A;  1U57 A;  3CCR P;  3VOP A;  4C7N B;  1FZE A;  4WY4 B;  2KI7 B;  3D71 A;  4M3L A;  2R5D A;  1NTK G;  3FXE A;  1LT1 A;  3IF4 A;  3L70 G;  3GF3 A;  4H44 C;  4GIF A;  2ZT9 C;  3TGU E;  3CMA P;  1R5S A;  1KIL B;  1PPJ E;  2Q1K A;  2P1J A;  3TGU D;  4I1L A;  3VYI A;  1EDK A;  2FYN C;  2Y0D A;  1S5L X;  3NXS A;  4M7F A;  4XFJ A;  1PGO A;  4GDO A;  1KB9 E;  1S2E A;  1LTB C;  1JMM A;  3E1I A;  1FJK A;  2K9J B;  3V2Q A;  1N73 B;  1JC9 A;  3MTU E;  4UB6 E;  3R4Y A;  1OW7 A;  3IN6 A;  4N6J A;  1LT9 B;  1SQP J;  1RQV A;  1CZQ A;  3D6Z A;  5BU8 B;  2I1K A;  1W2E A;  1NTM J;  4AQR D;  1YYC A;  2M5A A;  4RO0 A;  3H1I D;  2H8P D;  3U1C A;  2WSC H;  2ZXE B;  1G2C B;  2FXO A;  3H1J E;  2JP3 A;  2Q7C A;  3A3Y B;  2XU6 A;  2XNX C;  1SQQ J;  1EZV G;  3H1J D;  2J3F A;  1JY3 N;  5KLV G;  3GLM A;  3P8M C;  1J1D B;  1X22 A;  1GL2 C;  2P10 A;  3BCC G;  2B87 A;  1H0T B;  1HWT C;  3V2R A;  5BU5 A;  3M91 A;  1KB9 H;  2KXP B;  1GZL A;  1Y8A A;  1SP4 A;  4U3F J;  3H1H J;  2YO3 A;  2Q3I A;  3B5N C;  2KLV A;  1FZB B;  2BEQ D;  4NPF X;  2WTY A;  1SFC A;  3N7N A;  3VP8 A;  3H1L E;  4UB6 H;  2N1T C;  4H13 D;  3Q3D A;  2RN0 A;  3H1L D;  1JOC A;  2Z5I A;  3AEF C;  1RE4 C;  2M8R A;  3Q5S A;  1MFZ A;  1YQ3 C;  2WPV B;  2CK3 H;  4JYB A;  3UIA A;  2NRG A;  1M90 Q;  5CCG D;  2OYH A;  1CW5 A;  2V7Q H;  1RF1 B;  1ZRT E;  1EC5 A;  1GMJ A;  2YIU C;  3QH9 A;  1KQF B;  4H13 B;  1Y47 A;  3B8E B;  2H43 C;  2KNC A;  2FYZ A;  1ZRT D;  3P32 A;  1SQP E;  3CCM P;  1NTM E;  3TNU A;  2HLO A;  3MUD A;  1BCC J;  1SQP D;  2IZ1 A;  3TK1 A;  1YJ9 P;  1X79 B;  2JHH C;  1NTM D;  4HB1 A;  4EI2 A;  1NTZ E;  3CWB J;  1FID A;  3EQ2 A;  2D39 A;  1EZV I;  2E76 D;  3CXH E;  2BCC J;  1NTZ D;  1L0N J;  2HOD A;  2J2P A;  1L2P A;  1KQL A;  1LWU A;  2J58 A;  2AXT E;  1QLE D;  2JHI F;  3CXH D;  1R5L A;  1M56 D;  1K8A Q;  1NO4 A;  1FZG C;  4U3F E;  3FWN A;  3L73 G;  5APU A;  4EPU A;  1VQ4 P;  2K3R A;  4ASW A;  3D6Y A;  4U3F D;  1CI6 A;  5APY A;  3AE7 C;  2JWD A;  2KS1 B;  2IFM A;  3OW2 O;  1NAF A;  5DJT B;  3SWY A;  5K5G B;  4WVZ A;  1VQ8 P;  3L70 D;  1WT6 A;  2WVR A;  3V6I A;  3L72 E;  3GHG C;  1S72 P;  5CMZ A;  2C9N Y;  2JHL F;  3AED C;  3L74 G;  1RQU A;  4I7Z C;  3CXH H;  3L72 D;  1PIX A;  2ZVN B;  3L71 J;  1AQT A;  3E1I C;  2AXT H;  1W5C E;  4D6T G;  4KHX A;  2QJK B;  4L75 A;  1VF5 C;  3CCS P;  1LTJ B;  4WWI A;  5AW1 B;  3Q5R A;  1BCC E;  5AVQ B;  2GM4 A;  1YTZ T;  2M0B A;  4B86 A;  2J3U A;  1L0L J;  2C0W A;  1BCC D;  3R2P A;  2YNY A;  3CX5 I;  5AW8 B;  3WU2 E;  1ZXG A;  1N7S C;  1FAV A;  1URQ A;  2O01 N;  1L0N E;  1FZB C;  2WSE H;  5AVS B;  1QVF O;  3E1R A;  4ASV A;  1EZV D;  3IAO A;  1QGK B;  2I1J A;  1USE A;  3SFD C;  3H32 B;  3HTK A;  2FIB A;  4DJG A;  2NZ2 A;  1VQN P;  3CLQ A;  1Q81 Q;  3BCC D;  3CD6 P;  2ZFC A;  2YKP A;  3PLN A;  2I8D A;  2WZ7 A;  1JO5 A;  4EYY Q;  1NTK K;  2JEE A;  4IOI H;  2P67 A;  3KHU A;  1SQV K;  2OQQ A;  4KJM A;  2B9B A;  1FZA A;  3N4X A;  3KYQ A;  3A7O A;  3WU2 H;  3V5B A;  3HUS A;  4ZKP A;  1QL1 A;  1GU5 A;  3V2P A;  3F89 A;  3L71 E;  1DEB A;  3NMD A;  2WNP F;  1NU1 J;  1PPJ G;  3CCV P;  5CCG C;  2JHM F;  1RE3 A;  1RF0 B;  2O01 J;  3L71 D;  4GT1 A;  1FZF C;  2XKM A;  2WMM A;  5KJ7 A;  5H2F E;  1YIJ P;  2FFD A;  1UII A;  1L0L E;  3BRT B;  2FYU G;  2OYO A;  4ZKU A;  1R8E A;  1K9M Q;  2OAR A;  2G8Y A;  4W80 A;  2Z4E A;  2FYN B;  2WWW A;  3H1K J;  2OYI C;  1H8A A;  2QE7 H;  1MKM A;  5KLV K;  3JC2 2;  2E76 C;  1GL2 D;  3II6 A;  1N86 A;  1L4A D;  4JBZ A;  2J64 A;  1VQ5 P;  2KYV A;  3LW5 J;  2K1A A;  3JCU E;  5H2F H;  4JQ0 D;  2Y0E A;  5APW A;  2XNX B;  2IX7 C;  2ITA A;  2UWJ E;  3RL0 C;  1N8R Q;  1LTI C; 
#chains in the Genus database with same CATH homology
 1MUU A;  3U1A A;  3NXS A;  4M7F A;  1GL2 B;  1KFM A;  1M1J A;  2WPQ A;  4O9B A;  1LTJ C;  5APQ A;  1SFC C;  1L4A B;  1NH4 A;  3RK2 C;  1LTB C;  1JMM A;  1FZC C;  3E1I A;  3P8C E;  3HE4 B;  1RY3 A;  1FJK A;  3CI9 A;  4AUW A;  1IFN A;  3IFM A;  4LLH A;  3RK3 B;  3V2Q A;  2O1J A;  1N73 B;  4WY4 C;  2OYI A;  3MTU E;  5AW4 B;  1JC9 A;  1ZR4 A;  5APV A;  1JUN A;  1J2J B;  3P8C D;  4N6J A;  1LT9 B;  1CZQ A;  2N1T B;  2J5Z A;  3BAT A;  5BU8 B;  2I1K A;  3OAK A;  1W2E A;  4AQR D;  1SQX K;  2HOD B;  1YYC A;  4GKG A;  2J3G A;  2OYH C;  4HYT B;  1LWU B;  1AQ5 A;  3M9B A;  2H8P D;  3U1C A;  1IJD B;  2WSC H;  2ZXE B;  4RES B;  1JCD A;  3NTN A;  1G2C B;  1HH0 A;  1LTS C;  4DOJ A;  5CJ4 A;  2J0H A;  1RE4 B;  1FU1 A;  5KJ7 D;  2Q7C A;  3A3Y B;  2XU6 A;  2XNX C;  3IR9 A;  1HJB A;  1KIL C;  1NWQ A;  4N3Y B;  2J3F A;  1JY3 N;  1FOS F;  2HYN A;  1T2K C;  1CI6 B;  1NHL A;  1GU4 A;  3P8M C;  1J1D B;  1IFD A;  1JY2 N;  1JTH B;  1GL2 C;  2HPC B;  2P7J A;  2HLO C;  2HG5 D;  1HGV A;  1HWT C;  3V2R A;  5BU5 A;  1JY3 P;  3M91 A;  2WT7 A;  1T3U A;  5CCH A;  1GZL A;  2H43 B;  4LC1 A;  1SP4 A;  4N78 E;  2YO3 A;  2KOG A;  2Z5H A;  2FXM A;  1JY2 P;  2Q3I A;  5CHX A;  1ZLL A;  3B5N C;  2KLV A;  1N73 C;  3VMX A;  1FZB B;  5APS A;  1LTJ A;  1FIC A;  3M9H A;  2WTY A;  1SFC A;  3G3Z A;  3N7N A;  3VP8 A;  1LT9 C;  4N78 D;  2N1T C;  1FZC A;  2FFD B;  2GUS A;  2QM8 A;  2C0X A;  2HOD C;  1FIB A;  5AVY B;  4IFM A;  4C7N A;  1LWU C;  3NFQ A;  1JOC A;  2Z5I A;  1CSB A;  4WY4 A;  1JY3 O;  1RE4 C;  3P7K A;  2M8R A;  3BVH B;  1SVF A;  1MFZ A;  3EFG A;  1SQQ K;  1JY2 O;  1XTG B;  4JYC A;  1RF0 C;  4JYB A;  3UIA A;  2J61 A;  5CCG D;  1LTT C;  2OYH A;  1ZR2 A;  1CW5 A;  2W6B A;  4Y99 B;  1RF1 B;  2R3C A;  1J1D C;  2O1K A;  2KP8 A;  3VP9 A;  1FZG B;  2XNX A;  1MZ9 A;  1IFJ A;  1PFI A;  1FZE B;  2GUV A;  1ZN5 A;  3HRN A;  1KIL A;  4C46 A;  3B8E B;  2H43 C;  3SWF A;  2FYZ A;  3P32 A;  5APX A;  3KDP B;  1URQ B;  2XZR A;  3TNU A;  2HLO A;  2R32 A;  3MUD A;  3LW5 H;  1A02 J;  3TK1 A;  2YMY A;  1GDT A;  1X79 B;  2JHH C;  3PP5 A;  1M7L A;  2WPR A;  2NPS C;  1NKZ B;  3B5N A;  1N73 A;  1FID A;  3EQ2 A;  3GHG B;  3HD7 C;  2D39 A;  3HTK B;  1LT9 A;  4W7Y A;  2N1T A;  1JNM A;  1FZD A;  3L36 A;  2A45 G;  2HOD A;  2J2P A;  1HBW A;  4JF7 A;  3I5C A;  1N7S D;  3VMY A;  1IFI A;  1KQL A;  3KPE A;  1LWU A;  4I2L C;  2J58 A;  4Y99 C;  1IC2 A;  1JCC A;  1X8Y A;  1RF1 C;  2JHI F;  1ZV8 A;  2WIT A;  1RE4 A;  3E1I B;  2J3F D;  3MIW A;  1NO4 A;  2Q9I C;  1WRG A;  4R9T A;  1FZG C;  3VTP C;  3V4Q A;  1LGH B;  3HE5 A;  5APU A;  4EPU A;  1RF0 A;  3LID A;  1FZA B;  1CI6 A;  5APY A;  1URQ C;  5CCH D;  1HUC A;  3TYY A;  1JTH A;  3HUS B;  3MD0 A;  5AVU B;  2IFM A;  3BAS A;  3M0A A;  3V4W A;  1Z3S A;  1S9K E;  1L4A C;  1NAF A;  2E42 A;  2J60 A;  1T3J A;  2BAS A;  3SWY A;  2P2U A;  1N7S B;  1N2D C;  1WT6 A;  1S9K D;  1H88 A;  1RE3 B;  3RK3 C;  1GK4 A;  3GHG C;  2KSJ A;  1GW3 A;  1HTL C;  3L35 A;  2O01 H;  5CMZ A;  1FDM A;  2C9N Y;  5AW7 B;  1L0N K;  2J0Y A;  2JHL F;  5AVR B;  1J1E B;  1EQ7 A;  2W27 A;  4LGD E;  2NPS A;  5AW0 B;  1IFM A;  2WPS A;  3M06 A;  1VDF A;  3E1I C;  3HD7 A;  3MGN A;  2E43 A;  1LTG C;  2FKW B;  3VN0 A;  2PAJ A;  4IFF A;  4M7H A;  2YKO A;  1SQB K;  4KHX A;  3FIB A;  3O8Z A;  2Z4E B;  4NYT A;  3M9Q A;  1LTJ B;  1NOH A;  5AW3 B;  2J3O A;  1YTZ I;  2XDJ A;  3OJA B;  5AW1 B;  1FZA C;  1RF1 A;  1KIL D;  2WSF H;  4W7Z A;  5AVQ B;  2GM4 A;  1YTZ T;  3A5T A;  2J0G A;  3HUS C;  2Q9I A;  2JHK F;  4B86 A;  2VRS A;  5APT A;  1FZG A;  2J3U A;  1T2K D;  1FOS E;  2C0W A;  2HPC C;  1NU1 K;  3R2P A;  2YNY A;  4EIJ A;  5AW8 B;  1E5W A;  1N86 B;  1N7S C;  1FAV A;  2R5B A;  2W6A A;  1RE3 C;  1URQ A;  2A45 I;  2QM7 A;  1GW4 A;  1FZB C;  3H6P A;  1GL2 A;  3OA7 A;  2OYH B;  2WSE H;  3B5N D;  1L4A A;  5KJ7 C;  5AVS B;  4OH8 B;  2IPP A;  1FBM A;  2N9B A;  2FFD C;  1J1E C;  3HE4 A;  2N1T D;  1SLQ A;  1HVV A;  2GY7 A;  3LIE A;  1GD2 E;  2I1J A;  4JZC A;  5CJ0 A;  3U59 A;  3GHG A;  1FZF B;  4I6M C;  3H32 B;  1HGZ A;  3HTK A;  2FIB A;  4XA4 A;  4ZFG A;  3BVH C;  5AVV B;  2J1G A;  3CLQ A;  1N7L A;  2Z4E C;  2ZFC A;  2YKP A;  3TNU B;  2WZ7 A;  2YKQ A;  1JO5 A;  2C9L Y;  2HLO B;  1M1J B;  1NTK K;  1T8Z A;  2PP6 A;  2JEE A;  5AVT B;  1L0L K;  1MV8 A;  1G2C A;  2A45 H;  3L4F A;  3VMZ A;  5AW9 B;  3A2A A;  2P67 A;  3V2N A;  5AW6 B;  3B5N B;  1SQV K;  1FZE C;  1Z56 A;  3L37 A;  2CPB A;  2OYI B;  1N86 C;  1FZA A;  5AVZ B;  1FJP A;  3N4X A;  3KYQ A;  3A7O A;  5AW5 B;  3V5B A;  3HUS A;  3TSI A;  4ZKP A;  5AW2 B;  3RL0 D;  1QL1 A;  1GU5 A;  2HPC A;  1Z3U A;  4IFD K;  4JYO X;  3V2P A;  1XTC C;  1DH3 A;  2CPS A;  1IK9 A;  4R9J A;  1DEB A;  3NMD A;  2WNP F;  1N7S A;  2H43 A;  1SFC D;  5CCG C;  2M3B A;  3M0D C;  3RK2 D;  1A02 F;  3HE5 B;  2JHM F;  1RE3 A;  2J59 M;  2LKM A;  1QL2 A;  1RF0 B;  1VPC A;  4GT1 A;  1FZF C;  4XE5 B;  1FZB A;  3WMM 0;  3H32 C;  2XKM A;  1KZU B;  2NPS D;  4C7R A;  5KJ7 A;  5KTB A;  5AVW B;  3HD7 D;  4WY4 D;  2FFD A;  5BVZ A;  4AYC A;  3BRT B;  1M1J C;  4ZKU A;  1OWA A;  1KFN A;  4WB4 A;  2MJZ A;  2WT7 B;  1OXZ A;  3BVH A;  3RL0 B;  3BRV B;  2OAR A;  3C9I A;  4W80 A;  2POH A;  2Z4E A;  1H89 A;  2WWW A;  1SQP K;  4DZO A;  2YO2 A;  2OYI C;  1AFO A;  2IFN A;  1H8A A;  1SFC B;  1NTM K;  4EOT A;  3CL3 D;  3RK2 B;  3T97 A;  5KLV K;  1FZC B;  1X9V A;  2XV5 A;  2NPS B;  3VOP A;  1GK6 A;  1URQ D;  2Q5U A;  2HFE D;  2JJL A;  4C7N B;  1FZE A;  3KQG A;  2FYU K;  3HD7 B;  1GL2 D;  3II6 A;  4WY4 B;  1N86 A;  1NTZ K;  1NKN A;  1L4A D;  2KB7 P;  4M3L A;  2J64 A;  1LTA C;  4HH2 A;  2R5D A;  2KYV A;  1G1J A;  2J61 B;  3RK3 D;  4GIF A;  2Q9I B;  2L5G B;  5CCG A;  3M0D A;  5APW A;  2XNX B;  2IX7 C;  4WBA A;  1FZF A;  1KIL B;  1GTW A;  5AVX B;  3H32 A;  1G1I A;  5CCH C;  3RL0 C;  1LTI C;  2H7H A;  1DX7 A;  1IO4 A;  2P1J A;  4I1L A;  3VYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...