2FFDB

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
303
structure length
303
Chain Sequence
b'VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E Chain
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 92
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2ffdB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2ffdB03
1RF1A 1FIDA 3BVHB 1Z3UA 4EPUA 2JHKF 3E1IA 1W2EA 3GHGC 1T3UA 1RE4A 2JHLF 2JHHC 2D39A 2OYIB 3HUSA 1N73A 2HODA 1RF0A 1LT9B 1RE3B 1JY2O 1FZFA 1M1JB 2J64A 1FZGA 1FZEB 1FZCA 1FZAC 4JZCA 2HLOA 2H43B 3BVHC 2HPCB 2J0HA 2Q9IC 2OYHB 1RF1B 1JY3P 3H32A 4R9JA 3E1IB 2J3UA 1FZDA 2OYIC 1RE4B 1N86A 2J1GA 2Z4EC 2J3OA 1LT9C 1RE3C 3HUSB 2J3GA 1N73B 2HODB 1M1JC 1RF0B 2XNXA 1FZBA 1LTJA 1LWUA 2JHIF 1FZEC 1FZFB 4M7FA 2HPCC 1FZGB 4ZFGA 1FZCB 2GY7A 2OYHC 2WNPF 1RF1C 2HLOB 2FFDA 2J61A 4NYTA 3E1IC 1RE4C 3H32B 2J3FD 2Q9IA 4M7HA 1Z3SA 2J0YA 1JC9A 1N73C 1N86B 1RF0C 2FIBA 4JYOX 1FZFC 3GHGA 1JY2N 2Z4EA 2XNXB 1FZBB 1LTJB 1LWUB 3FIBA 1FZCC 1JY3O 2J60A 2H43C 2FFDB 4R9TA 3H32C 2J61B 1FZAA 1JY2P 1N86C 2Q9IB 3BVHA 2J2PA 3HUSC 1FICA 2HODC 1FZBC 2XNXC 1LTJC 1LWUC 3GHGB 2OYIA 1JY3N 1FIBA 2Z4EB 2J0GA 1LT9A 1RE3A 2A45I 1FZGC 2FFDC 1M1JA 2A45H 2HLOC 2JHMF 2J5ZA 2A45G 2J3FA 1FZEA 2H43A 2HPCA 1FZAB 2OYHA
chains in the Genus database with same CATH superfamily
4R4LA 4EPUA 1U7JA 2WITA 2WVRA 2H8PD 1T2KC 1LT9B 1RE3B 3D6YA 1L0LJ 3L71J 4TT3H 4BRYA 2J64A 4GT1A 2G3AA 2GA1A 4Z1MH 1G1IA 2KLUA 1WT6A 2FYUE 1SQXG 2N1TB 1VQ7P 2AEJA 2IDBA 1PV3A 1SQQG 2JHIF 4IFDK 1OZHA 1JO5A 4O9BA 2HPCC 4ZFGA 1PP9J 1FC2C 3E1IC 2J3FD 1VQOP 3LW5H 1FBMA 1NTKE 2E75B 3KZIE 4N3YB 1BCCE 3HE4B 1GK6A 2HYNA 4GODA 5CCGD 1H8AA 2J60A 3IR9A 3C8VA 2XU6A 1SQVK 2Q5UA 1UIXA 2ZT9B 3FXEA 4AQRD 1KILC 4PD4I 1MFTA 1W2BO 4PD4H 2JWDA 1MUUA 2HODC 1FZBC 4JBZA 2KLVA 1DEEG 2KZIA 4RJTA 4WBAA 2LXBA 3CCSP 2C0XA 3GLMA 2O1JA 2H88C 3H6PA 2GM4A 1Q81Q 1HH0A 4CPGA 4YXDC 1JY2O 3M91A 3AE6C 3QH9A 1EQ7A 3NMDA 3SWKA 2K37A 4JZCA 1VQ4P 1KFMA 1RF1B 3H1KD 4OGQD 1ZV8A 4Y28J 1PZQA 3W68A 2J3OA 2J5UA 1EDKA 3CCEP 2FYNC 4HYTB 2QM7A 3A0HE 1FZFB 5APVA 5EFWB 1L0LK 2QIWA 2XNDH 1VQPP 3HE5A 3H1IE 3TF5A 4U3FE 1FDMA 1NTME 3RK2D 2K3RA 3Q5PA 2Z4EA 1AQ5A 2XNXB 4JPZB 5KAFH 1PL5A 2B89A 2KNCB 1GZLA 2KXPB 1CW5A 2OGUA 1J1EB 5KAIH 1R8EA 2FBWC 4DJGA 1K9MQ 4PD4D 3L72E 2QSIA 2W27A 2NPSD 2GUSA 2MJZA 1DX7A 2A45I 3AE2C 2A45H 4I1LA 1EDJA 3AE3C 2NPSA 1SQXJ 4H13D 1JOCA 1W2EA 1R5SA 2ZVNB 2L5GB 2WPVB 1SQQJ 2QVAA 2QEXP 3L71E 1N73A 3CC7P 1HF9A 4A7PA 4ZMDA 1FZEB 1L4AB 2E74B 1DD3A 4C7RA 1YTZI 1FDOA 2Z5HA 1RE4B 4EI2A 1N86A 1M1JC 5AVRB 1SQPD 4EIJA 1FOSF 2H7HA 1NO4A 1EZVE 1VF5B 1T2KD 1ZW0A 3GMAA 1LTIC 4K35A 3CWBD 1K73Q 2PRRA 2N1TD 4OVNF 2QA4P 1KQLA 2KIKA 3OW2O 5AW8B 2KOGA 1PPJG 1PPJD 5H2FE 5AVVB 1IFDA 2JDIH 1SLQA 5CMZA 5AVSB 2A45G 5KTBA 1S5LX 4RKUJ 5CCHD 4I2LC 2HPCA 3CCVP 1OMIA 5AVXB 3BVHB 1ZMEC 3OAKA 2Q3EA 3E1IA 3Q1MA 4Y99C 2OARA 3G9RA 1YJNP 5AW4B 3D6ZA 2A06E 1D7MA 1YJWP 1E5WA 4NPDA 1KILD 3H1IG 2BASA 4U3FG 1NTMG 1N7SB 5BU8B 5TISE 1JY3P 1SQBJ 1FZDA 2UWJE 2P1JA 4UB6E 1KILA 1PGPA 5AVTB 1KV4A 1SQXK 1L0ND 2ZYAA 1USDA 1FZBA 4KHXA 1SQQK 3HRNA 5BU5A 1QL2A 3L72G 3AECC 2HLOB 1J1DB 1XTCC 1KORA 2YKOA 2XZRA 5CCGC 4M7HA 1K04A 1Z3SA 2AEMA 4LC1A 3HTKA 4W7ZA 2QJKC 1NU1E 1JY2N 3AE5C 2JO1A 1N8RQ 5KLIC 1S5LH 1K05A 3M9HA 2J61B 1X8YA 5GTIH 1NTZG 2ZAEB 1NTZD 4JYCA 3HD7C 1LWUC 2QE7H 2Y0DA 3AEEC 1FDIA 3FGAD 1KQSO 5DJTB 3TNUB 3BATA 3NFQA 4GOEA 1BSHA 1K8AQ 3QWOC 1FJPA 2WT7B 4W80A 2WQYC 4R4MA 1EZVG 1LP1A 3L37A 2OYIB 4C7NA 5B5EH 4OGQC 1AVYA 3O6QA 5GTHE 3VP9A 1RQUA 3L70D 1S3JA 3TGUG 3TGUD 2YKQA 3H25A 2Z4EC 2ZYGA 1N2DC 2C9NY 2Y0CA 1RF0B 1JTHA 5BVZA 1JNMA 4M7FA 1GW4A 2AEFA 2IBZI 2IPPA 2WPRA 3RK2C 1BE3D 1GU5A 2Z5IA 3CD6P 1FAVA 3H32B 2E5YA 2CK3H 1NHLA 2Q9IA 5KKZC 3I56P 3II6A 1HJ0A 2WTYA 1IO4A 1SQBK 1KQFB 3MUDA 4L73A 3L4FA 3A7OA 1YI2P 1OIPA 2M5AB 2K88A 1OXZA 1FU1A 2O01J 2A06G 1OW6A 1BSNA 1FE6A 1BDDA 1CZQA 1VQ8P 5KLVG 3H1LD 5KLVD 2V7QH 1VF5D 4L75A 2JKVA 3H1IJ 1USEA 3H1KE 4U3FJ 1NTMJ 4H13C 1M1JA 2O3JA 3MTUE 3RL0C 2FYUK 4KT0J 1JUNA 2XKMA 2ZXEB 1EXJA 2LXCB 2LKMA 3NXSA 3L72J 4YPCA 3F5HA 1NTKK 1S2EA 2JWAA 3BRTB 1NU1G 3FX0A 2W8ZA 3KYQA 2WSSH 5AW2B 4JF7A 1QVGO 4PJ0H 1LT9C 1RE3C 5APTA 2J3GA 2QJYB 3CC4P 3V5BA 2WSEJ 3VMAA 1NTZJ 4PD4E 5AW1B 1FZGB 1FZCB 2GY7A 3L75D 4QMAA 1S4XA 2IBZD 2IZ1A 3FWLA 3B5ND 1HWTC 3L73D 3TYYA 2N1TC 5M1BA 3CI9A 2FXOA 2FIBA 1OW8A 1AQTA 3RBXA 1LTJB 3FIBA 4YTPC 2CPBA 4TLFA 3B5NA 5DJUB 3KPEA 2J59M 1H89A 2O01N 4N78D 3VMYA 3IFMA 2XDJA 2WMMA 2KI7B 3GW6A 2E75C 1TU3F 2YIUB 1YBKA 4GDOA 4ASVA 5CCHC 4EDFA 3P8MC 1ZN5A 2AXTH 1JY3N 4D6TE 1SFCB 2ZT9C 1OW7A 2J3FA 1OX3A 2IFNA 2WPSA 1FIDA 1SQPE 3WU2H 5AVQB 3RBZA 1AV1A 1Y8AA 5CCGA 3HUSA 4WY4B 1HVVA 1QVFO 1FOSE 1NTMK 3HD7D 1CI6B 3GF3A 3CWBE 1T8ZA 3CPWO 3KDPB 5KAFE 1BGYD 3A0BH 2HODB 1G2CA 5E79H 2KK7A 2K9JB 3HD7A 2IZ0A 2D2CD 1LWUA 1JMBA 5KAIE 4LGDE 1GL2B 1RF1C 1PPJE 2ZJSE 1WMKA 2MKVA 5KLVJ 3H1KG 5AVWB 1P84I 1YTZT 1OVUA 1P84H 3UIAA 3U1CA 1HJBA 1FZFC 3I55P 2JR8A 5APSA 2WSCH 3RK3B 3PLNA 2OQQA 3LIDA 3GF7A 2VRSA 2FY8A 1KILE 2J58A 4H44B 1NAFA 2XV5A 1HUCA 1IJDB 2XNXC 2RKLA 3GHGB 3SFDC 1FIBA 4HJGH 2I1KA 1NU1J 1NJIQ 1J1EC 1L0NE 2H43A 2B87A 2R44A 4OWFA 3CMAP 2JHLF 1H0TB 1RHZB 2D39A 3P32A 2GUVA 1EXIA 1IFMA 3B71A 4M3LA 1ZOYC 1Q82Q 3PTZA 3LIEA 2Q9IC 1IZNB 2OYHB 1IFJA 2WSFH 1EDIA 4HH2A 3V6IA 3ZDMA 2KS1B 2J3UA 1S72P 1Y47A 3MUDC 3RL0D 2Q6QA 4XE5B 1NTZE 3IF4A 1VQKP 1FZEC 1L4AC 3BCCD 2ITAA 3PJSK 4GKGA 2E74C 2YMYA 4D6TG 1RE4C 4D6TD 2RMZA 3V4WA 3VYIA 3M9QA 1URQD 2Q7CA 1P84D 3MHVA 1SQPG 1AJYA 5L8RJ 3AEGC 3G71P 1VF5C 2FFDB 3JCUH 4WWIA 3T97B 1URQA 3L74D 4L74A 1X0TA 3S9OA 3R2PA 3L70E 3WUVA 3MP7B 3CWBG 2J0GA 2M0BA 1LT9A 1RE3A 3ITKA 3TGUE 2J5ZA 1FZAB 2W83C 3Q5RA 4DZOA 4H0LB 1ZXGA 4UB8H 2N1TA 2N9YB 1BE3E 1LNQA 2Y9ZA 1GTWA 5CJ0A 2E75D 2E76B 1JB0J 3H1KJ 4W7YA 3BVHC 2P7JA 1NU1K 3CMEP 2RN0A 3V2PA 2ZT9D 1QGKB 1S5LE 3HE4A 4ZNCA 5CCHA 5GTIE 3B5NC 3MD0A 1LT1A 1IC2A 4BRYB 1AA0A 3H1LE 5KLVE 1SQVG 1SQVD 4WY4D 5K5GB 3ABVC 2KSJA 2I1JA 1PIXA 3LW5J 4NPFX 2QJPC 2J0YA 1JC9A 1SP4A 3EFGA 4Y99B 1L0NG 3NTNA 1JY3O 3IAOA 1J1DC 1KYOH 2E42A 2M8RA 2YXRB 1M8OB 5B66H 4MN4C 5B5EE 5AW6B 1GL2D 3VOPA 3HUSC 2BCCD 1HGZA 2QG4A 1RY3A 2B88A 1KB9H 1ZRTD 2IFMA 5APQA 1IK9A 1MV8A 1RF1A 3H1HG 3RK3D 3H1HD 1SS1A 3N7NA 4K3AA 3A3YB 2P2UA 3L75E 3U1AA 2IBZE 2Y0EA 1JCDA 3L73E 1FZFA 1UIIA 1NWQA 4ASWA 5AVZB 4D6TJ 1L0LD 5CHXA 1X79B 2D2CC 1LGHB 1DIPA 2OYIC 1SQPJ 4N78E 2XNXA 4BWNA 2I8DA 2KNCA 1QL1A 3L70G 1KMIZ 3AEDC 2FYZA 3AEBC 1PP9D 1G1JA 4XA4A 1KFNA 3CWBJ 3AEFC 1ZP0C 1RF0C 4JYOX 4KJMA 2OTKE 4EYYQ 4IL6E 1VQ6P 4B86A 2B9BA 2H43C 1YHQP 1KYOD 3K5BA 3H32C 1BE3G 1M56D 2CPSA 3HE5B 1DH3A 1L4AD 2E74D 3CX5H 2Y9YA 2Z4EB 1ZR2A 4HKZH 1KB9D 1HBWA 1FZEA 1L4AA 2WSFJ 1BGYE 3PH0A 4PJ0E 3G4SP 3AE9C 4PV1B 1Z3UA 3SWYA 1RE4A 4NPEA 1MKMA 3H1LG 2KP8A 3CCJP 3Q3DA 3Q5SA 3CXHI 3A2AA 4DT0A 3CXHH 1SQVJ 5KJ7D 1OFCX 1S9KD 2V4HA 3B4SA 2NPSB 1L0NJ 2KSEA 2E43A 1N73B 1BDCA 2YKPA 4H0LD 1NOHA 1PGJA 4I7ZB 3AE4C 1URQC 2Q3IA 1LTGC 2QJYC 3SFEC 1N86B 3CCRP 2ZXXA 2YNYA 1GU4A 1SQPK 1FZCC 4XFJA 2C9LY 3E1RA 3USSA 3WU2E 1GD2E 3L75G 4R9TA 2IBZG 4ZKPA 2R32A 3CL3D 3BVHA 3L73G 5AVYB 2W90A 3P8CD 2BEZF 3SSUA 2J2PA 1VQLP 2K9YA 1ZLLA 2WWWA 1N7SD 1LTJC 3CX5D 1NYHA 1DEBA 2ZYDA 1OVRA 4BXLA 1N7SA 4OH8B 2YIUC 5CJ4A 3A0BE 5E79E 3V2NA 3L35A 3BCCE 1U57A 1VQNP 1SQXD 4I6MC 1SFCC 1SQQD 1T3JA 3CXHD 3L70J 1YJ9P 2HLOA 2HPCB 2YXQB 1P84E 3TGUJ 3D71A 1CSBA 4R9JA 3E1IB 1WRGA 4DCKA 4WY4C 2ZFCA 4N6JA 1H88A 4WB4A 1OVVA 3L74E 3KQGA 3PP5A 1BE3J 2K1AA 1KZUB 2J61A 4DOJA 1R5LA 4RESB 3D70A 1KILB 1M57D 1EDLA 2PGDA 1JM0A 1L0NK 2YO2A 1BGYG 3CC2P 1FZBB 2N9BA 1GL2C 3TNUA 1A02F 3H1LJ 1JY2P 2WT7A 2R3SA 1IK7A 4ZKUA 3CLQA 2G8YA 2H89C 2P10A 2SPZA 3HTKB 2OYIA 3RK3C 1YIJP 1PGQA 3KZIH 2JHMF 3OA7A 5APYA 4H44C 1QX8A 1NTZK 3GHGC 2AXCA 2KZJA 1YQ4C 1SQVE 1E79H 1GK4A 1VQMP 1DD4A 1RF0A 1S1CX 3O8ZA 2FYNB 3H1JG 3V4QA 1L2PA 3H1JD 3MGNA 1VQ5P 3H32A 5TJHA 3C9IA 1LP1B 2J1GA 1SQBG 1SQBD 5AW3B 1QLED 4PV1D 4C7NB 2W6JH 3JCUE 3O6QB 3L75J 1VQ9P 2LR2A 2OYHC 2PAJA 2M5AA 2PP6A 2BCCE 3L73J 1LTTC 5APWA 3MIWA 1IFNA 1ZRTE 3S1KA 5CBOA 1JTHB 2KUBA 3RK3E 3H1HE 3BCCG 2FYUG 2FYUD 1U7MA 2HFED 3A0HH 4UB8E 1NKNA 5C39A 1M1KQ 1KC8Q 2Q9IB 2O01H 2DW3A 2V7QJ 1AVOA 1X9VA 1L0LE 1ZR4A 3VP8A 1RH5B 2R5BA 1Q7YQ 3N4XA 2FFDC 1NTKG 3P7KA 1NTKD 1BCCG 2L91A 3SWFA 1BCCD 2IX7C 2PFXA 1Q86Q 5KJ7C 3WMM0 3L74G 3L36A 2JHKF 4IFMA 2E5TA 5KLVK 3TK1A 1PP9E 1LJ2A 1M1JB 1VDFA 1FZGA 1YQ3C 1FZCA 1FZAC 2C0WA 4H0LC 2ZVOB 3KHUA 1BGYJ 2HR3A 4IOIH 1KYOE 3MZWB 2WZ7A 3EFFK 2FKWB 3M0DC 1LTJA 2E76C 2O1KA 5B66E 2R5DA 2WSEH 1RQVA 3I5CA 4NYTA 2M3EA 1SFCD 2NRGA 2IYOA 4U7JA 2QRXA 1A02J 3E7KA 1KB9E 1HGVA 5CBNA 3M9BA 5AW9B 1SFCA 2FXMA 1HTLC 3WUUA 1N7SC 3EQ2A 1M90Q 3FXDA 3VMZA 1EZVI 2WPQA 4AUWA 3PHLA 1OWAA 2RH0A 4YXWH 1IFPA 1S9KE 3CCUP 4C46A 1FS0E 3CCLP 3H1JJ 4WY4A 4AYCA 3R4YA 3BASA 2BEQD 1KYOI 3B5NB 3C1LA 3H1ID 1KQGB 2HLOC 2OTLP 4U3FD 1NTMD 3CCQP 1CI6A 2YMKA 1LTSC 2W6BA 4LLHA 4L76A 1T3UA 5APUA 2POHA 3JC22 2JHHC 2QJPB 3AEAC 2BCCG 4JYBA 3FWNA 2HODA 3GG2A 1FJKA 2K9JA 2JP3A 3B8EB 5AVUB 5APXA 1KB9I 3L72D 2JEEA 1GL2A 4GOFA 1NKZB 5H2FH 1MZ9A 2QM8A 1YYCA 4JQ0D 1PGOA 1KN7A 3WUTA 3EWKA 3HUSB 3BCCJ 1IFIA 2FYUJ 3G6EP 4H44D 2QJKB 3P8CE 1NGMB 1L0LG 3L71G 3L71D 3CX5E 3PRJA 5KLIB 4WVZA 2JJLA 1PFIA 2YO3A 1Z56A 3M0AA 1JMMA 5AW7B 3GHGA 5TISH 1G2CB 1Y9BA 2FXPA 1SVFA 1NTKJ 3HD7B 4EOTA 2OTJP 1LWUB 1BCCJ 2WSCJ 3CCMP 4UB6H 3F89A 1VL2A 3V2QA 1Q90D 1KTMA 3L74J 1SQXE 4RO0A 1T6AA 1LTAC 1PP9G 1SQQE 3CXHE 3OJAB 2P67A 1EC5A 2D2CB 1EZVD 3U59A 1H0TA 2IYPA 1NVOA 3BRVB 4OGQB 4IL6X 1QEXA 2OYHA 3W67A 2KS1A 1YITP 3VMXA 3CX5I 1GMJA 3AE8C 3TDKA 1AFOA 1NH4A 3VN0A 2H43B 4PV1C 2J0HA 3Q2YA 4IFFA 2B87B 3RK2B 5AW0B 3RGUA 5KKZB 2R3CA 3JSVC 1NAYA 2P58A 2Q1KA 2WNPF 1VPCA 2NPSC 2FFDA 3V2RA 3VTPC 1N7LA 2A06D 5GTHH 3T97A 3AE7C 1Q2NA 1JEKA 2KB7P 1N73C 5KJ7A 4GIFA 1X22A 3AE1C 1XTGB 2KYVA 4I7ZC 1LTBC 3G3ZA 1KD1Q 3RL0g 2NZ2A 1J2JB 4H13B 3S4RA 1JCCA 4HB1A 4IL6H 1W5CE 2HG5D 3RL0B 1FZAA 2AXTE 1N86C 2BCCJ 3A5TA 2E76D 3H1JE 1M7LA 5AW5B 1FICA 2M3BA 3KXDA 3TSIA 3IN6A 1FZGC 2W6AA 3M0DA 1GW3A 1GDTA 1SQBE 1MFZA 3H1HJ 3M06A 1NU1D 2OYOA 1URQB
chains in the Genus database with same CATH topology
2WT7B 4W80A 4EPUA 2WITA 4DZOA 3GHGC 2H8PD 1GK4A 3L37A 2N1TA 2OYIB 4C7NA 1T2KC 1RF0A 1LT9B 1RE3B 1GTWA 3O8ZA 5CJ0A 3V4QA 3VP9A 2J64A 4GT1A 4W7YA 3BVHC 2P7JA 1NU1K 3MGNA 3H32A 3V2PA 1G1IA 3C9IA 2YKQA 2J1GA 1WT6A 2Z4EC 5AW3B 1N2DC 2N1TB 2C9NY 3HE4A 4C7NB 5CCHA 1RF0B 1JTHA 5BVZA 3B5NC 3MD0A 1JNMA 2JHIF 4IFDK 4M7FA 1GW4A 1IC2A 1JO5A 4O9BA 2HPCC 2IPPA 4ZFGA 2WPRA 2OYHC 2PAJA 2PP6A 4WY4D 1LTTC 3RK2C 5APWA 3E1IC 2KSJA 1GU5A 3MIWA 2Z5IA 1FAVA 2I1JA 3H32B 2J3FD 2Q9IA 1IFNA 1NHLA 2J0YA 1JC9A 1SP4A 3II6A 3LW5H 1FBMA 2WTYA 3EFGA 1IO4A 4Y99B 1SQBK 4N3YB 3HE4B 3NTNA 1GK6A 1JTHB 2HYNA 3MUDA 3L4FA 3A7OA 5CCGD 1JY3O 1H8AA 2J60A 1J1DC 3IR9A 2E42A 2M8RA 2XU6A 1SQVK 1OXZA 1FU1A 2HFED 2Q5UA 4AQRD 1CZQA 1KILC 1NKNA 2Q9IB 2O01H 5AW6B 1GL2D 3VOPA 1MUUA 1X9VA 3HUSC 2HODC 1FZBC 1ZR4A 3VP8A 2R5BA 1HGZA 2KLVA 1RY3A 3N4XA 4WBAA 2FFDC 1M1JA 3P7KA 3MTUE 2IFMA 3RL0C 2FYUK 3SWFA 5APQA 2IX7C 2C0XA 1IK9A 2O1JA 1MV8A 5KJ7C 1RF1A 3WMM0 3L36A 3RK3D 2JHKF 4IFMA 3N7NA 1JUNA 3A3YB 2XKMA 5KLVK 2ZXEB 3H6PA 2P2UA 2GM4A 2LKMA 3U1AA 1HH0A 3NXSA 3TK1A 1JY2O 1JCDA 1FZFA 3M91A 1NWQA 1M1JB 1VDFA 5AVZB 1EQ7A 3NMDA 1NTKK 1FZGA 1FZCA 1FZAC 4JZCA 2C0WA 5CHXA 1KFMA 1X79B 3BRTB 1RF1B 1LGHB 3KYQA 1ZV8A 2OYIC 5AW2B 4JF7A 2J3OA 1LT9C 1RE3C 2WZ7A 4N78E 5APTA 2J3GA 4HYTB 2FKWB 3V5BA 2XNXA 3M0DC 2QM7A 1LTJA 1FZFB 2O1KA 2R5DA 2WSEH 5APVA 5AW1B 1FZGB 1FZCB 3I5CA 2GY7A 1L0LK 1QL1A 4NYTA 2FYZA 1SFCD 1G1JA 3B5ND 1HWTC 4XA4A 3TYYA 1KFNA 2N1TC 3HE5A 1A02J 3CI9A 1RF0C 1HGVA 1FDMA 2FIBA 4JYOX 3RK2D 2Z4EA 1AQ5A 2XNXB 1LTJB 3FIBA 3M9BA 5AW9B 1SFCA 2CPBA 2FXMA 4B86A 1HTLC 3B5NA 2H43C 1GZLA 3KPEA 1N7SC 3EQ2A 2J59M 1H89A 4N78D 3H32C 3VMYA 1CW5A 3IFMA 2XDJA 1J1EB 3VMZA 2CPSA 2WPQA 4AUWA 3HE5B 1OWAA 1DH3A 1L4AD 5CCHC 1S9KE 4C46A 3P8MC 1ZN5A 2W27A 2NPSD 1JY3N 2Z4EB 2GUSA 2MJZA 4WY4A 4AYCA 3BASA 1DX7A 1SFCB 2A45I 1ZR2A 3B5NB 2A45H 2HLOC 2J3FA 1HBWA 1FZEA 1L4AA 4I1LA 2IFNA 1CI6A 2WPSA 2NPSA 1LTSC 1FIDA 2W6BA 1Z3UA 3SWYA 5AVQB 1JOCA 1W2EA 4LLHA 1T3UA 1RE4A 2POHA 5APUA 2L5GB 2KP8A 2JHHC 5CCGA 3HUSA 4JYBA 3A2AA 1N73A 2HODA 1FJKA 4WY4B 5KJ7D 1HVVA 3B8EB 5AVUB 5APXA 1FOSE 1S9KD 1FZEB 2JEEA 1L4AB 1GL2A 1NTMK 1NKZB 3HD7D 1CI6B 1MZ9A 2QM8A 4C7RA 1T8ZA 1YTZI 2NPSB 1YYCA 2Z5HA 3KDPB 1RE4B 1N86A 2E43A 3HUSB 1N73B 2HODB 1G2CA 1IFIA 1M1JC 2YKPA 3HD7A 5AVRB 1NOHA 1LWUA 4EIJA 1FOSF 3P8CE 4LGDE 2H7HA 1NO4A 1GL2B 1RF1C 1URQC 2Q3IA 5AVWB 2JJLA 1T2KD 1PFIA 1LTIC 2YO3A 1LTGC 1YTZT 1N86B 1Z56A 3M0AA 1JMMA 5AW7B 3UIAA 3U1CA 3GHGA 1HJBA 1G2CB 1FZFC 1SVFA 3HD7B 4EOTA 2YNYA 1GU4A 1LWUB 1SQPK 1FZCC 2C9LY 2N1TD 5APSA 2WSCH 3V2QA 3RK3B 1GD2E 4R9TA 4ZKPA 3LIDA 2R32A 1KQLA 1LTAC 2VRSA 3CL3D 3BVHA 2J58A 2P67A 3OJAB 3P8CD 1NAFA 2KOGA 1HUCA 2XV5A 5AVYB 1IJDB 5AW8B 2J2PA 3U59A 1ZLLA 2XNXC 2WWWA 1N7SD 1LTJC 3GHGB 1FIBA 5AVVB 1IFDA 3BRVB 2I1KA 1SLQA 1DEBA 5CMZA 5AVSB 2A45G 5KTBA 5CCHD 4I2LC 1J1EC 2H43A 2HPCA 1N7SA 4OH8B 5CJ4A 2OYHA 5AVXB 3BVHB 3OAKA 3V2NA 3L35A 3E1IA 4Y99C 3VMXA 2JHLF 2OARA 2D39A 1FJPA 4I6MC 5AW4B 1SFCC 3P32A 2GUVA 1IFMA 1T3JA 1E5WA 1KILD 1AFOA 4M3LA 2BASA 1NH4A 2HLOA 3VN0A 1FZAB 2H43B 2HPCB 2J0HA 3LIEA 4IFFA 2Q9IC 1N7SB 5BU8B 2OYHB 1IFJA 2WSFH 3RK2B 1JY3P 4HH2A 1CSBA 4R9JA 3E1IB 2J3UA 1FZDA 5AW0B 2P1JA 1KILA 1WRGA 5AVTB 4WY4C 2ZFCA 1SQXK 4N6JA 2R3CA 3RL0D 1H88A 4XE5B 4WB4A 1FZBA 4KHXA 1SQQK 3HRNA 5BU5A 1FZEC 3KQGA 1L4AC 3PP5A 4GKGA 1QL2A 2WNPF 1VPCA 2NPSC 2HLOB 2FFDA 1KZUB 1J1DB 1XTCC 3V2RA 3VTPC 1N7LA 2J61A 4DOJA 2YMYA 2YKOA 2XZRA 1RE4C 3T97A 4RESB 5CCGC 4M7HA 1Z3SA 2KB7P 1N73C 5KJ7A 1KILB 4LC1A 3V4WA 3HTKA 1L0NK 4W7ZA 4GIFA 1URQD 2YO2A 3M9QA 2Q7CA 3VYIA 1JY2N 1XTGB 1FZBB 2KYVA 2N9BA 1GL2C 1LTBC 3G3ZA 3TNUA 1J2JB 2FFDB 1A02F 1JCCA 3M9HA 2J61B 1X8YA 2HG5D 3RL0B 1FZAA 1URQA 1JY2P 2WT7A 1N86C 4JYCA 3A5TA 4ZKUA 3CLQA 1M7LA 5AW5B 1FICA 3HD7C 2M3BA 3HTKB 3R2PA 1LWUC 2OYIA 3TSIA 2J0GA 1LT9A 1RE3A 3RK3C 1FZGC 2W6AA 3TNUB 2JHMF 2J5ZA 3BATA 3M0DA 1GW3A 3NFQA 1GDTA 3OA7A 5APYA 1MFZA 3M06A 1NTZK 1URQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF1 A;  1FID A;  3BVH B;  1Z3U A;  4EPU A;  2JHK F;  3E1I A;  1W2E A;  3GHG C;  1T3U A;  1RE4 A;  2JHL F;  2JHH C;  2D39 A;  2OYI B;  3HUS A;  1N73 A;  2HOD A;  1RF0 A;  1LT9 B;  1RE3 B;  1JY2 O;  1FZF A;  1M1J B;  2J64 A;  1FZG A;  1FZE B;  1FZC A;  1FZA C;  4JZC A;  2HLO A;  2H43 B;  3BVH C;  2HPC B;  2J0H A;  2Q9I C;  2OYH B;  1RF1 B;  1JY3 P;  3H32 A;  4R9J A;  3E1I B;  2J3U A;  1FZD A;  2OYI C;  1RE4 B;  1N86 A;  2J1G A;  2Z4E C;  2J3O A;  1LT9 C;  1RE3 C;  3HUS B;  2J3G A;  1N73 B;  2HOD B;  1M1J C;  1RF0 B;  2XNX A;  1FZB A;  1LTJ A;  1LWU A;  2JHI F;  1FZE C;  1FZF B;  4M7F A;  2HPC C;  1FZG B;  4ZFG A;  1FZC B;  2GY7 A;  2OYH C;  2WNP F;  1RF1 C;  2HLO B;  2FFD A;  2J61 A;  4NYT A;  3E1I C;  1RE4 C;  3H32 B;  2J3F D;  2Q9I A;  4M7H A;  1Z3S A;  2J0Y A;  1JC9 A;  1N73 C;  1N86 B;  1RF0 C;  2FIB A;  4JYO X;  1FZF C;  3GHG A;  1JY2 N;  2Z4E A;  2XNX B;  1FZB B;  1LTJ B;  1LWU B;  3FIB A;  1FZC C;  1JY3 O;  2J60 A;  2H43 C;  2FFD B;  4R9T A;  3H32 C;  2J61 B;  1FZA A;  1JY2 P;  1N86 C;  2Q9I B;  3BVH A;  2J2P A;  3HUS C;  1FIC A;  2HOD C;  1FZB C;  2XNX C;  1LTJ C;  1LWU C;  3GHG B;  2OYI A;  1JY3 N;  1FIB A;  2Z4E B;  2J0G A;  1LT9 A;  1RE3 A;  2A45 I;  1FZG C;  2FFD C;  1M1J A;  2A45 H;  2HLO C;  2JHM F;  2J5Z A;  2A45 G;  2J3F A;  1FZE A;  2H43 A;  2HPC A;  1FZA B;  2OYH A; 
#chains in the Genus database with same CATH topology
 4R4L A;  4EPU A;  1U7J A;  2WIT A;  2WVR A;  2H8P D;  1T2K C;  1LT9 B;  1RE3 B;  3D6Y A;  1L0L J;  3L71 J;  4TT3 H;  4BRY A;  2J64 A;  4GT1 A;  2G3A A;  2GA1 A;  4Z1M H;  1G1I A;  2KLU A;  1WT6 A;  2FYU E;  1SQX G;  2N1T B;  1VQ7 P;  2AEJ A;  2IDB A;  1PV3 A;  1SQQ G;  2JHI F;  4IFD K;  1OZH A;  1JO5 A;  4O9B A;  2HPC C;  4ZFG A;  1PP9 J;  1FC2 C;  3E1I C;  2J3F D;  1VQO P;  3LW5 H;  1FBM A;  1NTK E;  2E75 B;  3KZI E;  4N3Y B;  1BCC E;  3HE4 B;  1GK6 A;  2HYN A;  4GOD A;  5CCG D;  1H8A A;  2J60 A;  3IR9 A;  3C8V A;  2XU6 A;  1SQV K;  2Q5U A;  1UIX A;  2ZT9 B;  3FXE A;  4AQR D;  1KIL C;  4PD4 I;  1MFT A;  1W2B O;  4PD4 H;  2JWD A;  1MUU A;  2HOD C;  1FZB C;  4JBZ A;  2KLV A;  1DEE G;  2KZI A;  4RJT A;  4WBA A;  2LXB A;  3CCS P;  2C0X A;  3GLM A;  2O1J A;  2H88 C;  3H6P A;  2GM4 A;  1Q81 Q;  1HH0 A;  4CPG A;  4YXD C;  1JY2 O;  3M91 A;  3AE6 C;  3QH9 A;  1EQ7 A;  3NMD A;  3SWK A;  2K37 A;  4JZC A;  1VQ4 P;  1KFM A;  1RF1 B;  3H1K D;  4OGQ D;  1ZV8 A;  4Y28 J;  1PZQ A;  3W68 A;  2J3O A;  2J5U A;  1EDK A;  3CCE P;  2FYN C;  4HYT B;  2QM7 A;  3A0H E;  1FZF B;  5APV A;  5EFW B;  1L0L K;  2QIW A;  2XND H;  1VQP P;  3HE5 A;  3H1I E;  3TF5 A;  4U3F E;  1FDM A;  1NTM E;  3RK2 D;  2K3R A;  3Q5P A;  2Z4E A;  1AQ5 A;  2XNX B;  4JPZ B;  5KAF H;  1PL5 A;  2B89 A;  2KNC B;  1GZL A;  2KXP B;  1CW5 A;  2OGU A;  1J1E B;  5KAI H;  1R8E A;  2FBW C;  4DJG A;  1K9M Q;  4PD4 D;  3L72 E;  2QSI A;  2W27 A;  2NPS D;  2GUS A;  2MJZ A;  1DX7 A;  2A45 I;  3AE2 C;  2A45 H;  4I1L A;  1EDJ A;  3AE3 C;  2NPS A;  1SQX J;  4H13 D;  1JOC A;  1W2E A;  1R5S A;  2ZVN B;  2L5G B;  2WPV B;  1SQQ J;  2QVA A;  2QEX P;  3L71 E;  1N73 A;  3CC7 P;  1HF9 A;  4A7P A;  4ZMD A;  1FZE B;  1L4A B;  2E74 B;  1DD3 A;  4C7R A;  1YTZ I;  1FDO A;  2Z5H A;  1RE4 B;  4EI2 A;  1N86 A;  1M1J C;  5AVR B;  1SQP D;  4EIJ A;  1FOS F;  2H7H A;  1NO4 A;  1EZV E;  1VF5 B;  1T2K D;  1ZW0 A;  3GMA A;  1LTI C;  4K35 A;  3CWB D;  1K73 Q;  2PRR A;  2N1T D;  4OVN F;  2QA4 P;  1KQL A;  2KIK A;  3OW2 O;  5AW8 B;  2KOG A;  1PPJ G;  1PPJ D;  5H2F E;  5AVV B;  1IFD A;  2JDI H;  1SLQ A;  5CMZ A;  5AVS B;  2A45 G;  5KTB A;  1S5L X;  4RKU J;  5CCH D;  4I2L C;  2HPC A;  3CCV P;  1OMI A;  5AVX B;  3BVH B;  1ZME C;  3OAK A;  2Q3E A;  3E1I A;  3Q1M A;  4Y99 C;  2OAR A;  3G9R A;  1YJN P;  5AW4 B;  3D6Z A;  2A06 E;  1D7M A;  1YJW P;  1E5W A;  4NPD A;  1KIL D;  3H1I G;  2BAS A;  4U3F G;  1NTM G;  1N7S B;  5BU8 B;  5TIS E;  1JY3 P;  1SQB J;  1FZD A;  2UWJ E;  2P1J A;  4UB6 E;  1KIL A;  1PGP A;  5AVT B;  1KV4 A;  1SQX K;  1L0N D;  2ZYA A;  1USD A;  1FZB A;  4KHX A;  1SQQ K;  3HRN A;  5BU5 A;  1QL2 A;  3L72 G;  3AEC C;  2HLO B;  1J1D B;  1XTC C;  1KOR A;  2YKO A;  2XZR A;  5CCG C;  4M7H A;  1K04 A;  1Z3S A;  2AEM A;  4LC1 A;  3HTK A;  4W7Z A;  2QJK C;  1NU1 E;  1JY2 N;  3AE5 C;  2JO1 A;  1N8R Q;  5KLI C;  1S5L H;  1K05 A;  3M9H A;  2J61 B;  1X8Y A;  5GTI H;  1NTZ G;  2ZAE B;  1NTZ D;  4JYC A;  3HD7 C;  1LWU C;  2QE7 H;  2Y0D A;  3AEE C;  1FDI A;  3FGA D;  1KQS O;  5DJT B;  3TNU B;  3BAT A;  3NFQ A;  4GOE A;  1BSH A;  1K8A Q;  3QWO C;  1FJP A;  2WT7 B;  4W80 A;  2WQY C;  4R4M A;  1EZV G;  1LP1 A;  3L37 A;  2OYI B;  4C7N A;  5B5E H;  4OGQ C;  1AVY A;  3O6Q A;  5GTH E;  3VP9 A;  1RQU A;  3L70 D;  1S3J A;  3TGU G;  3TGU D;  2YKQ A;  3H25 A;  2Z4E C;  2ZYG A;  1N2D C;  2C9N Y;  2Y0C A;  1RF0 B;  1JTH A;  5BVZ A;  1JNM A;  4M7F A;  1GW4 A;  2AEF A;  2IBZ I;  2IPP A;  2WPR A;  3RK2 C;  1BE3 D;  1GU5 A;  2Z5I A;  3CD6 P;  1FAV A;  3H32 B;  2E5Y A;  2CK3 H;  1NHL A;  2Q9I A;  5KKZ C;  3I56 P;  3II6 A;  1HJ0 A;  2WTY A;  1IO4 A;  1SQB K;  1KQF B;  3MUD A;  4L73 A;  3L4F A;  3A7O A;  1YI2 P;  1OIP A;  2M5A B;  2K88 A;  1OXZ A;  1FU1 A;  2O01 J;  2A06 G;  1OW6 A;  1BSN A;  1FE6 A;  1BDD A;  1CZQ A;  1VQ8 P;  5KLV G;  3H1L D;  5KLV D;  2V7Q H;  1VF5 D;  4L75 A;  2JKV A;  3H1I J;  1USE A;  3H1K E;  4U3F J;  1NTM J;  4H13 C;  1M1J A;  2O3J A;  3MTU E;  3RL0 C;  2FYU K;  4KT0 J;  1JUN A;  2XKM A;  2ZXE B;  1EXJ A;  2LXC B;  2LKM A;  3NXS A;  3L72 J;  4YPC A;  3F5H A;  1NTK K;  1S2E A;  2JWA A;  3BRT B;  1NU1 G;  3FX0 A;  2W8Z A;  3KYQ A;  2WSS H;  5AW2 B;  4JF7 A;  1QVG O;  4PJ0 H;  1LT9 C;  1RE3 C;  5APT A;  2J3G A;  2QJY B;  3CC4 P;  3V5B A;  2WSE J;  3VMA A;  1NTZ J;  4PD4 E;  5AW1 B;  1FZG B;  1FZC B;  2GY7 A;  3L75 D;  4QMA A;  1S4X A;  2IBZ D;  2IZ1 A;  3FWL A;  3B5N D;  1HWT C;  3L73 D;  3TYY A;  2N1T C;  5M1B A;  3CI9 A;  2FXO A;  2FIB A;  1OW8 A;  1AQT A;  3RBX A;  1LTJ B;  3FIB A;  4YTP C;  2CPB A;  4TLF A;  3B5N A;  5DJU B;  3KPE A;  2J59 M;  1H89 A;  2O01 N;  4N78 D;  3VMY A;  3IFM A;  2XDJ A;  2WMM A;  2KI7 B;  3GW6 A;  2E75 C;  1TU3 F;  2YIU B;  1YBK A;  4GDO A;  4ASV A;  5CCH C;  4EDF A;  3P8M C;  1ZN5 A;  2AXT H;  1JY3 N;  4D6T E;  1SFC B;  2ZT9 C;  1OW7 A;  2J3F A;  1OX3 A;  2IFN A;  2WPS A;  1FID A;  1SQP E;  3WU2 H;  5AVQ B;  3RBZ A;  1AV1 A;  1Y8A A;  5CCG A;  3HUS A;  4WY4 B;  1HVV A;  1QVF O;  1FOS E;  1NTM K;  3HD7 D;  1CI6 B;  3GF3 A;  3CWB E;  1T8Z A;  3CPW O;  3KDP B;  5KAF E;  1BGY D;  3A0B H;  2HOD B;  1G2C A;  5E79 H;  2KK7 A;  2K9J B;  3HD7 A;  2IZ0 A;  2D2C D;  1LWU A;  1JMB A;  5KAI E;  4LGD E;  1GL2 B;  1RF1 C;  1PPJ E;  2ZJS E;  1WMK A;  2MKV A;  5KLV J;  3H1K G;  5AVW B;  1P84 I;  1YTZ T;  1OVU A;  1P84 H;  3UIA A;  3U1C A;  1HJB A;  1FZF C;  3I55 P;  2JR8 A;  5APS A;  2WSC H;  3RK3 B;  3PLN A;  2OQQ A;  3LID A;  3GF7 A;  2VRS A;  2FY8 A;  1KIL E;  2J58 A;  4H44 B;  1NAF A;  2XV5 A;  1HUC A;  1IJD B;  2XNX C;  2RKL A;  3GHG B;  3SFD C;  1FIB A;  4HJG H;  2I1K A;  1NU1 J;  1NJI Q;  1J1E C;  1L0N E;  2H43 A;  2B87 A;  2R44 A;  4OWF A;  3CMA P;  2JHL F;  1H0T B;  1RHZ B;  2D39 A;  3P32 A;  2GUV A;  1EXI A;  1IFM A;  3B71 A;  4M3L A;  1ZOY C;  1Q82 Q;  3PTZ A;  3LIE A;  2Q9I C;  1IZN B;  2OYH B;  1IFJ A;  2WSF H;  1EDI A;  4HH2 A;  3V6I A;  3ZDM A;  2KS1 B;  2J3U A;  1S72 P;  1Y47 A;  3MUD C;  3RL0 D;  2Q6Q A;  4XE5 B;  1NTZ E;  3IF4 A;  1VQK P;  1FZE C;  1L4A C;  3BCC D;  2ITA A;  3PJS K;  4GKG A;  2E74 C;  2YMY A;  4D6T G;  1RE4 C;  4D6T D;  2RMZ A;  3V4W A;  3VYI A;  3M9Q A;  1URQ D;  2Q7C A;  1P84 D;  3MHV A;  1SQP G;  1AJY A;  5L8R J;  3AEG C;  3G71 P;  1VF5 C;  2FFD B;  3JCU H;  4WWI A;  3T97 B;  1URQ A;  3L74 D;  4L74 A;  1X0T A;  3S9O A;  3R2P A;  3L70 E;  3WUV A;  3MP7 B;  3CWB G;  2J0G A;  2M0B A;  1LT9 A;  1RE3 A;  3ITK A;  3TGU E;  2J5Z A;  1FZA B;  2W83 C;  3Q5R A;  4DZO A;  4H0L B;  1ZXG A;  4UB8 H;  2N1T A;  2N9Y B;  1BE3 E;  1LNQ A;  2Y9Z A;  1GTW A;  5CJ0 A;  2E75 D;  2E76 B;  1JB0 J;  3H1K J;  4W7Y A;  3BVH C;  2P7J A;  1NU1 K;  3CME P;  2RN0 A;  3V2P A;  2ZT9 D;  1QGK B;  1S5L E;  3HE4 A;  4ZNC A;  5CCH A;  5GTI E;  3B5N C;  3MD0 A;  1LT1 A;  1IC2 A;  4BRY B;  1AA0 A;  3H1L E;  5KLV E;  1SQV G;  1SQV D;  4WY4 D;  5K5G B;  3ABV C;  2KSJ A;  2I1J A;  1PIX A;  3LW5 J;  4NPF X;  2QJP C;  2J0Y A;  1JC9 A;  1SP4 A;  3EFG A;  4Y99 B;  1L0N G;  3NTN A;  1JY3 O;  3IAO A;  1J1D C;  1KYO H;  2E42 A;  2M8R A;  2YXR B;  1M8O B;  5B66 H;  4MN4 C;  5B5E E;  5AW6 B;  1GL2 D;  3VOP A;  3HUS C;  2BCC D;  1HGZ A;  2QG4 A;  1RY3 A;  2B88 A;  1KB9 H;  1ZRT D;  2IFM A;  5APQ A;  1IK9 A;  1MV8 A;  1RF1 A;  3H1H G;  3RK3 D;  3H1H D;  1SS1 A;  3N7N A;  4K3A A;  3A3Y B;  2P2U A;  3L75 E;  3U1A A;  2IBZ E;  2Y0E A;  1JCD A;  3L73 E;  1FZF A;  1UII A;  1NWQ A;  4ASW A;  5AVZ B;  4D6T J;  1L0L D;  5CHX A;  1X79 B;  2D2C C;  1LGH B;  1DIP A;  2OYI C;  1SQP J;  4N78 E;  2XNX A;  4BWN A;  2I8D A;  2KNC A;  1QL1 A;  3L70 G;  1KMI Z;  3AED C;  2FYZ A;  3AEB C;  1PP9 D;  1G1J A;  4XA4 A;  1KFN A;  3CWB J;  3AEF C;  1ZP0 C;  1RF0 C;  4JYO X;  4KJM A;  2OTK E;  4EYY Q;  4IL6 E;  1VQ6 P;  4B86 A;  2B9B A;  2H43 C;  1YHQ P;  1KYO D;  3K5B A;  3H32 C;  1BE3 G;  1M56 D;  2CPS A;  3HE5 B;  1DH3 A;  1L4A D;  2E74 D;  3CX5 H;  2Y9Y A;  2Z4E B;  1ZR2 A;  4HKZ H;  1KB9 D;  1HBW A;  1FZE A;  1L4A A;  2WSF J;  1BGY E;  3PH0 A;  4PJ0 E;  3G4S P;  3AE9 C;  4PV1 B;  1Z3U A;  3SWY A;  1RE4 A;  4NPE A;  1MKM A;  3H1L G;  2KP8 A;  3CCJ P;  3Q3D A;  3Q5S A;  3CXH I;  3A2A A;  4DT0 A;  3CXH H;  1SQV J;  5KJ7 D;  1OFC X;  1S9K D;  2V4H A;  3B4S A;  2NPS B;  1L0N J;  2KSE A;  2E43 A;  1N73 B;  1BDC A;  2YKP A;  4H0L D;  1NOH A;  1PGJ A;  4I7Z B;  3AE4 C;  1URQ C;  2Q3I A;  1LTG C;  2QJY C;  3SFE C;  1N86 B;  3CCR P;  2ZXX A;  2YNY A;  1GU4 A;  1SQP K;  1FZC C;  4XFJ A;  2C9L Y;  3E1R A;  3USS A;  3WU2 E;  1GD2 E;  3L75 G;  4R9T A;  2IBZ G;  4ZKP A;  2R32 A;  3CL3 D;  3BVH A;  3L73 G;  5AVY B;  2W90 A;  3P8C D;  2BEZ F;  3SSU A;  2J2P A;  1VQL P;  2K9Y A;  1ZLL A;  2WWW A;  1N7S D;  1LTJ C;  3CX5 D;  1NYH A;  1DEB A;  2ZYD A;  1OVR A;  4BXL A;  1N7S A;  4OH8 B;  2YIU C;  5CJ4 A;  3A0B E;  5E79 E;  3V2N A;  3L35 A;  3BCC E;  1U57 A;  1VQN P;  1SQX D;  4I6M C;  1SFC C;  1SQQ D;  1T3J A;  3CXH D;  3L70 J;  1YJ9 P;  2HLO A;  2HPC B;  2YXQ B;  1P84 E;  3TGU J;  3D71 A;  1CSB A;  4R9J A;  3E1I B;  1WRG A;  4DCK A;  4WY4 C;  2ZFC A;  4N6J A;  1H88 A;  4WB4 A;  1OVV A;  3L74 E;  3KQG A;  3PP5 A;  1BE3 J;  2K1A A;  1KZU B;  2J61 A;  4DOJ A;  1R5L A;  4RES B;  3D70 A;  1KIL B;  1M57 D;  1EDL A;  2PGD A;  1JM0 A;  1L0N K;  2YO2 A;  1BGY G;  3CC2 P;  1FZB B;  2N9B A;  1GL2 C;  3TNU A;  1A02 F;  3H1L J;  1JY2 P;  2WT7 A;  2R3S A;  1IK7 A;  4ZKU A;  3CLQ A;  2G8Y A;  2H89 C;  2P10 A;  2SPZ A;  3HTK B;  2OYI A;  3RK3 C;  1YIJ P;  1PGQ A;  3KZI H;  2JHM F;  3OA7 A;  5APY A;  4H44 C;  1QX8 A;  1NTZ K;  3GHG C;  2AXC A;  2KZJ A;  1YQ4 C;  1SQV E;  1E79 H;  1GK4 A;  1VQM P;  1DD4 A;  1RF0 A;  1S1C X;  3O8Z A;  2FYN B;  3H1J G;  3V4Q A;  1L2P A;  3H1J D;  3MGN A;  1VQ5 P;  3H32 A;  5TJH A;  3C9I A;  1LP1 B;  2J1G A;  1SQB G;  1SQB D;  5AW3 B;  1QLE D;  4PV1 D;  4C7N B;  2W6J H;  3JCU E;  3O6Q B;  3L75 J;  1VQ9 P;  2LR2 A;  2OYH C;  2PAJ A;  2M5A A;  2PP6 A;  2BCC E;  3L73 J;  1LTT C;  5APW A;  3MIW A;  1IFN A;  1ZRT E;  3S1K A;  5CBO A;  1JTH B;  2KUB A;  3RK3 E;  3H1H E;  3BCC G;  2FYU G;  2FYU D;  1U7M A;  2HFE D;  3A0H H;  4UB8 E;  1NKN A;  5C39 A;  1M1K Q;  1KC8 Q;  2Q9I B;  2O01 H;  2DW3 A;  2V7Q J;  1AVO A;  1X9V A;  1L0L E;  1ZR4 A;  3VP8 A;  1RH5 B;  2R5B A;  1Q7Y Q;  3N4X A;  2FFD C;  1NTK G;  3P7K A;  1NTK D;  1BCC G;  2L91 A;  3SWF A;  1BCC D;  2IX7 C;  2PFX A;  1Q86 Q;  5KJ7 C;  3WMM 0;  3L74 G;  3L36 A;  2JHK F;  4IFM A;  2E5T A;  5KLV K;  3TK1 A;  1PP9 E;  1LJ2 A;  1M1J B;  1VDF A;  1FZG A;  1YQ3 C;  1FZC A;  1FZA C;  2C0W A;  4H0L C;  2ZVO B;  3KHU A;  1BGY J;  2HR3 A;  4IOI H;  1KYO E;  3MZW B;  2WZ7 A;  3EFF K;  2FKW B;  3M0D C;  1LTJ A;  2E76 C;  2O1K A;  5B66 E;  2R5D A;  2WSE H;  1RQV A;  3I5C A;  4NYT A;  2M3E A;  1SFC D;  2NRG A;  2IYO A;  4U7J A;  2QRX A;  1A02 J;  3E7K A;  1KB9 E;  1HGV A;  5CBN A;  3M9B A;  5AW9 B;  1SFC A;  2FXM A;  1HTL C;  3WUU A;  1N7S C;  3EQ2 A;  1M90 Q;  3FXD A;  3VMZ A;  1EZV I;  2WPQ A;  4AUW A;  3PHL A;  1OWA A;  2RH0 A;  4YXW H;  1IFP A;  1S9K E;  3CCU P;  4C46 A;  1FS0 E;  3CCL P;  3H1J J;  4WY4 A;  4AYC A;  3R4Y A;  3BAS A;  2BEQ D;  1KYO I;  3B5N B;  3C1L A;  3H1I D;  1KQG B;  2HLO C;  2OTL P;  4U3F D;  1NTM D;  3CCQ P;  1CI6 A;  2YMK A;  1LTS C;  2W6B A;  4LLH A;  4L76 A;  1T3U A;  5APU A;  2POH A;  3JC2 2;  2JHH C;  2QJP B;  3AEA C;  2BCC G;  4JYB A;  3FWN A;  2HOD A;  3GG2 A;  1FJK A;  2K9J A;  2JP3 A;  3B8E B;  5AVU B;  5APX A;  1KB9 I;  3L72 D;  2JEE A;  1GL2 A;  4GOF A;  1NKZ B;  5H2F H;  1MZ9 A;  2QM8 A;  1YYC A;  4JQ0 D;  1PGO A;  1KN7 A;  3WUT A;  3EWK A;  3HUS B;  3BCC J;  1IFI A;  2FYU J;  3G6E P;  4H44 D;  2QJK B;  3P8C E;  1NGM B;  1L0L G;  3L71 G;  3L71 D;  3CX5 E;  3PRJ A;  5KLI B;  4WVZ A;  2JJL A;  1PFI A;  2YO3 A;  1Z56 A;  3M0A A;  1JMM A;  5AW7 B;  3GHG A;  5TIS H;  1G2C B;  1Y9B A;  2FXP A;  1SVF A;  1NTK J;  3HD7 B;  4EOT A;  2OTJ P;  1LWU B;  1BCC J;  2WSC J;  3CCM P;  4UB6 H;  3F89 A;  1VL2 A;  3V2Q A;  1Q90 D;  1KTM A;  3L74 J;  1SQX E;  4RO0 A;  1T6A A;  1LTA C;  1PP9 G;  1SQQ E;  3CXH E;  3OJA B;  2P67 A;  1EC5 A;  2D2C B;  1EZV D;  3U59 A;  1H0T A;  2IYP A;  1NVO A;  3BRV B;  4OGQ B;  4IL6 X;  1QEX A;  2OYH A;  3W67 A;  2KS1 A;  1YIT P;  3VMX A;  3CX5 I;  1GMJ A;  3AE8 C;  3TDK A;  1AFO A;  1NH4 A;  3VN0 A;  2H43 B;  4PV1 C;  2J0H A;  3Q2Y A;  4IFF A;  2B87 B;  3RK2 B;  5AW0 B;  3RGU A;  5KKZ B;  2R3C A;  3JSV C;  1NAY A;  2P58 A;  2Q1K A;  2WNP F;  1VPC A;  2NPS C;  2FFD A;  3V2R A;  3VTP C;  1N7L A;  2A06 D;  5GTH H;  3T97 A;  3AE7 C;  1Q2N A;  1JEK A;  2KB7 P;  1N73 C;  5KJ7 A;  4GIF A;  1X22 A;  3AE1 C;  1XTG B;  2KYV A;  4I7Z C;  1LTB C;  3G3Z A;  1KD1 Q;  3RL0 g;  2NZ2 A;  1J2J B;  4H13 B;  3S4R A;  1JCC A;  4HB1 A;  4IL6 H;  1W5C E;  2HG5 D;  3RL0 B;  1FZA A;  2AXT E;  1N86 C;  2BCC J;  3A5T A;  2E76 D;  3H1J E;  1M7L A;  5AW5 B;  1FIC A;  2M3B A;  3KXD A;  3TSI A;  3IN6 A;  1FZG C;  2W6A A;  3M0D A;  1GW3 A;  1GDT A;  1SQB E;  1MFZ A;  3H1H J;  3M06 A;  1NU1 D;  2OYO A;  1URQ B; 
#chains in the Genus database with same CATH homology
 2WT7 B;  4W80 A;  4EPU A;  2WIT A;  4DZO A;  3GHG C;  2H8P D;  1GK4 A;  3L37 A;  2N1T A;  2OYI B;  4C7N A;  1T2K C;  1RF0 A;  1LT9 B;  1RE3 B;  1GTW A;  3O8Z A;  5CJ0 A;  3V4Q A;  3VP9 A;  2J64 A;  4GT1 A;  4W7Y A;  3BVH C;  2P7J A;  1NU1 K;  3MGN A;  3H32 A;  3V2P A;  1G1I A;  3C9I A;  2YKQ A;  2J1G A;  1WT6 A;  2Z4E C;  5AW3 B;  1N2D C;  2N1T B;  2C9N Y;  3HE4 A;  4C7N B;  5CCH A;  1RF0 B;  1JTH A;  5BVZ A;  3B5N C;  3MD0 A;  1JNM A;  2JHI F;  4IFD K;  4M7F A;  1GW4 A;  1IC2 A;  1JO5 A;  4O9B A;  2HPC C;  2IPP A;  4ZFG A;  2WPR A;  2OYH C;  2PAJ A;  2PP6 A;  4WY4 D;  1LTT C;  3RK2 C;  5APW A;  3E1I C;  2KSJ A;  1GU5 A;  3MIW A;  2Z5I A;  1FAV A;  2I1J A;  3H32 B;  2J3F D;  2Q9I A;  1IFN A;  1NHL A;  2J0Y A;  1JC9 A;  1SP4 A;  3II6 A;  3LW5 H;  1FBM A;  2WTY A;  3EFG A;  1IO4 A;  4Y99 B;  1SQB K;  4N3Y B;  3HE4 B;  3NTN A;  1GK6 A;  1JTH B;  2HYN A;  3MUD A;  3L4F A;  3A7O A;  5CCG D;  1JY3 O;  1H8A A;  2J60 A;  1J1D C;  3IR9 A;  2E42 A;  2M8R A;  2XU6 A;  1SQV K;  1OXZ A;  1FU1 A;  2HFE D;  2Q5U A;  4AQR D;  1CZQ A;  1KIL C;  1NKN A;  2Q9I B;  2O01 H;  5AW6 B;  1GL2 D;  3VOP A;  1MUU A;  1X9V A;  3HUS C;  2HOD C;  1FZB C;  1ZR4 A;  3VP8 A;  2R5B A;  1HGZ A;  2KLV A;  1RY3 A;  3N4X A;  4WBA A;  2FFD C;  1M1J A;  3P7K A;  3MTU E;  2IFM A;  3RL0 C;  2FYU K;  3SWF A;  5APQ A;  2IX7 C;  2C0X A;  1IK9 A;  2O1J A;  1MV8 A;  5KJ7 C;  1RF1 A;  3WMM 0;  3L36 A;  3RK3 D;  2JHK F;  4IFM A;  3N7N A;  1JUN A;  3A3Y B;  2XKM A;  5KLV K;  2ZXE B;  3H6P A;  2P2U A;  2GM4 A;  2LKM A;  3U1A A;  1HH0 A;  3NXS A;  3TK1 A;  1JY2 O;  1JCD A;  1FZF A;  3M91 A;  1NWQ A;  1M1J B;  1VDF A;  5AVZ B;  1EQ7 A;  3NMD A;  1NTK K;  1FZG A;  1FZC A;  1FZA C;  4JZC A;  2C0W A;  5CHX A;  1KFM A;  1X79 B;  3BRT B;  1RF1 B;  1LGH B;  3KYQ A;  1ZV8 A;  2OYI C;  5AW2 B;  4JF7 A;  2J3O A;  1LT9 C;  1RE3 C;  2WZ7 A;  4N78 E;  5APT A;  2J3G A;  4HYT B;  2FKW B;  3V5B A;  2XNX A;  3M0D C;  2QM7 A;  1LTJ A;  1FZF B;  2O1K A;  2R5D A;  2WSE H;  5APV A;  5AW1 B;  1FZG B;  1FZC B;  3I5C A;  2GY7 A;  1L0L K;  1QL1 A;  4NYT A;  2FYZ A;  1SFC D;  1G1J A;  3B5N D;  1HWT C;  4XA4 A;  3TYY A;  1KFN A;  2N1T C;  3HE5 A;  1A02 J;  3CI9 A;  1RF0 C;  1HGV A;  1FDM A;  2FIB A;  4JYO X;  3RK2 D;  2Z4E A;  1AQ5 A;  2XNX B;  1LTJ B;  3FIB A;  3M9B A;  5AW9 B;  1SFC A;  2CPB A;  2FXM A;  4B86 A;  1HTL C;  3B5N A;  2H43 C;  1GZL A;  3KPE A;  1N7S C;  3EQ2 A;  2J59 M;  1H89 A;  4N78 D;  3H32 C;  3VMY A;  1CW5 A;  3IFM A;  2XDJ A;  1J1E B;  3VMZ A;  2CPS A;  2WPQ A;  4AUW A;  3HE5 B;  1OWA A;  1DH3 A;  1L4A D;  5CCH C;  1S9K E;  4C46 A;  3P8M C;  1ZN5 A;  2W27 A;  2NPS D;  1JY3 N;  2Z4E B;  2GUS A;  2MJZ A;  4WY4 A;  4AYC A;  3BAS A;  1DX7 A;  1SFC B;  2A45 I;  1ZR2 A;  3B5N B;  2A45 H;  2HLO C;  2J3F A;  1HBW A;  1FZE A;  1L4A A;  4I1L A;  2IFN A;  1CI6 A;  2WPS A;  2NPS A;  1LTS C;  1FID A;  2W6B A;  1Z3U A;  3SWY A;  5AVQ B;  1JOC A;  1W2E A;  4LLH A;  1T3U A;  1RE4 A;  2POH A;  5APU A;  2L5G B;  2KP8 A;  2JHH C;  5CCG A;  3HUS A;  4JYB A;  3A2A A;  1N73 A;  2HOD A;  1FJK A;  4WY4 B;  5KJ7 D;  1HVV A;  3B8E B;  5AVU B;  5APX A;  1FOS E;  1S9K D;  1FZE B;  2JEE A;  1L4A B;  1GL2 A;  1NTM K;  1NKZ B;  3HD7 D;  1CI6 B;  1MZ9 A;  2QM8 A;  4C7R A;  1T8Z A;  1YTZ I;  2NPS B;  1YYC A;  2Z5H A;  3KDP B;  1RE4 B;  1N86 A;  2E43 A;  3HUS B;  1N73 B;  2HOD B;  1G2C A;  1IFI A;  1M1J C;  2YKP A;  3HD7 A;  5AVR B;  1NOH A;  1LWU A;  4EIJ A;  1FOS F;  3P8C E;  4LGD E;  2H7H A;  1NO4 A;  1GL2 B;  1RF1 C;  1URQ C;  2Q3I A;  5AVW B;  2JJL A;  1T2K D;  1PFI A;  1LTI C;  2YO3 A;  1LTG C;  1YTZ T;  1N86 B;  1Z56 A;  3M0A A;  1JMM A;  5AW7 B;  3UIA A;  3U1C A;  3GHG A;  1HJB A;  1G2C B;  1FZF C;  1SVF A;  3HD7 B;  4EOT A;  2YNY A;  1GU4 A;  1LWU B;  1SQP K;  1FZC C;  2C9L Y;  2N1T D;  5APS A;  2WSC H;  3V2Q A;  3RK3 B;  1GD2 E;  4R9T A;  4ZKP A;  3LID A;  2R32 A;  1KQL A;  1LTA C;  2VRS A;  3CL3 D;  3BVH A;  2J58 A;  2P67 A;  3OJA B;  3P8C D;  1NAF A;  2KOG A;  1HUC A;  2XV5 A;  5AVY B;  1IJD B;  5AW8 B;  2J2P A;  3U59 A;  1ZLL A;  2XNX C;  2WWW A;  1N7S D;  1LTJ C;  3GHG B;  1FIB A;  5AVV B;  1IFD A;  3BRV B;  2I1K A;  1SLQ A;  1DEB A;  5CMZ A;  5AVS B;  2A45 G;  5KTB A;  5CCH D;  4I2L C;  1J1E C;  2H43 A;  2HPC A;  1N7S A;  4OH8 B;  5CJ4 A;  2OYH A;  5AVX B;  3BVH B;  3OAK A;  3V2N A;  3L35 A;  3E1I A;  4Y99 C;  3VMX A;  2JHL F;  2OAR A;  2D39 A;  1FJP A;  4I6M C;  5AW4 B;  1SFC C;  3P32 A;  2GUV A;  1IFM A;  1T3J A;  1E5W A;  1KIL D;  1AFO A;  4M3L A;  2BAS A;  1NH4 A;  2HLO A;  3VN0 A;  1FZA B;  2H43 B;  2HPC B;  2J0H A;  3LIE A;  4IFF A;  2Q9I C;  1N7S B;  5BU8 B;  2OYH B;  1IFJ A;  2WSF H;  3RK2 B;  1JY3 P;  4HH2 A;  1CSB A;  4R9J A;  3E1I B;  2J3U A;  1FZD A;  5AW0 B;  2P1J A;  1KIL A;  1WRG A;  5AVT B;  4WY4 C;  2ZFC A;  1SQX K;  4N6J A;  2R3C A;  3RL0 D;  1H88 A;  4XE5 B;  4WB4 A;  1FZB A;  4KHX A;  1SQQ K;  3HRN A;  5BU5 A;  1FZE C;  3KQG A;  1L4A C;  3PP5 A;  4GKG A;  1QL2 A;  2WNP F;  1VPC A;  2NPS C;  2HLO B;  2FFD A;  1KZU B;  1J1D B;  1XTC C;  3V2R A;  3VTP C;  1N7L A;  2J61 A;  4DOJ A;  2YMY A;  2YKO A;  2XZR A;  1RE4 C;  3T97 A;  4RES B;  5CCG C;  4M7H A;  1Z3S A;  2KB7 P;  1N73 C;  5KJ7 A;  1KIL B;  4LC1 A;  3V4W A;  3HTK A;  1L0N K;  4W7Z A;  4GIF A;  1URQ D;  2YO2 A;  3M9Q A;  2Q7C A;  3VYI A;  1JY2 N;  1XTG B;  1FZB B;  2KYV A;  2N9B A;  1GL2 C;  1LTB C;  3G3Z A;  3TNU A;  1J2J B;  2FFD B;  1A02 F;  1JCC A;  3M9H A;  2J61 B;  1X8Y A;  2HG5 D;  3RL0 B;  1FZA A;  1URQ A;  1JY2 P;  2WT7 A;  1N86 C;  4JYC A;  3A5T A;  4ZKU A;  3CLQ A;  1M7L A;  5AW5 B;  1FIC A;  3HD7 C;  2M3B A;  3HTK B;  3R2P A;  1LWU C;  2OYI A;  3TSI A;  2J0G A;  1LT9 A;  1RE3 A;  3RK3 C;  1FZG C;  2W6A A;  3TNU B;  2JHM F;  2J5Z A;  3BAT A;  3M0D A;  1GW3 A;  3NFQ A;  1GDT A;  3OA7 A;  5APY A;  1MFZ A;  3M06 A;  1NTZ K;  1URQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...