2FFDB

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
303
structure length
303
Chain Sequence
VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E Chain
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 92
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2ffdB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2ffdB03
2J61A 1FZCA 1FZGA 2HODC 1RF1A 1RE4A 1JY3P 2Z4EA 2HLOB 3GHGB 1N86C 1M1JC 1FIDA 1FZAA 2FFDB 2J3UA 2HODB 1FZBA 1M1JB 2XNXB 2GY7A 1RF0C 1N73C 3BVHA 4JZCA 2Z4EB 2J1GA 4M7FA 2HLOC 2J3GA 2J3FD 1LWUC 1W2EA 1LTJC 2H43A 1JY2N 2OYIC 1FICA 1FZBB 1T3UA 1LT9C 1LWUB 1LTJB 2XNXC 4M7HA 1FZEA 3H32A 2OYIB 1RE3C 4NYTA 2Q9IA 1FZCC 1RF1C 2OYHA 1RE4C 2Z4EC 1LT9B 1Z3UA 4EPUA 2HPCA 1JY3O 2A45H 1FZAC 1RE3B 2J61B 1FZCB 1FZGB 1RF1B 1RE4B 1FZFA 1FZBC 3E1IA 1FZAB 2FIBA 4R9TA 3HUSA 1RF0A 2J60A 4JYOX 3BVHC 2JHLF 2HPCB 2J3OA 3GHGA 3BVHB 2FFDA 1FZDA 2WNPF 1FIBA 2JHIF 1FZGC 2HODA 2J0GA 1N86A 1M1JA 2H43B 3FIBA 2XNXA 1FZEC 3H32C 2Q9IC 2J0YA 2OYHC 2JHKF 2HPCC 2J5ZA 1JY3N 1FZEB 4ZFGA 3H32B 1JY2P 2J3FA 2Q9IB 1N73A 2OYHB 1FZFC 2A45G 1Z3SA 2D39A 1N86B 3E1IC 2A45I 2HLOA 3HUSC 2H43C 1LWUA 2J64A 1LTJA 1FZFB 4R9JA 1JY2O 2JHHC 2J2PA 2OYIA 3E1IB 2J0HA 3HUSB 1LT9A 1RF0B 3GHGC 1N73B 1JC9A 2FFDC 1RE3A 2JHMF
chains in the Genus database with same CATH superfamily
1L4AB 3L72E 2QJPB 2KK7A 1ZW0A 1RE4A 1JY3P 2W8ZA 5L8RJ 1SQQJ 3CXHD 4Y99C 3MD0A 4RO0A 2AEJA 2WSCJ 1RF0C 1AQTA 1AA0A 1T6AA 1NTMJ 1BDDA 3RK2C 2PGDA 3UIAA 2LR2A 5AVTB 1MFZA 2J3GA 1LWUC 3PLNA 1NKNA 2JEEA 3RGUA 2D2CB 2MJZA 4H13D 3A0BH 3H1KE 4H44B 3CMEP 1URQA 3GG2A 1RE4C 1R8EA 5GTHH 3CCUP 3PJSK 1YI2P 1FZAB 4GT1A 4MN4C 1U7JA 4WY4D 2W6AA 1NTZJ 3BASA 3BVHB 2WNPF 2R32A 2YNYA 1KB9D 2KUBA 2J0GA 1KFMA 1FJKA 5APWA 3H1KJ 3HTKB 4I7ZB 1URQC 2YIUB 1IZNB 1FC2C 1USEA 2J3FA 2H89C 1HH0A 5E79E 1VQOP 4N78D 1YJNP 3ITKA 1ZR2A 2OYIA 1WRGA 3L73E 2Z4EA 3CXHH 1M7LA 3CCVP 1BCCE 3P8CE 4IFFA 1Q2NA 1MV8A 1ZMEC 3JC22 3H1LD 1LTGC 1KYOD 1L0LK 2OYIC 3QH9A 3AEBC 3L73J 1T3UA 2RMZA 1DD3A 1KQLA 3U1CA 2IBZG 1FS0E 2Z4EC 2FXOA 2WQYC 4OGQD 3T97A 1E5WA 2QE7H 1PGPA 4H13C 2LXCB 1ZRTD 3PH0A 2CPBA 2HPCB 1KB9H 4L73A 4U7JA 3QWOC 5AW0B 2FXPA 1SP4A 3FIBA 1NAYA 4C46A 2OTJP 2V7QH 5GTHE 4WY4C 3CCLP 3G6EP 1GD2E 2KXPB 3L71D 1IFMA 1JY2P 1L0LE 1NU1D 2BEQD 2KLVA 1OVUA 2OYHB 4GOEA 2W6JH 3O8ZA 1JCDA 3CWBG 5AW8B 3B5NA 1H88A 2H7HA 2YKOA 3PHLA 1DEEG 1H0TB 5CCGA 1CW5A 2WPQA 1GMJA 1PP9G 1GU5A 1EDKA 1VQMP 2ZVOB 2HLOB 2FYZA 2J3UA 2HODB 3VP9A 5APTA 4U3FD 2ZT9B 1OXZA 4W7YA 1SQBJ 1QLED 1VDFA 1KILB 1EZVG 1KYOH 1FOSE 3MGNA 4D6TD 3L75D 5KLVD 1AJYA 3MHVA 1YQ3C 3CXHE 2POHA 2N1TB 4KHXA 4IOIH 5CCHA 4M7HA 5CCGC 1LNQA 4BRYB 1FAVA 1KORA 3Q5RA 2IFMA 1JY3O 1NJIQ 5KAFH 2FYNC 3G9RA 2WPSA 2B87B 3RL0D 3V4WA 2HG5D 2WT7B 3CWBD 1NTKG 2W27A 1L4AA 4OWFA 1BE3E 1Y47A 4I1LA 1YQ4C 2WWWA 2E75C 2PAJA 3L74G 1RQVA 2NRGA 1S4XA 3V2NA 2V4HA 1S5LE 1JEKA 2WPRA 1QEXA 3VMYA 2Q9IB 1N73A 2FKWB 1IJDB 4N6JA 5AW3B 2R5DA 3KHUA 4PD4H 3IAOA 3I56P 4R4MA 1K73Q 3USSA 1J1DB 3FXDA 2KB7P 1FDOA 1L4AC 1BE3J 2QJPC 2JO1A 2JR8A 3A7OA 3S4RA 1ZN5A 2YKPA 2KLUA 1GL2D 2ZXXA 1T3JA 1FZAA 4EYYQ 1R5LA 4HJGH 4Y28J 1ZXGA 3VTPC 1VQ8P 2XNXB 1N7LA 2P7JA 3H1IJ 3BVHA 1N73C 1FJPA 1VQ7P 1JO5A 2WPVB 1LTIC 3G71P 3R2PA 4H44C 1SFCD 2AXCA 3HTKA 1N8RQ 2A06G 1GU4A 3H1JJ 1YTZI 3AE8C 2V7QJ 3A0HE 5KAIH 3Q3DA 1Z3UA 5H2FE 1FZAC 3TSIA 1SQPJ 4H0LB 4GOFA 3TNUB 2FIBA 3TGUG 4R9TA 1BGYD 2QG4A 4ASVA 1JOCA 1NAFA 3BVHC 3N4XA 1NYHA 1X9VA 1VQNP 2JJLA 1KV4A 1VL2A 2WSFH 3KDPB 4O9BA 1IFIA 2K3RA 4I7ZC 3AEAC 2G8YA 3KXDA 2W6BA 5KAFE 3L70J 2E76D 3Q1MA 1GK4A 2XDJA 1ZRTE 3H32B 2KS1B 1M90Q 1NO4A 3H1HG 2H88C 2KSJA 1RQUA 2H43C 2ZT9D 2BCCG 1FOSF 3D6ZA 3SWFA 2ZYDA 3I5CA 2WITA 3CC7P 2J0HA 2A06D 3BATA 3G4SP 1SQXG 1JC9A 3CX5D 2Y0CA 1IFNA 2Y0DA 2R44A 1LTTC 1K04A 4Z1MH 3TGUD 1PGOA 1ZLLA 4NPFX 4PD4E 1ZOYC 2L5GB 4JBZA 2IBZE 5DJTB 4KT0J 2RN0A 3RK2D 3AE6C 3RK3B 1SLQA 3M9HA 1RY3A 1GDTA 2Q6QA 1JNMA 2IYPA 5APQA 2OYHA 1Q82Q 3FWLA 3H1HD 1VQ9P 2P58A 1H0TA 2I8DA 1SQVG 4WWIA 1SQXD 1Y8AA 2E42A 2KP8A 3N7NA 2HODA 5KAIE 3U1AA 3RBXA 4DCKA 1SVFA 3AE2C 5AVWB 2IZ0A 2IDBA 2OYHC 3AEDC 2P10A 1KILA 1CZQA 3IN6A 4M3LA 4EOTA 4N3YB 1IK7A 1PP9E 1S9KD 2E76C 3E1IB 4BRYA 1UIIA 1QL1A 3SFEC 3HUSB 2P1JA 1L2PA 1PV3A 1D7MA 2MKVA 2HODC 3GHGB 5BVZA 4ZMDA 2ZT9C 2FFDB 2LXBA 1EZVE 2WT7A 4C7NB 1EQ7A 2HR3A 5APYA 1M1JB 1KILC 1DIPA 1EDIA 1LT1A 2NPSB 4UB6H 1ZP0C 1VQ6P 5B66H 1FDIA 1PP9J 2J3FD 3GMAA 1U57A 3KPEA 2YMKA 1N2DC 5APXA 1A02F 2Q9IA 3CD6P 1NTKE 2FYUG 1J1EB 1FZGB 1M1KQ 5CJ4A 3H25A 3V4QA 3KQGA 2BASA 1YBKA 1NHLA 3L74E 4EIJA 1MFTA 2JDIH 3WMM0 2ZYGA 3CI9A 1EXJA 1RH5B 2GUVA 2E74B 2O1KA 2OYOA 3L72J 4IL6E 3SWYA 4NPDA 2XNXA 4PV1B 1ZR4A 2Q9IC 2QJKB 1NTKJ 1FZEB 5APVA 3AE9C 1J1DC 3H1LG 1N86B 1S2EA 2KI7B 3L74J 2J64A 3GF7A 1IFJA 1XTGB 4ZKPA 2R3CA 2QM7A 3CL3D 4IFMA 2KYVA 3MTUE 5BU5A 4LC1A 2QM8A 3MUDA 3H1ID 2FYUD 3TNUA 2JP3A 3KYQA 4JYBA 3VMZA 2P2UA 4RKUJ 4BWNA 3U59A 2B89A 2XV5A 3HD7B 2A06E 5CBNA 3CCRP 3SFDC 1OMIA 1BDCA 2WSSH 3RBZA 1QL2A 1AFOA 1GW4A 2ZXEB 3VP8A 1SQXK 3HE5A 1DD4A 1SQPD 1S72P 3H32A 2KS1A 3B5ND 3TGUE 5KKZB 3MUDC 4HB1A 1LT9B 3L71G 4H0LC 1NU1G 5CCGD 3MZWB 4UB6E 1G1IA 5B66E 1WT6A 4K3AA 1OZHA 3PTZA 1MKMA 5TISH 2C0XA 2JHIF 2Q1KA 3F5HA 3H1HE 1BCCJ 3H32C 2E75D 2J0YA 1JB0J 2BCCE 1W2BO 4U3FG 2K37A 2NZ2A 5CCHD 4L75A 2R3SA 1AQ5A 2FXMA 1SQXE 5CBOA 2IYOA 2O01J 4D6TG 3L75G 1JTHA 3A0BE 1SQVK 1VF5B 3EFGA 5KLVG 2PP6A 3BCCG 4PJ0H 1QGKB 1ZV8A 2C0WA 3AECC 1T2KD 1L4AD 2XKMA 1N7SB 3O6QB 2O3JA 2AEMA 2BCCJ 4QMAA 1FZBA 4XFJA 3JSVC 3M9BA 1DEBA 1UIXA 3RK3C 1GTWA 1Q81Q 1PGQA 2OGUA 1JMBA 1HUCA 2RKLA 2E5TA 2D2CD 1FBMA 3B4SA 4H44D 1PIXA 1L0LJ 5GTIH 1SQVE 1NKZB 1FZCB 1FZBC 2QA4P 3E1IA 3HUSA 2ZYAA 2L91A 3B5NC 3GF3A 2QJYC 3BCCD 3GHGA 1OFCX 1HJBA 2FFDA 4C7NA 3M0DA 1M1JA 2M3BA 2QIWA 2QEXP 2NPSA 3P7KA 3A3YB 2FYUK 2J5ZA 4GODA 3E1IC 2Z5IA 3HUSC 1L0ND 3LIDA 2J2PA 4Y99B 3C1LA 5CCHC 1RF0B 3GHGC 2FFDC 3LIEA 2PRRA 1FZGA 2LKMA 1M1JC 2GUSA 3SSUA 3CC4P 1EDLA 1NTZG 2NPSC 4I6MC 5AW5B 1BGYG 1KB9E 2GY7A 4C7RA 1USDA 1T2KC 1SQQD 1LP1B 4PJ0E 3GW6A 1OIPA 2FYUE 1FICA 3AEGC 1NTMD 1WMKA 3L4FA 4PD4I 1FZEA 4N78E 4NYTA 1J1EC 2IBZI 1OW8A 1RE3B 4NPEA 2OARA 2D2CC 1LGHB 3VMXA 1URQB 3CLQA 1CI6B 1OX3A 4ZKUA 1G1JA 1PPJG 2QJKC 3S9OA 4B86A 1FZEC 3H1LE 1NTZD 3HD7A 2N9BA 1KYOE 2JHKF 1NU1K 3EFFK 2A45G 1TU3F 1Z3SA 3H1KD 1P84I 3CCQP 3TF5A 1YTZT 4ASWA 4YXWH 2YIUC 2E5YA 2ZJSE 1LT9A 2YXQB 1KZUB 2KZJA 1Q86Q 3R4YA 4AYCA 3H1LJ 2OQQA 3KZIH 2WTYA 3HD7C 2CK3H 1X0TA 4JZCA 2Z4EB 2ZAEB 1KILD 2GA1A 5KLIB 1EZVI 5AW4B 2WSCH 3L71E 4L76A 5KLVK 1NU1E 1PPJD 1A02J 1LT9C 1E79H 1LTJB 4H13B 2N1TD 4XE5B 3FXEA 2Y9YA 2SPZA 2C9LY 2HPCA 2CPSA 2J61B 1RF1B 3L73D 3C8VA 1R5SA 2FBWC 3D71A 4WY4B 2I1JA 3OW2O 1BCCD 1X8YA 3O6QA 1N7SA 3GLMA 2M5AB 3L71J 4U3FE 3V5BA 1NU1J 1VQ4P 3W67A 4AQRD 2BEZF 1SQBG 1LTBC 1VQPP 1PL5A 4D6TE 3L75E 2HPCC 4EDFA 5KLVE 3BCCE 1VF5C 1AVYA 2HLOA 2H8PD 1FZFB 4R9JA 1PZQA 1SQQK 1OVRA 1G2CB 1LTAC 4U3FJ 1RHZB 1FZCA 3CWBE 1NTMK 3OA7A 1AVOA 3II6A 4D6TJ 3L75J 1KTMA 2N1TA 2YXRB 2RH0A 3CX5H 4EI2A 5KTBA 2HLOC 2FYNB 2R5BA 1K9MQ 5AW9B 1L0LD 2B87A 1HJ0A 1YITP 1SQBD 2K9YA 4I2LC 2J59M 2O01N 3KZIE 5M1BA 5B5EH 3Q5PA 1FZCC 3CWBJ 4OGQB 3AE7C 3M06A 2A45H 1NTZK 1QX8A 3OAKA 3NMDA 5AVVB 2YO2A 5CJ0A 4H0LD 2N1TC 3M91A 1RF0A 2WSFJ 4IFDK 1BSHA 3M0AA 3F89A 1KQFB 2K88A 2WSEH 4WVZA 3H1IG 1QVGO 2KIKA 3CCMP 3FX0A 2B9BA 2O1JA 1OW7A 1LP1A 1EC5A 1BSNA 3H1JG 3V6IA 3NTNA 2JHHC 1YYCA 1FU1A 1NTZE 1MUUA 3WU2H 1SQPG 1N73B 1RE3A 1BGYE 1HWTC 4JQ0D 3TYYA 4HKZH 4JYCA 2WZ7A 3VMAA 3EWKA 1BE3D 4YPCA 4RESB 1VQLP 1CI6A 4TT3H 5AVXB 3W68A 1FE6A 3L70G 1T8ZA 1JY2N 4K35A 4BXLA 3AE4C 3HRNA 2HYNA 1OW6A 4L74A 3RK3D 2Q3EA 2YKQA 2XNXC 1OVVA 1BGYJ 1RE3C 2Q7CA 4LGDE 1NOHA 3AE3C 2FY8A 3V2PA 4AUWA 1KILE 3CPWO 3RL0B 1YJ9P 3H1JD 3L36A 3CX5E 1VQKP 1PPJE 1HGVA 2J3OA 5C39A 1DX7A 5B5EE 1EDJA 2OTKE 1S1CX 2H43B 2WVRA 1JM0A 1GZLA 4W80A 3CXHI 4WB4A 3OJAB 3WUVA 5DJUB 3B71A 2C9NY 2UWJE 5AVRB 3L70D 2I1KA 1LTJA 3VYIA 1JUNA 3L35A 3B8EB 3TK1A 3CC2P 3TGUJ 4CPGA 3M9QA 2J61A 2JHMF 1GK6A 1GL2B 1RF1A 1IO4A 1M56D 1SQBK 1H8AA 2J5UA 3IF4A 3ZDMA 4DJGA 4WY4A 3G3ZA 4JPZB 5KLIC 1S5LH 2M5AA 2NPSD 3VN0A 2WSEJ 4M7FA 1W2EA 1LTJC 3WU2E 2ZFCA 1SFCB 2W83C 4OVNF 3CCSP 1KB9I 3H1HJ 2KOGA 2KSEA 1K05A 2K9JB 2P67A 1RF1C 3D6YA 2AXTH 1OWAA 5KJ7D 1S9KE 4GIFA 3HE4B 1FZFA 1SQXJ 4LLHA 3TDKA 3V2RA 3CCEP 2IFNA 1L0NG 1K8AQ 1G2CA 3FWNA 3BRVB 1SQBE 2ZVNB 1KQSO 2E74D 1Y9BA 4PD4D 3C9IA 2QVAA 1S5LX 1S3JA 3NFQA 4PV1D 2E76B 2IBZD 2Q3IA 4UB8H 1HGZA 3WUUA 2M3EA 1JMMA 4JF7A 1FZFC 3SWKA 3A0HH 1SQQG 1HVVA 5AVUB 2D39A 1EXIA 5H2FH 3IR9A 2JWDA 3NXSA 1KYOI 1KD1Q 1FDMA 1NTMG 2XZRA 1M8OB 5AVYB 1X79B 4DZOA 1SQVJ 1FIDA 3BRTB 4R4LA 3MIWA 4ZNCA 3JCUH 3L72G 1YHQP 4HYTB 5TISE 3A2AA 2QSIA 3HD7D 1P84D 5KJ7A 2J1GA 2KNCB 3E1RA 2QRXA 3CCJP 3RK2B 3M0DC 2E43A 4HH2A 1AV1A 1SQPK 4OGQC 1LWUB 1U7MA 1PP9D 5AW7B 1YIJP 1RE4B 2B88A 1X22A 3FGAD 3H1KG 4XA4A 4DOJA 1J2JB 4JYOX 2JHLF 3H1IE 3RK3E 3IFMA 5AVQB 1EZVD 5KJ7C 1M57D 3Q2YA 1HF9A 3P32A 3AE1C 1HTLC 1FIBA 1FZGC 3ABVC 1IC2A 1NGMB 2AXTE 1N86A 3E7KA 3H1JE 5AW2B 2IZ1A 1XTCC 3AE5C 1KN7A 3A5TA 3AEEC 3L72D 4W7ZA 2E74C 1SQPE 2VRSA 2GM4A 4PV1C 5CMZA 1NTKD 2FYUJ 1VF5D 4KJMA 5AVZB 3RL0g 5GTIE 3L74D 1LTSC 1IFDA 4OH8B 1DH3A 1N7SD 1N86C 4UB8E 1Q7YQ 1NWQA 2JWAA 2K1AA 2M0BA 3L73G 3L70E 2W90A 1JCCA 1P84H 1BCCG 1LJ2A 1QVFO 3LW5H 2H43A 2WMMA 2ITAA 1HBWA 2OYIB 2M8RA 3RL0C 3JCUE 4EPUA 4YXDC 2XU6A 3HE5B 4TLFA 4DT0A 3D70A 1CSBA 5KKZC 1GL2A 5AVSB 3V2QA 3P8MC 3CMAP 1IFPA 3I55P 1VQ5P 3Q5SA 2IX7C 1JY3N 1YJWP 3H6PA 1SFCA 3P8CD 1L0NK 3T97B 1JY2O 5K5GB 1L0LG 1Q90D 2K9JA 1GL2C 1Z56A 2YO3A 3HE4A 4GDOA 2XNDH 3VOPA 2IPPA 5APSA 2AEFA 3MP7B 1JTHB 1NVOA 3PRJA 4IL6H 2Y9ZA 3PP5A 4YTPC 4WBAA 5CHXA 1SFCC 2KZIA 1MZ9A 1N7SC 1W5CE 4GKGA 2BCCD 2Q5UA 1FZBB 1KFNA 2JKVA 1KC8Q 3AEFC 2DW3A 3B5NB 2Y0EA 1L0NE 2QJYB 3L37A 1H89A 1VPCA 5KLVJ 1P84E 5AW6B 3BCCJ 2OTLP 5BU8B 2G3AA 2N9YB 2J60A 1SS1A 1NH4A 1URQD 5E79H 1NTKK 1PFIA 5EFWB 1FZDA 5APUA 1KMIZ 4IL6X 2YMYA 3K5BA 3S1KA 3CX5I 3WUTA 1SQQE 2E75B 4RJTA 1BE3G 2PFXA 1L0NJ 2J58A 5AW1B 4ZFGA 2KNCA 1NTME 2HFED 3EQ2A 2A45I 1KQGB 1PGJA 1LWUA 2Z5HA 3LW5J 1GW3A 5TJHA 1SQVD 1IK9A 4A7PA 2O01H
chains in the Genus database with same CATH topology
2J61A 1L4AB 1GK6A 1FZGA 1GL2B 1RF1A 1IO4A 1RE4A 2LKMA 1JY3P 1IFNA 1SQBK 1M1JC 2GUSA 1LTTC 1H8AA 4WY4A 3G3ZA 2NPSC 4I6MC 5AW5B 4Y99C 1ZLLA 3MD0A 2GY7A 1RF0C 4C7RA 1T2KC 3RK2C 2L5GB 2NPSD 3UIAA 3VN0A 4M7FA 5AVTB 1MFZA 2J3GA 1LWUC 1W2EA 1LTJC 1NKNA 2ZFCA 2JEEA 1SFCB 3RK2D 1FICA 3RK3B 1SLQA 2KOGA 1RY3A 3M9HA 1GDTA 3L4FA 2MJZA 1JNMA 1FZEA 4N78E 4NYTA 1J1EC 1URQA 2P67A 5APQA 1RF1C 2OYHA 1RE4C 1OWAA 5KJ7D 1S9KE 4GIFA 3HE4B 1RE3B 1FZFA 2OARA 4LLHA 3V2RA 1FZAB 2IFNA 4GT1A 1G2CA 1LGHB 3VMXA 1URQB 3CLQA 3BRVB 1CI6B 4WY4D 2W6AA 4ZKUA 1G1JA 3BASA 3BVHB 2E42A 2KP8A 3N7NA 2WNPF 2R32A 2YNYA 2HODA 2J0GA 3C9IA 1KFMA 3U1AA 1FJKA 4B86A 5APWA 1FZEC 1SVFA 3NFQA 3HTKB 1URQC 5AVWB 3HD7A 2OYHC 2N9BA 2Q3IA 2JHKF 1KILA 1NU1K 1HGZA 2J3FA 1JMMA 4JF7A 1CZQA 1FZFC 4M3LA 4EOTA 2A45G 1HH0A 1HVVA 1Z3SA 5AVUB 2D39A 4N78D 3M9QA 3IR9A 4N3YB 1S9KD 1ZR2A 3NXSA 2OYIA 1YTZT 3E1IB 1FDMA 1QL1A 3HUSB 1WRGA 1LT9A 2P1JA 2XZRA 1KZUB 2HODC 5AVYB 2Z4EA 1X79B 3GHGB 4AYCA 4DZOA 5BVZA 1M7LA 1FIDA 2FFDB 3BRTB 2WT7A 3P8CE 4C7NB 2WTYA 3HD7C 3MIWA 4IFFA 1EQ7A 5APYA 1M1JB 1KILC 1MV8A 4HYTB 3A2AA 2NPSB 3HD7D 4JZCA 2Z4EB 5KJ7A 1KILD 2J1GA 1LTGC 5AW4B 2WSCH 2J3FD 3RK2B 1L0LK 2OYIC 5KLVK 3M0DC 2E43A 4HH2A 1A02J 1T3UA 1SQPK 1LT9C 1LWUB 1LTJB 3KPEA 1KQLA 2N1TD 4XE5B 1N2DC 5APXA 3U1CA 1A02F 2Q9IA 2Z4EC 2C9LY 2HPCA 2CPSA 2J61B 1J1EB 3T97A 1FZGB 1E5WA 5AW7B 1RF1B 1RE4B 5CJ4A 3V4QA 3KQGA 2BASA 1NHLA 4EIJA 4XA4A 4DOJA 1J2JB 4WY4B 4JYOX 2JHLF 2I1JA 3WMM0 3IFMA 2CPBA 5AVQB 5KJ7C 2HPCB 1X8YA 1N7SA 3CI9A 2GUVA 2O1KA 3P32A 1HTLC 3V5BA 1FIBA 1FZGC 1IC2A 5AW0B 4AQRD 3SWYA 1N86A 1SP4A 3FIBA 1LTBC 2XNXA 1ZR4A 4C46A 5AW2B 4WY4C 2Q9IC 1XTCC 1GD2E 3A5TA 2HPCC 1FZEB 1IFMA 5APVA 4W7ZA 1JY2P 2KLVA 2OYHB 1J1DC 3O8ZA 1N86B 2VRSA 2GM4A 1JCDA 2HLOA 2H8PD 2J64A 5CMZA 4R9JA 1FZFB 5AW8B 3B5NA 1H88A 1SQQK 2H7HA 2YKOA 1IFJA 1XTGB 5AVZB 1G2CB 4ZKPA 2R3CA 5CCGA 1LTAC 2QM7A 3CL3D 2WPQA 4IFMA 1CW5A 2KYVA 1FZCA 3MTUE 5BU5A 1LTSC 2QM8A 1IFDA 3MUDA 4LC1A 4OH8B 1GU5A 1DH3A 2HLOB 1NTMK 1N7SD 1N86C 2FYZA 3TNUA 2J3UA 3OA7A 3KYQA 1NWQA 3II6A 2HODB 4JYBA 3VMZA 3VP9A 5APTA 2P2UA 3U59A 1JCCA 2N1TA 1OXZA 2XV5A 3HD7B 4W7YA 1VDFA 1KILB 1FOSE 5KTBA 2HLOC 3MGNA 2R5BA 3LW5H 2H43A 1QL2A 5AW9B 1AFOA 1GW4A 2ZXEB 3VP8A 1SQXK 3HE5A 2POHA 2N1TB 4I2LC 4KHXA 5CCHA 2J59M 4M7HA 5CCGC 1HBWA 3H32A 2OYIB 3B5ND 2M8RA 1FZCC 1FAVA 3RL0C 1LT9B 4EPUA 3M06A 2IFMA 1JY3O 2A45H 2XU6A 5CCGD 1NTZK 2WPSA 3OAKA 3NMDA 1G1IA 5AVVB 2YO2A 3RL0D 3V4WA 5CJ0A 3HE5B 2HG5D 1WT6A 2WT7B 2N1TC 3M91A 1RF0A 4IFDK 3M0AA 2W27A 1L4AA 1CSBA 1GL2A 2WSEH 5AVSB 4I1LA 2C0XA 3V2QA 3P8MC 2WWWA 2PAJA 2JHIF 3V2NA 3H32C 2O1JA 2WPRA 2J0YA 2IX7C 1JY3N 5CCHD 3H6PA 3VMYA 2Q9IB 1N73A 2FKWB 1IJDB 2FXMA 1AQ5A 4N6JA 5AW3B 1SFCA 3P8CD 2R5DA 1L0NK 2JHMF 1JTHA 1JY2O 1SQVK 3NTNA 1YYCA 3EFGA 2JHHC 1J1DB 2KB7P 1FU1A 1L4AC 2PP6A 1GL2C 1Z56A 1MUUA 1N73B 1ZV8A 2YO3A 2C0WA 3A7OA 3HE4A 1RE3A 1ZN5A 1HWTC 1T2KD 3VOPA 1L4AD 2YKPA 2XKMA 1N7SB 1GL2D 3TYYA 2IPPA 1T3JA 4JYCA 5APSA 2WZ7A 1FZAA 1JTHB 4RESB 3VTPC 1CI6A 1FZBA 2XNXB 3PP5A 1N7LA 2P7JA 1N73C 3BVHA 1FJPA 3M9BA 4WBAA 5CHXA 1SFCC 1DEBA 1MZ9A 1N7SC 5AVXB 3RK3C 1JO5A 1GTWA 1T8ZA 4GKGA 1JY2N 1LTIC 2Q5UA 3R2PA 3HRNA 1SFCD 3HTKA 2HYNA 1KFNA 1FZBB 1HUCA 3RK3D 2YKQA 2XNXC 1GU4A 3B5NB 1YTZI 1FBMA 1RE3C 2Q7CA 4LGDE 1NOHA 1Z3UA 3L37A 1H89A 1FZAC 1VPCA 3V2PA 5AW6B 1NKZB 1FZCB 3TSIA 4AUWA 3RL0B 1FZBC 3E1IA 3L36A 3TNUB 2FIBA 4R9TA 3HUSA 1JOCA 5BU8B 1NAFA 2J60A 3B5NC 3BVHC 1URQD 1NH4A 3N4XA 1X9VA 1HGVA 2JJLA 2J3OA 3GHGA 1NTKK 1PFIA 1HJBA 2FFDA 1FZDA 2WSFH 3KDPB 5APUA 1DX7A 4O9BA 1IFIA 2YMYA 4C7NA 3M0DA 1M1JA 2H43B 2W6BA 2M3BA 1GZLA 2NPSA 3P7KA 2J58A 4W80A 4WB4A 3A3YB 2FYUK 1GK4A 5AW1B 2J5ZA 4ZFGA 2XDJA 3H32B 3OJAB 1NO4A 2C9NY 5AVRB 2HFED 3EQ2A 2KSJA 3E1IC 2Z5IA 2A45I 3HUSC 2H43C 2I1KA 3LIDA 1LWUA 2Z5HA 1LTJA 3VYIA 1FOSF 1GW3A 3SWFA 1JUNA 3I5CA 2WITA 3L35A 2J2PA 4Y99B 1IK9A 2J0HA 3BATA 3B8EB 3TK1A 5CCHC 2O01H 1RF0B 3GHGC 1JC9A 2FFDC 3LIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J61 A;  1FZC A;  1FZG A;  2HOD C;  1RF1 A;  1RE4 A;  1JY3 P;  2Z4E A;  2HLO B;  3GHG B;  1N86 C;  1M1J C;  1FID A;  1FZA A;  2FFD B;  2J3U A;  2HOD B;  1FZB A;  1M1J B;  2XNX B;  2GY7 A;  1RF0 C;  1N73 C;  3BVH A;  4JZC A;  2Z4E B;  2J1G A;  4M7F A;  2HLO C;  2J3G A;  2J3F D;  1LWU C;  1W2E A;  1LTJ C;  2H43 A;  1JY2 N;  2OYI C;  1FIC A;  1FZB B;  1T3U A;  1LT9 C;  1LWU B;  1LTJ B;  2XNX C;  4M7H A;  1FZE A;  3H32 A;  2OYI B;  1RE3 C;  4NYT A;  2Q9I A;  1FZC C;  1RF1 C;  2OYH A;  1RE4 C;  2Z4E C;  1LT9 B;  1Z3U A;  4EPU A;  2HPC A;  1JY3 O;  2A45 H;  1FZA C;  1RE3 B;  2J61 B;  1FZC B;  1FZG B;  1RF1 B;  1RE4 B;  1FZF A;  1FZB C;  3E1I A;  1FZA B;  2FIB A;  4R9T A;  3HUS A;  1RF0 A;  2J60 A;  4JYO X;  3BVH C;  2JHL F;  2HPC B;  2J3O A;  3GHG A;  3BVH B;  2FFD A;  1FZD A;  2WNP F;  1FIB A;  2JHI F;  1FZG C;  2HOD A;  2J0G A;  1N86 A;  1M1J A;  2H43 B;  3FIB A;  2XNX A;  1FZE C;  3H32 C;  2Q9I C;  2J0Y A;  2OYH C;  2JHK F;  2HPC C;  2J5Z A;  1JY3 N;  1FZE B;  4ZFG A;  3H32 B;  1JY2 P;  2J3F A;  2Q9I B;  1N73 A;  2OYH B;  1FZF C;  2A45 G;  1Z3S A;  2D39 A;  1N86 B;  3E1I C;  2A45 I;  2HLO A;  3HUS C;  2H43 C;  1LWU A;  2J64 A;  1LTJ A;  1FZF B;  4R9J A;  1JY2 O;  2JHH C;  2J2P A;  2OYI A;  3E1I B;  2J0H A;  3HUS B;  1LT9 A;  1RF0 B;  3GHG C;  1N73 B;  1JC9 A;  2FFD C;  1RE3 A;  2JHM F; 
#chains in the Genus database with same CATH topology
 1L4A B;  3L72 E;  2QJP B;  2KK7 A;  1ZW0 A;  1RE4 A;  1JY3 P;  2W8Z A;  5L8R J;  1SQQ J;  3CXH D;  4Y99 C;  3MD0 A;  4RO0 A;  2AEJ A;  2WSC J;  1RF0 C;  1AQT A;  1AA0 A;  1T6A A;  1NTM J;  1BDD A;  3RK2 C;  2PGD A;  3UIA A;  2LR2 A;  5AVT B;  1MFZ A;  2J3G A;  1LWU C;  3PLN A;  1NKN A;  2JEE A;  3RGU A;  2D2C B;  2MJZ A;  4H13 D;  3A0B H;  3H1K E;  4H44 B;  3CME P;  1URQ A;  3GG2 A;  1RE4 C;  1R8E A;  5GTH H;  3CCU P;  3PJS K;  1YI2 P;  1FZA B;  4GT1 A;  4MN4 C;  1U7J A;  4WY4 D;  2W6A A;  1NTZ J;  3BAS A;  3BVH B;  2WNP F;  2R32 A;  2YNY A;  1KB9 D;  2KUB A;  2J0G A;  1KFM A;  1FJK A;  5APW A;  3H1K J;  3HTK B;  4I7Z B;  1URQ C;  2YIU B;  1IZN B;  1FC2 C;  1USE A;  2J3F A;  2H89 C;  1HH0 A;  5E79 E;  1VQO P;  4N78 D;  1YJN P;  3ITK A;  1ZR2 A;  2OYI A;  1WRG A;  3L73 E;  2Z4E A;  3CXH H;  1M7L A;  3CCV P;  1BCC E;  3P8C E;  4IFF A;  1Q2N A;  1MV8 A;  1ZME C;  3JC2 2;  3H1L D;  1LTG C;  1KYO D;  1L0L K;  2OYI C;  3QH9 A;  3AEB C;  3L73 J;  1T3U A;  2RMZ A;  1DD3 A;  1KQL A;  3U1C A;  2IBZ G;  1FS0 E;  2Z4E C;  2FXO A;  2WQY C;  4OGQ D;  3T97 A;  1E5W A;  2QE7 H;  1PGP A;  4H13 C;  2LXC B;  1ZRT D;  3PH0 A;  2CPB A;  2HPC B;  1KB9 H;  4L73 A;  4U7J A;  3QWO C;  5AW0 B;  2FXP A;  1SP4 A;  3FIB A;  1NAY A;  4C46 A;  2OTJ P;  2V7Q H;  5GTH E;  4WY4 C;  3CCL P;  3G6E P;  1GD2 E;  2KXP B;  3L71 D;  1IFM A;  1JY2 P;  1L0L E;  1NU1 D;  2BEQ D;  2KLV A;  1OVU A;  2OYH B;  4GOE A;  2W6J H;  3O8Z A;  1JCD A;  3CWB G;  5AW8 B;  3B5N A;  1H88 A;  2H7H A;  2YKO A;  3PHL A;  1DEE G;  1H0T B;  5CCG A;  1CW5 A;  2WPQ A;  1GMJ A;  1PP9 G;  1GU5 A;  1EDK A;  1VQM P;  2ZVO B;  2HLO B;  2FYZ A;  2J3U A;  2HOD B;  3VP9 A;  5APT A;  4U3F D;  2ZT9 B;  1OXZ A;  4W7Y A;  1SQB J;  1QLE D;  1VDF A;  1KIL B;  1EZV G;  1KYO H;  1FOS E;  3MGN A;  4D6T D;  3L75 D;  5KLV D;  1AJY A;  3MHV A;  1YQ3 C;  3CXH E;  2POH A;  2N1T B;  4KHX A;  4IOI H;  5CCH A;  4M7H A;  5CCG C;  1LNQ A;  4BRY B;  1FAV A;  1KOR A;  3Q5R A;  2IFM A;  1JY3 O;  1NJI Q;  5KAF H;  2FYN C;  3G9R A;  2WPS A;  2B87 B;  3RL0 D;  3V4W A;  2HG5 D;  2WT7 B;  3CWB D;  1NTK G;  2W27 A;  1L4A A;  4OWF A;  1BE3 E;  1Y47 A;  4I1L A;  1YQ4 C;  2WWW A;  2E75 C;  2PAJ A;  3L74 G;  1RQV A;  2NRG A;  1S4X A;  3V2N A;  2V4H A;  1S5L E;  1JEK A;  2WPR A;  1QEX A;  3VMY A;  2Q9I B;  1N73 A;  2FKW B;  1IJD B;  4N6J A;  5AW3 B;  2R5D A;  3KHU A;  4PD4 H;  3IAO A;  3I56 P;  4R4M A;  1K73 Q;  3USS A;  1J1D B;  3FXD A;  2KB7 P;  1FDO A;  1L4A C;  1BE3 J;  2QJP C;  2JO1 A;  2JR8 A;  3A7O A;  3S4R A;  1ZN5 A;  2YKP A;  2KLU A;  1GL2 D;  2ZXX A;  1T3J A;  1FZA A;  4EYY Q;  1R5L A;  4HJG H;  4Y28 J;  1ZXG A;  3VTP C;  1VQ8 P;  2XNX B;  1N7L A;  2P7J A;  3H1I J;  3BVH A;  1N73 C;  1FJP A;  1VQ7 P;  1JO5 A;  2WPV B;  1LTI C;  3G71 P;  3R2P A;  4H44 C;  1SFC D;  2AXC A;  3HTK A;  1N8R Q;  2A06 G;  1GU4 A;  3H1J J;  1YTZ I;  3AE8 C;  2V7Q J;  3A0H E;  5KAI H;  3Q3D A;  1Z3U A;  5H2F E;  1FZA C;  3TSI A;  1SQP J;  4H0L B;  4GOF A;  3TNU B;  2FIB A;  3TGU G;  4R9T A;  1BGY D;  2QG4 A;  4ASV A;  1JOC A;  1NAF A;  3BVH C;  3N4X A;  1NYH A;  1X9V A;  1VQN P;  2JJL A;  1KV4 A;  1VL2 A;  2WSF H;  3KDP B;  4O9B A;  1IFI A;  2K3R A;  4I7Z C;  3AEA C;  2G8Y A;  3KXD A;  2W6B A;  5KAF E;  3L70 J;  2E76 D;  3Q1M A;  1GK4 A;  2XDJ A;  1ZRT E;  3H32 B;  2KS1 B;  1M90 Q;  1NO4 A;  3H1H G;  2H88 C;  2KSJ A;  1RQU A;  2H43 C;  2ZT9 D;  2BCC G;  1FOS F;  3D6Z A;  3SWF A;  2ZYD A;  3I5C A;  2WIT A;  3CC7 P;  2J0H A;  2A06 D;  3BAT A;  3G4S P;  1SQX G;  1JC9 A;  3CX5 D;  2Y0C A;  1IFN A;  2Y0D A;  2R44 A;  1LTT C;  1K04 A;  4Z1M H;  3TGU D;  1PGO A;  1ZLL A;  4NPF X;  4PD4 E;  1ZOY C;  2L5G B;  4JBZ A;  2IBZ E;  5DJT B;  4KT0 J;  2RN0 A;  3RK2 D;  3AE6 C;  3RK3 B;  1SLQ A;  3M9H A;  1RY3 A;  1GDT A;  2Q6Q A;  1JNM A;  2IYP A;  5APQ A;  2OYH A;  1Q82 Q;  3FWL A;  3H1H D;  1VQ9 P;  2P58 A;  1H0T A;  2I8D A;  1SQV G;  4WWI A;  1SQX D;  1Y8A A;  2E42 A;  2KP8 A;  3N7N A;  2HOD A;  5KAI E;  3U1A A;  3RBX A;  4DCK A;  1SVF A;  3AE2 C;  5AVW B;  2IZ0 A;  2IDB A;  2OYH C;  3AED C;  2P10 A;  1KIL A;  1CZQ A;  3IN6 A;  4M3L A;  4EOT A;  4N3Y B;  1IK7 A;  1PP9 E;  1S9K D;  2E76 C;  3E1I B;  4BRY A;  1UII A;  1QL1 A;  3SFE C;  3HUS B;  2P1J A;  1L2P A;  1PV3 A;  1D7M A;  2MKV A;  2HOD C;  3GHG B;  5BVZ A;  4ZMD A;  2ZT9 C;  2FFD B;  2LXB A;  1EZV E;  2WT7 A;  4C7N B;  1EQ7 A;  2HR3 A;  5APY A;  1M1J B;  1KIL C;  1DIP A;  1EDI A;  1LT1 A;  2NPS B;  4UB6 H;  1ZP0 C;  1VQ6 P;  5B66 H;  1FDI A;  1PP9 J;  2J3F D;  3GMA A;  1U57 A;  3KPE A;  2YMK A;  1N2D C;  5APX A;  1A02 F;  2Q9I A;  3CD6 P;  1NTK E;  2FYU G;  1J1E B;  1FZG B;  1M1K Q;  5CJ4 A;  3H25 A;  3V4Q A;  3KQG A;  2BAS A;  1YBK A;  1NHL A;  3L74 E;  4EIJ A;  1MFT A;  2JDI H;  3WMM 0;  2ZYG A;  3CI9 A;  1EXJ A;  1RH5 B;  2GUV A;  2E74 B;  2O1K A;  2OYO A;  3L72 J;  4IL6 E;  3SWY A;  4NPD A;  2XNX A;  4PV1 B;  1ZR4 A;  2Q9I C;  2QJK B;  1NTK J;  1FZE B;  5APV A;  3AE9 C;  1J1D C;  3H1L G;  1N86 B;  1S2E A;  2KI7 B;  3L74 J;  2J64 A;  3GF7 A;  1IFJ A;  1XTG B;  4ZKP A;  2R3C A;  2QM7 A;  3CL3 D;  4IFM A;  2KYV A;  3MTU E;  5BU5 A;  4LC1 A;  2QM8 A;  3MUD A;  3H1I D;  2FYU D;  3TNU A;  2JP3 A;  3KYQ A;  4JYB A;  3VMZ A;  2P2U A;  4RKU J;  4BWN A;  3U59 A;  2B89 A;  2XV5 A;  3HD7 B;  2A06 E;  5CBN A;  3CCR P;  3SFD C;  1OMI A;  1BDC A;  2WSS H;  3RBZ A;  1QL2 A;  1AFO A;  1GW4 A;  2ZXE B;  3VP8 A;  1SQX K;  3HE5 A;  1DD4 A;  1SQP D;  1S72 P;  3H32 A;  2KS1 A;  3B5N D;  3TGU E;  5KKZ B;  3MUD C;  4HB1 A;  1LT9 B;  3L71 G;  4H0L C;  1NU1 G;  5CCG D;  3MZW B;  4UB6 E;  1G1I A;  5B66 E;  1WT6 A;  4K3A A;  1OZH A;  3PTZ A;  1MKM A;  5TIS H;  2C0X A;  2JHI F;  2Q1K A;  3F5H A;  3H1H E;  1BCC J;  3H32 C;  2E75 D;  2J0Y A;  1JB0 J;  2BCC E;  1W2B O;  4U3F G;  2K37 A;  2NZ2 A;  5CCH D;  4L75 A;  2R3S A;  1AQ5 A;  2FXM A;  1SQX E;  5CBO A;  2IYO A;  2O01 J;  4D6T G;  3L75 G;  1JTH A;  3A0B E;  1SQV K;  1VF5 B;  3EFG A;  5KLV G;  2PP6 A;  3BCC G;  4PJ0 H;  1QGK B;  1ZV8 A;  2C0W A;  3AEC C;  1T2K D;  1L4A D;  2XKM A;  1N7S B;  3O6Q B;  2O3J A;  2AEM A;  2BCC J;  4QMA A;  1FZB A;  4XFJ A;  3JSV C;  3M9B A;  1DEB A;  1UIX A;  3RK3 C;  1GTW A;  1Q81 Q;  1PGQ A;  2OGU A;  1JMB A;  1HUC A;  2RKL A;  2E5T A;  2D2C D;  1FBM A;  3B4S A;  4H44 D;  1PIX A;  1L0L J;  5GTI H;  1SQV E;  1NKZ B;  1FZC B;  1FZB C;  2QA4 P;  3E1I A;  3HUS A;  2ZYA A;  2L91 A;  3B5N C;  3GF3 A;  2QJY C;  3BCC D;  3GHG A;  1OFC X;  1HJB A;  2FFD A;  4C7N A;  3M0D A;  1M1J A;  2M3B A;  2QIW A;  2QEX P;  2NPS A;  3P7K A;  3A3Y B;  2FYU K;  2J5Z A;  4GOD A;  3E1I C;  2Z5I A;  3HUS C;  1L0N D;  3LID A;  2J2P A;  4Y99 B;  3C1L A;  5CCH C;  1RF0 B;  3GHG C;  2FFD C;  3LIE A;  2PRR A;  1FZG A;  2LKM A;  1M1J C;  2GUS A;  3SSU A;  3CC4 P;  1EDL A;  1NTZ G;  2NPS C;  4I6M C;  5AW5 B;  1BGY G;  1KB9 E;  2GY7 A;  4C7R A;  1USD A;  1T2K C;  1SQQ D;  1LP1 B;  4PJ0 E;  3GW6 A;  1OIP A;  2FYU E;  1FIC A;  3AEG C;  1NTM D;  1WMK A;  3L4F A;  4PD4 I;  1FZE A;  4N78 E;  4NYT A;  1J1E C;  2IBZ I;  1OW8 A;  1RE3 B;  4NPE A;  2OAR A;  2D2C C;  1LGH B;  3VMX A;  1URQ B;  3CLQ A;  1CI6 B;  1OX3 A;  4ZKU A;  1G1J A;  1PPJ G;  2QJK C;  3S9O A;  4B86 A;  1FZE C;  3H1L E;  1NTZ D;  3HD7 A;  2N9B A;  1KYO E;  2JHK F;  1NU1 K;  3EFF K;  2A45 G;  1TU3 F;  1Z3S A;  3H1K D;  1P84 I;  3CCQ P;  3TF5 A;  1YTZ T;  4ASW A;  4YXW H;  2YIU C;  2E5Y A;  2ZJS E;  1LT9 A;  2YXQ B;  1KZU B;  2KZJ A;  1Q86 Q;  3R4Y A;  4AYC A;  3H1L J;  2OQQ A;  3KZI H;  2WTY A;  3HD7 C;  2CK3 H;  1X0T A;  4JZC A;  2Z4E B;  2ZAE B;  1KIL D;  2GA1 A;  5KLI B;  1EZV I;  5AW4 B;  2WSC H;  3L71 E;  4L76 A;  5KLV K;  1NU1 E;  1PPJ D;  1A02 J;  1LT9 C;  1E79 H;  1LTJ B;  4H13 B;  2N1T D;  4XE5 B;  3FXE A;  2Y9Y A;  2SPZ A;  2C9L Y;  2HPC A;  2CPS A;  2J61 B;  1RF1 B;  3L73 D;  3C8V A;  1R5S A;  2FBW C;  3D71 A;  4WY4 B;  2I1J A;  3OW2 O;  1BCC D;  1X8Y A;  3O6Q A;  1N7S A;  3GLM A;  2M5A B;  3L71 J;  4U3F E;  3V5B A;  1NU1 J;  1VQ4 P;  3W67 A;  4AQR D;  2BEZ F;  1SQB G;  1LTB C;  1VQP P;  1PL5 A;  4D6T E;  3L75 E;  2HPC C;  4EDF A;  5KLV E;  3BCC E;  1VF5 C;  1AVY A;  2HLO A;  2H8P D;  1FZF B;  4R9J A;  1PZQ A;  1SQQ K;  1OVR A;  1G2C B;  1LTA C;  4U3F J;  1RHZ B;  1FZC A;  3CWB E;  1NTM K;  3OA7 A;  1AVO A;  3II6 A;  4D6T J;  3L75 J;  1KTM A;  2N1T A;  2YXR B;  2RH0 A;  3CX5 H;  4EI2 A;  5KTB A;  2HLO C;  2FYN B;  2R5B A;  1K9M Q;  5AW9 B;  1L0L D;  2B87 A;  1HJ0 A;  1YIT P;  1SQB D;  2K9Y A;  4I2L C;  2J59 M;  2O01 N;  3KZI E;  5M1B A;  5B5E H;  3Q5P A;  1FZC C;  3CWB J;  4OGQ B;  3AE7 C;  3M06 A;  2A45 H;  1NTZ K;  1QX8 A;  3OAK A;  3NMD A;  5AVV B;  2YO2 A;  5CJ0 A;  4H0L D;  2N1T C;  3M91 A;  1RF0 A;  2WSF J;  4IFD K;  1BSH A;  3M0A A;  3F89 A;  1KQF B;  2K88 A;  2WSE H;  4WVZ A;  3H1I G;  1QVG O;  2KIK A;  3CCM P;  3FX0 A;  2B9B A;  2O1J A;  1OW7 A;  1LP1 A;  1EC5 A;  1BSN A;  3H1J G;  3V6I A;  3NTN A;  2JHH C;  1YYC A;  1FU1 A;  1NTZ E;  1MUU A;  3WU2 H;  1SQP G;  1N73 B;  1RE3 A;  1BGY E;  1HWT C;  4JQ0 D;  3TYY A;  4HKZ H;  4JYC A;  2WZ7 A;  3VMA A;  3EWK A;  1BE3 D;  4YPC A;  4RES B;  1VQL P;  1CI6 A;  4TT3 H;  5AVX B;  3W68 A;  1FE6 A;  3L70 G;  1T8Z A;  1JY2 N;  4K35 A;  4BXL A;  3AE4 C;  3HRN A;  2HYN A;  1OW6 A;  4L74 A;  3RK3 D;  2Q3E A;  2YKQ A;  2XNX C;  1OVV A;  1BGY J;  1RE3 C;  2Q7C A;  4LGD E;  1NOH A;  3AE3 C;  2FY8 A;  3V2P A;  4AUW A;  1KIL E;  3CPW O;  3RL0 B;  1YJ9 P;  3H1J D;  3L36 A;  3CX5 E;  1VQK P;  1PPJ E;  1HGV A;  2J3O A;  5C39 A;  1DX7 A;  5B5E E;  1EDJ A;  2OTK E;  1S1C X;  2H43 B;  2WVR A;  1JM0 A;  1GZL A;  4W80 A;  3CXH I;  4WB4 A;  3OJA B;  3WUV A;  5DJU B;  3B71 A;  2C9N Y;  2UWJ E;  5AVR B;  3L70 D;  2I1K A;  1LTJ A;  3VYI A;  1JUN A;  3L35 A;  3B8E B;  3TK1 A;  3CC2 P;  3TGU J;  4CPG A;  3M9Q A;  2J61 A;  2JHM F;  1GK6 A;  1GL2 B;  1RF1 A;  1IO4 A;  1M56 D;  1SQB K;  1H8A A;  2J5U A;  3IF4 A;  3ZDM A;  4DJG A;  4WY4 A;  3G3Z A;  4JPZ B;  5KLI C;  1S5L H;  2M5A A;  2NPS D;  3VN0 A;  2WSE J;  4M7F A;  1W2E A;  1LTJ C;  3WU2 E;  2ZFC A;  1SFC B;  2W83 C;  4OVN F;  3CCS P;  1KB9 I;  3H1H J;  2KOG A;  2KSE A;  1K05 A;  2K9J B;  2P67 A;  1RF1 C;  3D6Y A;  2AXT H;  1OWA A;  5KJ7 D;  1S9K E;  4GIF A;  3HE4 B;  1FZF A;  1SQX J;  4LLH A;  3TDK A;  3V2R A;  3CCE P;  2IFN A;  1L0N G;  1K8A Q;  1G2C A;  3FWN A;  3BRV B;  1SQB E;  2ZVN B;  1KQS O;  2E74 D;  1Y9B A;  4PD4 D;  3C9I A;  2QVA A;  1S5L X;  1S3J A;  3NFQ A;  4PV1 D;  2E76 B;  2IBZ D;  2Q3I A;  4UB8 H;  1HGZ A;  3WUU A;  2M3E A;  1JMM A;  4JF7 A;  1FZF C;  3SWK A;  3A0H H;  1SQQ G;  1HVV A;  5AVU B;  2D39 A;  1EXI A;  5H2F H;  3IR9 A;  2JWD A;  3NXS A;  1KYO I;  1KD1 Q;  1FDM A;  1NTM G;  2XZR A;  1M8O B;  5AVY B;  1X79 B;  4DZO A;  1SQV J;  1FID A;  3BRT B;  4R4L A;  3MIW A;  4ZNC A;  3JCU H;  3L72 G;  1YHQ P;  4HYT B;  5TIS E;  3A2A A;  2QSI A;  3HD7 D;  1P84 D;  5KJ7 A;  2J1G A;  2KNC B;  3E1R A;  2QRX A;  3CCJ P;  3RK2 B;  3M0D C;  2E43 A;  4HH2 A;  1AV1 A;  1SQP K;  4OGQ C;  1LWU B;  1U7M A;  1PP9 D;  5AW7 B;  1YIJ P;  1RE4 B;  2B88 A;  1X22 A;  3FGA D;  3H1K G;  4XA4 A;  4DOJ A;  1J2J B;  4JYO X;  2JHL F;  3H1I E;  3RK3 E;  3IFM A;  5AVQ B;  1EZV D;  5KJ7 C;  1M57 D;  3Q2Y A;  1HF9 A;  3P32 A;  3AE1 C;  1HTL C;  1FIB A;  1FZG C;  3ABV C;  1IC2 A;  1NGM B;  2AXT E;  1N86 A;  3E7K A;  3H1J E;  5AW2 B;  2IZ1 A;  1XTC C;  3AE5 C;  1KN7 A;  3A5T A;  3AEE C;  3L72 D;  4W7Z A;  2E74 C;  1SQP E;  2VRS A;  2GM4 A;  4PV1 C;  5CMZ A;  1NTK D;  2FYU J;  1VF5 D;  4KJM A;  5AVZ B;  3RL0 g;  5GTI E;  3L74 D;  1LTS C;  1IFD A;  4OH8 B;  1DH3 A;  1N7S D;  1N86 C;  4UB8 E;  1Q7Y Q;  1NWQ A;  2JWA A;  2K1A A;  2M0B A;  3L73 G;  3L70 E;  2W90 A;  1JCC A;  1P84 H;  1BCC G;  1LJ2 A;  1QVF O;  3LW5 H;  2H43 A;  2WMM A;  2ITA A;  1HBW A;  2OYI B;  2M8R A;  3RL0 C;  3JCU E;  4EPU A;  4YXD C;  2XU6 A;  3HE5 B;  4TLF A;  4DT0 A;  3D70 A;  1CSB A;  5KKZ C;  1GL2 A;  5AVS B;  3V2Q A;  3P8M C;  3CMA P;  1IFP A;  3I55 P;  1VQ5 P;  3Q5S A;  2IX7 C;  1JY3 N;  1YJW P;  3H6P A;  1SFC A;  3P8C D;  1L0N K;  3T97 B;  1JY2 O;  5K5G B;  1L0L G;  1Q90 D;  2K9J A;  1GL2 C;  1Z56 A;  2YO3 A;  3HE4 A;  4GDO A;  2XND H;  3VOP A;  2IPP A;  5APS A;  2AEF A;  3MP7 B;  1JTH B;  1NVO A;  3PRJ A;  4IL6 H;  2Y9Z A;  3PP5 A;  4YTP C;  4WBA A;  5CHX A;  1SFC C;  2KZI A;  1MZ9 A;  1N7S C;  1W5C E;  4GKG A;  2BCC D;  2Q5U A;  1FZB B;  1KFN A;  2JKV A;  1KC8 Q;  3AEF C;  2DW3 A;  3B5N B;  2Y0E A;  1L0N E;  2QJY B;  3L37 A;  1H89 A;  1VPC A;  5KLV J;  1P84 E;  5AW6 B;  3BCC J;  2OTL P;  5BU8 B;  2G3A A;  2N9Y B;  2J60 A;  1SS1 A;  1NH4 A;  1URQ D;  5E79 H;  1NTK K;  1PFI A;  5EFW B;  1FZD A;  5APU A;  1KMI Z;  4IL6 X;  2YMY A;  3K5B A;  3S1K A;  3CX5 I;  3WUT A;  1SQQ E;  2E75 B;  4RJT A;  1BE3 G;  2PFX A;  1L0N J;  2J58 A;  5AW1 B;  4ZFG A;  2KNC A;  1NTM E;  2HFE D;  3EQ2 A;  2A45 I;  1KQG B;  1PGJ A;  1LWU A;  2Z5H A;  3LW5 J;  1GW3 A;  5TJH A;  1SQV D;  1IK9 A;  4A7P A;  2O01 H; 
#chains in the Genus database with same CATH homology
 2J61 A;  1L4A B;  1GK6 A;  1FZG A;  1GL2 B;  1RF1 A;  1IO4 A;  1RE4 A;  2LKM A;  1JY3 P;  1IFN A;  1SQB K;  1M1J C;  2GUS A;  1LTT C;  1H8A A;  4WY4 A;  3G3Z A;  2NPS C;  4I6M C;  5AW5 B;  4Y99 C;  1ZLL A;  3MD0 A;  2GY7 A;  1RF0 C;  4C7R A;  1T2K C;  3RK2 C;  2L5G B;  2NPS D;  3UIA A;  3VN0 A;  4M7F A;  5AVT B;  1MFZ A;  2J3G A;  1LWU C;  1W2E A;  1LTJ C;  1NKN A;  2ZFC A;  2JEE A;  1SFC B;  3RK2 D;  1FIC A;  3RK3 B;  1SLQ A;  2KOG A;  1RY3 A;  3M9H A;  1GDT A;  3L4F A;  2MJZ A;  1JNM A;  1FZE A;  4N78 E;  4NYT A;  1J1E C;  1URQ A;  2P67 A;  5APQ A;  1RF1 C;  2OYH A;  1RE4 C;  1OWA A;  5KJ7 D;  1S9K E;  4GIF A;  3HE4 B;  1RE3 B;  1FZF A;  2OAR A;  4LLH A;  3V2R A;  1FZA B;  2IFN A;  4GT1 A;  1G2C A;  1LGH B;  3VMX A;  1URQ B;  3CLQ A;  3BRV B;  1CI6 B;  4WY4 D;  2W6A A;  4ZKU A;  1G1J A;  3BAS A;  3BVH B;  2E42 A;  2KP8 A;  3N7N A;  2WNP F;  2R32 A;  2YNY A;  2HOD A;  2J0G A;  3C9I A;  1KFM A;  3U1A A;  1FJK A;  4B86 A;  5APW A;  1FZE C;  1SVF A;  3NFQ A;  3HTK B;  1URQ C;  5AVW B;  3HD7 A;  2OYH C;  2N9B A;  2Q3I A;  2JHK F;  1KIL A;  1NU1 K;  1HGZ A;  2J3F A;  1JMM A;  4JF7 A;  1CZQ A;  1FZF C;  4M3L A;  4EOT A;  2A45 G;  1HH0 A;  1HVV A;  1Z3S A;  5AVU B;  2D39 A;  4N78 D;  3M9Q A;  3IR9 A;  4N3Y B;  1S9K D;  1ZR2 A;  3NXS A;  2OYI A;  1YTZ T;  3E1I B;  1FDM A;  1QL1 A;  3HUS B;  1WRG A;  1LT9 A;  2P1J A;  2XZR A;  1KZU B;  2HOD C;  5AVY B;  2Z4E A;  1X79 B;  3GHG B;  4AYC A;  4DZO A;  5BVZ A;  1M7L A;  1FID A;  2FFD B;  3BRT B;  2WT7 A;  3P8C E;  4C7N B;  2WTY A;  3HD7 C;  3MIW A;  4IFF A;  1EQ7 A;  5APY A;  1M1J B;  1KIL C;  1MV8 A;  4HYT B;  3A2A A;  2NPS B;  3HD7 D;  4JZC A;  2Z4E B;  5KJ7 A;  1KIL D;  2J1G A;  1LTG C;  5AW4 B;  2WSC H;  2J3F D;  3RK2 B;  1L0L K;  2OYI C;  5KLV K;  3M0D C;  2E43 A;  4HH2 A;  1A02 J;  1T3U A;  1SQP K;  1LT9 C;  1LWU B;  1LTJ B;  3KPE A;  1KQL A;  2N1T D;  4XE5 B;  1N2D C;  5APX A;  3U1C A;  1A02 F;  2Q9I A;  2Z4E C;  2C9L Y;  2HPC A;  2CPS A;  2J61 B;  1J1E B;  3T97 A;  1FZG B;  1E5W A;  5AW7 B;  1RF1 B;  1RE4 B;  5CJ4 A;  3V4Q A;  3KQG A;  2BAS A;  1NHL A;  4EIJ A;  4XA4 A;  4DOJ A;  1J2J B;  4WY4 B;  4JYO X;  2JHL F;  2I1J A;  3WMM 0;  3IFM A;  2CPB A;  5AVQ B;  5KJ7 C;  2HPC B;  1X8Y A;  1N7S A;  3CI9 A;  2GUV A;  2O1K A;  3P32 A;  1HTL C;  3V5B A;  1FIB A;  1FZG C;  1IC2 A;  5AW0 B;  4AQR D;  3SWY A;  1N86 A;  1SP4 A;  3FIB A;  1LTB C;  2XNX A;  1ZR4 A;  4C46 A;  5AW2 B;  4WY4 C;  2Q9I C;  1XTC C;  1GD2 E;  3A5T A;  2HPC C;  1FZE B;  1IFM A;  5APV A;  4W7Z A;  1JY2 P;  2KLV A;  2OYH B;  1J1D C;  3O8Z A;  1N86 B;  2VRS A;  2GM4 A;  1JCD A;  2HLO A;  2H8P D;  2J64 A;  5CMZ A;  4R9J A;  1FZF B;  5AW8 B;  3B5N A;  1H88 A;  1SQQ K;  2H7H A;  2YKO A;  1IFJ A;  1XTG B;  5AVZ B;  1G2C B;  4ZKP A;  2R3C A;  5CCG A;  1LTA C;  2QM7 A;  3CL3 D;  2WPQ A;  4IFM A;  1CW5 A;  2KYV A;  1FZC A;  3MTU E;  5BU5 A;  1LTS C;  2QM8 A;  1IFD A;  3MUD A;  4LC1 A;  4OH8 B;  1GU5 A;  1DH3 A;  2HLO B;  1NTM K;  1N7S D;  1N86 C;  2FYZ A;  3TNU A;  2J3U A;  3OA7 A;  3KYQ A;  1NWQ A;  3II6 A;  2HOD B;  4JYB A;  3VMZ A;  3VP9 A;  5APT A;  2P2U A;  3U59 A;  1JCC A;  2N1T A;  1OXZ A;  2XV5 A;  3HD7 B;  4W7Y A;  1VDF A;  1KIL B;  1FOS E;  5KTB A;  2HLO C;  3MGN A;  2R5B A;  3LW5 H;  2H43 A;  1QL2 A;  5AW9 B;  1AFO A;  1GW4 A;  2ZXE B;  3VP8 A;  1SQX K;  3HE5 A;  2POH A;  2N1T B;  4I2L C;  4KHX A;  5CCH A;  2J59 M;  4M7H A;  5CCG C;  1HBW A;  3H32 A;  2OYI B;  3B5N D;  2M8R A;  1FZC C;  1FAV A;  3RL0 C;  1LT9 B;  4EPU A;  3M06 A;  2IFM A;  1JY3 O;  2A45 H;  2XU6 A;  5CCG D;  1NTZ K;  2WPS A;  3OAK A;  3NMD A;  1G1I A;  5AVV B;  2YO2 A;  3RL0 D;  3V4W A;  5CJ0 A;  3HE5 B;  2HG5 D;  1WT6 A;  2WT7 B;  2N1T C;  3M91 A;  1RF0 A;  4IFD K;  3M0A A;  2W27 A;  1L4A A;  1CSB A;  1GL2 A;  2WSE H;  5AVS B;  4I1L A;  2C0X A;  3V2Q A;  3P8M C;  2WWW A;  2PAJ A;  2JHI F;  3V2N A;  3H32 C;  2O1J A;  2WPR A;  2J0Y A;  2IX7 C;  1JY3 N;  5CCH D;  3H6P A;  3VMY A;  2Q9I B;  1N73 A;  2FKW B;  1IJD B;  2FXM A;  1AQ5 A;  4N6J A;  5AW3 B;  1SFC A;  3P8C D;  2R5D A;  1L0N K;  2JHM F;  1JTH A;  1JY2 O;  1SQV K;  3NTN A;  1YYC A;  3EFG A;  2JHH C;  1J1D B;  2KB7 P;  1FU1 A;  1L4A C;  2PP6 A;  1GL2 C;  1Z56 A;  1MUU A;  1N73 B;  1ZV8 A;  2YO3 A;  2C0W A;  3A7O A;  3HE4 A;  1RE3 A;  1ZN5 A;  1HWT C;  1T2K D;  3VOP A;  1L4A D;  2YKP A;  2XKM A;  1N7S B;  1GL2 D;  3TYY A;  2IPP A;  1T3J A;  4JYC A;  5APS A;  2WZ7 A;  1FZA A;  1JTH B;  4RES B;  3VTP C;  1CI6 A;  1FZB A;  2XNX B;  3PP5 A;  1N7L A;  2P7J A;  1N73 C;  3BVH A;  1FJP A;  3M9B A;  4WBA A;  5CHX A;  1SFC C;  1DEB A;  1MZ9 A;  1N7S C;  5AVX B;  3RK3 C;  1JO5 A;  1GTW A;  1T8Z A;  4GKG A;  1JY2 N;  1LTI C;  2Q5U A;  3R2P A;  3HRN A;  1SFC D;  3HTK A;  2HYN A;  1KFN A;  1FZB B;  1HUC A;  3RK3 D;  2YKQ A;  2XNX C;  1GU4 A;  3B5N B;  1YTZ I;  1FBM A;  1RE3 C;  2Q7C A;  4LGD E;  1NOH A;  1Z3U A;  3L37 A;  1H89 A;  1FZA C;  1VPC A;  3V2P A;  5AW6 B;  1NKZ B;  1FZC B;  3TSI A;  4AUW A;  3RL0 B;  1FZB C;  3E1I A;  3L36 A;  3TNU B;  2FIB A;  4R9T A;  3HUS A;  1JOC A;  5BU8 B;  1NAF A;  2J60 A;  3B5N C;  3BVH C;  1URQ D;  1NH4 A;  3N4X A;  1X9V A;  1HGV A;  2JJL A;  2J3O A;  3GHG A;  1NTK K;  1PFI A;  1HJB A;  2FFD A;  1FZD A;  2WSF H;  3KDP B;  5APU A;  1DX7 A;  4O9B A;  1IFI A;  2YMY A;  4C7N A;  3M0D A;  1M1J A;  2H43 B;  2W6B A;  2M3B A;  1GZL A;  2NPS A;  3P7K A;  2J58 A;  4W80 A;  4WB4 A;  3A3Y B;  2FYU K;  1GK4 A;  5AW1 B;  2J5Z A;  4ZFG A;  2XDJ A;  3H32 B;  3OJA B;  1NO4 A;  2C9N Y;  5AVR B;  2HFE D;  3EQ2 A;  2KSJ A;  3E1I C;  2Z5I A;  2A45 I;  3HUS C;  2H43 C;  2I1K A;  3LID A;  1LWU A;  2Z5H A;  1LTJ A;  3VYI A;  1FOS F;  1GW3 A;  3SWF A;  1JUN A;  3I5C A;  2WIT A;  3L35 A;  2J2P A;  4Y99 B;  1IK9 A;  2J0H A;  3BAT A;  3B8E B;  3TK1 A;  5CCH C;  2O01 H;  1RF0 B;  3GHG C;  1JC9 A;  2FFD C;  3LIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...