2FFDB

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
303
structure length
303
Chain Sequence
VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E Chain
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 92
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2ffdB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2ffdB03
2JHKF 4EPUA 2J61B 3E1IB 2J0GA 1FZAA 2J1GA 1N86C 1JC9A 1RE4A 1FZEB 1FZCB 1M1JC 1FIBA 2XNXA 2J5ZA 2OYIC 2HLOB 3GHGA 2OYHB 2H43B 2J60A 1LT9C 2J3GA 2HODA 2J2PA 1LTJB 1LWUA 1RE4C 3BVHA 1RF0B 2J3OA 2Z4EB 3GHGC 1RE3A 3FIBA 2J3UA 2A45I 1N86B 2HPCB 1Z3UA 1Z3SA 1RF1B 2HODC 1LT9A 1LWUC 3BVHC 1JY3O 2GY7A 2WNPF 3HUSA 4M7FA 1RE3C 1FIDA 1FZAB 1JY3N 1RE4B 1FZFB 2JHIF 1FZBB 2XNXB 1N73A 2Q9IA 3GHGB 2D39A 1FZGB 3HUSC 2FFDC 1LWUB 1FZCA 1N73C 2HLOA 2Q9IC 2J0YA 1M1JB 4M7HA 1RE3B 3H32A 2OYIB 1FICA 1JY2P 1W2EA 4JYOX 1LTJA 1LT9B 1FZEC 1FZCC 2JHMF 2FIBA 1RF0A 2FFDA 2HLOC 2OYHC 3H32C 2J64A 2J3FA 1LTJC 1N73B 3E1IA 2J61A 1FZDA 1RF0C 4R9TA 2HODB 1FZEA 1JY3P 2JHLF 2Z4EC 3BVHB 4R9JA 2HPCC 2A45H 2OYHA 2H43A 1FZFA 1RF1C 1FZBA 4JZCA 3E1IC 1T3UA 4ZFGA 2J3FD 3H32B 1FZGA 1JY2O 1FZAC 2A45G 2Z4EA 3HUSB 2H43C 2JHHC 1FZFC 1FZBC 1JY2N 2XNXC 1N86A 2HPCA 2FFDB 1M1JA 1RF1A 2J0HA 4NYTA 1FZGC 2OYIA 2Q9IB
chains in the Genus database with same CATH superfamily
1FE6A 3UIAA 2B87A 1BCCG 3BCCJ 5KLIC 4ZNCA 1FBMA 2IYPA 4KJMA 5AVUB 4L75A 3CMAP 3R2PA 1NKNA 1NU1G 3H1KG 3RK3C 3AEAC 3MD0A 2YXQB 3GHGC 2A06D 2JWDA 1Z56A 3V2PA 1RF1B 1EZVD 2B87B 2YKOA 1FAVA 4K3AA 2G8YA 1Y8AA 1R8EA 4OGQB 3RBZA 3P8CE 1FZCA 1S9KE 3H1ID 3CC2P 3RK3E 3LW5H 5E79H 1LTTC 2QJPC 2M0BA 2I1JA 2N9YB 1HBWA 2BASA 1HTLC 2FYUE 3BASA 2HG5D 3H1JJ 4BXLA 3L4FA 1VQ9P 2WWWA 5AVTB 3H25A 2YXRB 3CD6P 1JY3P 1QVGO 1IZNB 2V7QH 1FZFA 3P7KA 2BCCD 3C9IA 4C7RA 3GF7A 3RGUA 1FC2C 1JY2N 1ZXGA 3WUTA 1T2KD 1SQBG 1EQ7A 1IFIA 2LR2A 1JNMA 5KAFE 5GTIH 1PP9G 2XDJA 1K05A 2PP6A 1VQ7P 1NTKD 2M3EA 1QGKB 4D6TE 1L0NK 1K9MQ 3RL0D 3ITKA 2SPZA 4N6JA 1N7SC 1Y47A 4H44C 2YO3A 3TGUJ 4JYBA 1S5LH 1XTGB 2E76B 1AA0A 1FZBB 4GOEA 1H88A 4WB4A 2WSFH 1QEXA 3V2RA 1DX7A 3AE6C 2AXTH 4Y99B 3MGNA 3L75G 1JM0A 3O6QB 1SQQD 5B5EH 2WT7B 1OW6A 3E1RA 3FGAD 3CCQP 1VF5B 1LP1A 3G71P 2WPVB 3AE9C 1Q90D 3VMZA 2QJYB 5KKZB 1PPJG 3B5ND 5APWA 2W90A 3CCUP 4Z1MH 3H1HJ 3PLNA 3CCSP 2W8ZA 3CPWO 1ZW0A 2PRRA 2IFMA 4U3FE 3U1CA 1LP1B 1KYOH 2OTKE 3CCVP 1OFCX 3L70E 4DJGA 3KPEA 2XNXA 3TSIA 2WSSH 2HLOB 1OMIA 3VMAA 3SSUA 1KFMA 5AW6B 4GKGA 4IFMA 4AQRD 4IFDK 3P8CD 1NAYA 1S9KD 5APXA 3H1JG 4LGDE 3RK3D 1J2JB 3AEBC 1OVUA 2AEFA 2KZIA 1SQXK 1SQPJ 1JMMA 1LTAC 3CX5H 2FYUD 1FIDA 3S1KA 1KB9H 1KILC 3LW5J 3WU2E 3HD7B 3N4XA 2XNXB 1YQ3C 1DEBA 1FJPA 1KYOI 1E5WA 2Y0CA 4GT1A 1U7JA 3L72G 1EDLA 1DH3A 1GW3A 3FWLA 4K35A 2YMKA 4H0LC 1HWTC 1M1JB 2OYIB 2P2UA 5AW4B 3KZIE 1JY2P 4W7YA 2V7QJ 1CZQA 2J59M 2ZVOB 5GTHH 1JMBA 3A0BE 1KILE 4MN4C 3CX5I 1M56D 1YYCA 1KQGB 5AVRB 1P84I 2Q3IA 1KB9I 4JBZA 3I56P 4PJ0H 1FZGA 4D6TD 3D6YA 2A45G 4Y28J 3MP7B 2HPCA 5TJHA 3AEFC 4PV1C 5DJTB 3AE3C 2O1JA 4DOJA 3AE5C 2I1KA 3CXHE 2FYUK 3TDKA 2Q6QA 4IL6X 2OARA 3S4RA 3GHGA 1LTSC 5E79E 2QA4P 1M1KQ 1RF0B 3H1LJ 5KAIE 2J3UA 2WPSA 2E75B 2WSFJ 2HPCB 3L73E 2Y9YA 4W80A 3P8MC 1LTBC 1FOSF 1LWUC 1J1DB 1NTME 3RBXA 1N7SD 4H44D 5CCGD 3M0AA 1RQVA 1L0LE 1YHQP 2KI7B 1SS1A 3H1HG 5KLVE 3GHGB 1L0NJ 3HUSC 2J58A 2QE7H 5K5GB 4XFJA 1BE3E 1K04A 4R4LA 2GUVA 2Q9IC 2J0YA 3AEGC 3GMAA 1PGOA 1FZEC 2GUSA 1SQVE 4U3FD 2OYOA 2LXBA 2D2CC 2E5TA 1RQUA 5GTIE 4IFFA 3L70D 2Z4EC 2QJPB 2Q3EA 4C7NA 3V2NA 1WMKA 1FZAC 1X79B 1NU1J 1S5LE 1N7LA 1R5SA 1AVOA 1YTZI 1QX8A 1W5CE 3RK2C 5AVQB 1KORA 2FXMA 4JQ0D 1HGVA 2KOGA 4IOIH 4AUWA 2J0GA 4I6MC 3H6PA 3H1IE 1IFPA 5EFWB 4C7NB 3CC4P 2AXTE 1FU1A 2IPPA 4ASVA 1N7SA 2N1TB 1FOSE 1SP4A 3CLQA 4TT3H 1DEEG 1GDTA 3HE5A 1Z3UA 2K37A 3CCJP 3OW2O 1S4XA 1Y9BA 1ZV8A 2WPQA 3CWBE 4U7JA 1JY3N 3NXSA 3N7NA 3L71G 1KILD 3RL0C 1JCDA 4H44B 4ZKPA 1S2EA 1PFIA 1BCCE 4H0LD 1GL2A 1X9VA 3HE5B 5APYA 3A0HH 3G9RA 4RO0A 1NJIQ 2KXPB 2O1KA 5APUA 3H1KE 1LTJC 1M8OB 1Q82Q 1GZLA 3OAKA 1SQPD 3V2QA 2FYNB 3Q1MA 1JB0J 3CXHD 1N8RQ 3L74J 3AECC 2A45H 1USEA 4JZCA 1T3UA 4EYYQ 2W6JH 1GL2B 1JY2O 3C8VA 2NPSA 1EZVG 4IL6H 1OZHA 4UB6E 5CJ0A 3CX5E 2P1JA 3L73D 1S1CX 1L0NG 1NTMD 2ZYGA 2ZXEB 4EPUA 1L0LD 4YXDC 3U1AA 2J1GA 1N86C 2UWJE 1IO4A 2WTYA 4WVZA 5KLVD 2WITA 1GU4A 1Q86Q 2NPSB 1BE3D 4RESB 2WSCH 2PGDA 2LKMA 2A45I 2W83C 3L75J 1CI6B 5L8RJ 5GTHE 1SQVD 2WNPF 3AE4C 2XKMA 3VN0A 4M7FA 2IZ0A 2KK7A 2JHIF 2ZYAA 1XTCC 1A02F 3LIDA 1URQC 5AVWB 1SQBE 4A7PA 2JEEA 4PJ0E 5CBOA 3ZDMA 1CW5A 1SFCC 2YNYA 3EFFK 3WUUA 1BDDA 2M3BA 1A02J 3I5CA 4ASWA 1PP9E 3T97A 2H89C 2O01H 3H1LD 2WQYC 2D2CD 2PFXA 3NMDA 2NRGA 1NTMK 3IF4A 3PRJA 1HGZA 1L4AC 4XA4A 4R9TA 2QJKC 3OJAB 1L0LK 2C0XA 5APSA 2IZ1A 4B86A 1EDIA 5CCHC 3E1IC 5KLVK 1ZMEC 3JSVC 1J1EB 3D70A 3GG2A 2XV5A 1U57A 2E42A 3CI9A 2Q5UA 1VQPP 3T97B 3KHUA 2ZJSE 5DJUB 4N78D 2N9BA 2QG4A 3CWBD 3RK2D 4UB8H 1FZCB 1YTZT 3CMEP 1SQXG 3BCCE 2WVRA 2J60A 4M3LA 1NTZJ 1MKMA 4PV1B 1LWUA 5CHXA 4PD4E 2NZ2A 3L72J 1KN7A 2J3OA 4YPCA 3Q2YA 3FIBA 2K9JA 1BCCD 1GU5A 1QLED 2IBZI 3BVHC 3L74G 1PPJE 1NWQA 3HUSA 3H1KD 4CPGA 1FZFB 1JEKA 4QMAA 4ZKUA 2KLUA 2Q9IA 1HJBA 1LWUB 1EC5A 4I7ZC 2O01N 5CCGC 4M7HA 2E74C 3VMXA 1M90Q 2JHMF 2H8PD 3CX5D 2YIUC 5AVVB 3FXDA 3TYYA 2POHA 1KZUB 1BGYJ 3C1LA 1VQLP 3H1JE 1PZQA 3S9OA 1E79H 3GW6A 3RL0g 1GMJA 2OYHA 1JUNA 4R4MA 3PTZA 1M7LA 2D2CB 3MTUE 1DD3A 1H8AA 2FYUG 2H88C 1KMIZ 3AE1C 3G6EP 3L72E 1HVVA 2JHKF 2WSCJ 2OQQA 4WBAA 2MJZA 2OYHB 2AEMA 1SQBD 2J3GA 1TU3F 2C0WA 4HB1A 1NTKK 4N3YB 4JPZB 1NKZB 1EZVI 1ZLLA 2KIKA 1X22A 2JO1A 2FBWC 1PV3A 2HODC 1L2PA 1LT9A 5KJ7C 3AEEC 1PP9D 3TGUE 3M0DC 2ZT9D 1NYHA 1VQ8P 2QSIA 3VYIA 1URQD 3VTPC 2P67A 4O9BA 2O01J 1MUUA 1SVFA 1SFCD 1IFJA 1SQQK 1W2EA 1LTJA 1LT9B 4ZMDA 4GIFA 3A5TA 2QRXA 1P84H 1YQ4C 3II6A 2FFDA 3RL0B 2WSEH 2YKQA 3H32C 3V6IA 1HH0A 3MUDC 1NTZG 2J61A 3L75D 4XE5B 1GW4A 5AVXB 1L4AD 3BCCD 1RF1C 1NOHA 2P7JA 5CCHD 4PD4D 1KC8Q 3H1HE 2Y0DA 2H43C 3U59A 3B5NA 1N86A 2QIWA 2FFDB 1NGMB 1AV1A 1PPJD 5AW5B 3Q5PA 2J61B 2OTJP 1ZR2A 1LT1A 1IC2A 3L71J 4WWIA 2GM4A 1BGYG 2KZJA 4LLHA 3B5NB 2B89A 1NO4A 2W27A 1N86B 2QEXP 1NH4A 1JY3O 1SQPE 2LXCB 3VP8A 1ZN5A 2O3JA 1SFCA 3H1JD 4WY4C 1FZGB 2P10A 2J5UA 4L73A 5KLIB 2E74D 3TNUA 4JYOX 3WMM0 1L4AA 2Q1KA 3RK3B 1Q81Q 2J64A 3L72D 3JCUH 2Q7CA 3E1IA 1U7MA 2BEZF 3G4SP 2KSEA 3F89A 5AW0B 1QL1A 2E76C 3Q5SA 3TNUB 3WUVA 2BEQD 1FZBC 4OH8B 1L4AB 2B9BA 1YJNP 4NYTA 4EIJA 3TGUD 3E1IB 3MIWA 2JR8A 4Y99C 1OW8A 3IFMA 1LJ2A 5AW1B 1QL2A 3EFGA 1EXJA 3LIEA 1BSNA 2BCCJ 3SWKA 1VF5C 3PHLA 3AE7C 2IBZG 3BVHA 5KAFH 1FDMA 3H1LE 2XZRA 2XU6A 2K9YA 3A3YB 3V4WA 3IN6A 5KKZC 2P58A 3V5BA 5KJ7D 3W68A 4NPDA 5CCGA 1PGQA 3FWNA 5B5EE 1NTKJ 2WSEJ 1L0NE 3V4QA 1YJ9P 5AW7B 4YTPC 1G1IA 4N78E 4C46A 3H1HD 3Q3DA 2KNCA 2HLOC 2M5AA 3TK1A 3AE2C 2I8DA 5AVYB 1FZDA 1N7SB 3SFEC 1KFNA 1ZP0C 3M91A 2IDBA 4BWNA 4R9JA 2K1AA 1JOCA 1SQXJ 1LTIC 1OVRA 3PH0A 4YXWH 1SQQJ 1KYOE 2K88A 3EWKA 3W67A 1NHLA 1GK6A 2CPBA 2YKPA 1NAFA 3G3ZA 3HD7C 2XNXC 4H13C 4I1LA 1NU1E 2KNCB 2AEJA 2J0HA 1H0TA 2M5AB 1QVFO 4OGQD 3VP9A 1YJWP 2MKVA 1G2CA 4HH2A 2A06G 1JC9A 1M1JC 3NTNA 2OYIC 3PP5A 1ZR4A 2R44A 5H2FH 1UIXA 2HODA 4JF7A 2C9LY 3BRVB 3B4SA 1P84E 1MZ9A 1KB9E 1S5LX 1H0TB 3M0DA 2KSJA 2ZXXA 3H1IG 1K73Q 1UIIA 1G2CB 4GODA 2R3SA 2KUBA 3VMYA 3TF5A 2D39A 2L91A 3M9QA 4WY4D 1IK9A 4LC1A 2G3AA 3WU2H 1KILA 3M9HA 1Q7YQ 3H32A 2WMMA 3MUDA 1OWAA 1K8AQ 2QVAA 2FYUJ 2FIBA 2W6AA 2ZT9C 1EXIA 2BCCG 1WT6A 2ZVNB 3AEDC 1RF0C 1SQPK 1G1JA 2E75C 2HPCC 2H43A 5B66H 3L74E 1GK4A 1J1DC 4ZFGA 1KILB 3A0BH 3H32B 4DZOA 1VQMP 3EQ2A 5AW9B 1EDKA 2E76D 1X8YA 3PJSK 1M57D 3M06A 4H0LB 1NTKG 1LNQA 1HF9A 1ZOYC 3KXDA 3QWOC 4I2LC 4AYCA 2H43B 4D6TJ 2CPSA 3MHVA 1L0ND 1LTGC 3I55P 3CXHH 2JP3A 1VF5D 1KQFB 2FXPA 1VL2A 1CSBA 1VQ4P 2FY8A 3JCUE 3SFDC 3L75E 4WY4A 1SQVK 1RE3C 5KAIH 2FKWB 2JWAA 1SQQG 3P32A 1AQ5A 4KT0J 4RKUJ 1S72P 1FJKA 3IR9A 1N73C 2M8RA 1KYOD 1IJDB 2QM7A 4WY4B 1NU1D 3CCRP 2W6BA 3CXHI 2N1TC 3NFQA 1RY3A 1FZEA 1VPCA 3A7OA 1JTHA 2V4HA 1KQSO 2RH0A 2K9JB 1FZBA 2KLVA 4U3FJ 2Z4EA 3HUSB 1P84D 1KB9D 1VQKP 3HD7D 3GF3A 4H13D 3O6QA 2Q9IB 2WT7A 3L70J 4GDOA 1FZAA 1VQ5P 1FZEB 3CCLP 1JTHB 2KS1A 2ZYDA 4L74A 2JKVA 2DW3A 2E43A 1X0TA 1FS0E 1RE4C 2R3CA 1NTZE 3E7KA 4DT0A 2Z4EB 2Z5IA 2IFNA 2FYZA 1SQXD 2L5GB 2FYNC 1YBKA 4HKZH 2GY7A 2RMZA 3BCCG 1FZAB 2JDIH 1NU1K 5AW3B 2KS1B 1GL2C 1OXZA 3RK2B 3A0HE 1MV8A 3L74D 4DCKA 2HLOA 4NPFX 5CJ4A 1FICA 1BSHA 3D71A 4KHXA 3GLMA 1USDA 1IK7A 5AW8B 2Y0EA 1PGPA 4D6TG 4EDFA 4BRYA 1BGYE 2NPSC 1N2DC 5H2FE 2JHLF 1R5LA 4IL6E 4RJTA 3D6ZA 1VQOP 3HD7A 2E75D 2J3FD 4OVNF 1JCCA 1MFTA 2PAJA 1M1JA 1AQTA 1KTMA 2AXCA 2OYIA 3F5HA 4BRYB 4UB6H 4JYCA 2J5ZA 3M9BA 2XNDH 1D7MA 4H13B 3Q5RA 1SQBK 3L37A 2HYNA 5TISH 1LTJB 1Q2NA 1BDCA 4OGQC 3L73J 1JO5A 2KYVA 1NTMJ 1Z3SA 4GOFA 1ZRTE 1L0LJ 1NVOA 5KLVJ 1J1EC 5B66E 4U3FG 5AVSB 2OTLP 1BE3J 2FXOA 5APVA 3BATA 3L70G 2OGUA 2R5DA 3USSA 3TGUG 3BRTB 3L35A 1URQA 1SQVJ 1SLQA 1FZCC 5KTBA 1RF0A 2IX7C 3KQGA 5BU8B 3CC7P 2YMYA 2IBZE 1GTWA 2J3FA 2QM8A 2KB7P 2E5YA 2N1TD 3HRNA 4EOTA 1DIPA 1OW7A 1H89A 2ZT9B 5CBNA 1OX3A 1GD2E 2WZ7A 1NTZD 3KDPB 1URQB 4UB8E 1FZFC 1RH5B 5APTA 1YIJP 5CCHA 1SFCB 3JC22 1VQNP 1IFDA 1YITP 3H1IJ 3VOPA 2ITAA 1FIBA 5AVZB 2KP8A 3L71E 3KYQA 2QJKB 1RE3A 5BU5A 1T3JA 2JJLA 3FXEA 3CL3D 1IFNA 3CWBJ 4PD4H 4W7ZA 1N73A 2HFED 1BGYD 1T8ZA 1GL2D 3B71A 2ZAEB 1PIXA 3QH9A 4OWFA 3HTKA 4NPEA 2C9NY 1BCCJ 3CCEP 3SWFA 1RE3B 2A06E 1SQPG 5M1BA 2QJYC 2CK3H 1HUCA 2N1TA 3B8EB 1KV4A 2ZFCA 3SWYA 1NTZK 1KQLA 5APQA 1EZVE 3H1KJ 2OYHC 3O8ZA 1IFMA 1N73B 1OIPA 2VRSA 3L36A 1DD4A 4L76A 3A2AA 3L73G 4PD4I 2NPSD 1PGJA 4EI2A 1AJYA 3BVHB 1NTMG 3HTKB 3ABVC 5BVZA 1L0LG 2RN0A 1VQ6P 1T2KC 5KLVG 2JHHC 1HJ0A 4HJGH 2HR3A 2Y9ZA 5C39A 1ZRTD 1YI2P 4I7ZB 2H7HA 1BE3G 2E74B 3HE4A 3FX0A 1MFZA 3K5BA 1RE4A 2YIUB 2YO2A 1SQVG 1T6AA 1LT9C 3MZWB 2R32A 4TLFA 2J2PA 2BCCE 3AE8C 2RKLA 5AW2B 1KD1Q 2IYOA 1WRGA 3HE4B 1RE4B 2IBZD 1FDIA 2Z5HA 1SQBJ 1LGHB 3IAOA 3OA7A 5KJ7A 1NTKE 2R5BA 3H1LG 2FFDC 2GA1A 2K3RA 1W2BO 1AFOA 1PL5A 1PP9J 3R4YA 2WPRA 5CMZA 1EDJA 1CI6A 1VDFA 1OVVA 4PV1D 2HODB 5TISE 3B5NC 3CCMP 2B88A 1AVYA 1FDOA 3CWBG 1S3JA 1SQXE 3L71D 1SQQE 1RHZB 1RF1A 3KZIH 1FZGC 4HYTB
chains in the Genus database with same CATH topology
5AVQB 5AW5B 2FXMA 3UIAA 4AUWA 1HGVA 2KOGA 2J61B 2J0GA 1FZAA 4I6MC 1FZEB 3H6PA 1FBMA 1ZR2A 1JTHB 5AVUB 4C7NB 3R2PA 1FU1A 1NKNA 2IPPA 1IC2A 2E43A 1N7SA 2N1TB 1RE4C 1FOSE 1SP4A 2R3CA 2GM4A 3RK3C 3CLQA 3MD0A 2Z4EB 3GHGC 2Z5IA 2IFNA 4LLHA 3B5NB 1GDTA 1N86B 1NO4A 2W27A 3HE5A 1Z56A 1Z3UA 3V2PA 2FYZA 1RF1B 2L5GB 1NH4A 1JY3O 2GY7A 1ZV8A 3VP8A 2WPQA 1ZN5A 2YKOA 1FZAB 1JY3N 3NXSA 1NU1K 1FAVA 5AW3B 3N7NA 1GL2C 1OXZA 1SFCA 1KILD 4WY4C 3RL0C 1FZGB 1JCDA 3RK2B 3P8CE 4ZKPA 1FZCA 1MV8A 1S9KE 1PFIA 2HLOA 3LW5H 1GL2A 5CJ4A 1LTTC 1FICA 1X9VA 3HE5B 5APYA 4JYOX 3TNUA 4KHXA 2I1JA 3WMM0 1HBWA 2BASA 1L4AA 1HTLC 5AW8B 3BASA 2O1KA 2HG5D 5APUA 3RK3B 2J64A 2Q7CA 3L4FA 1LTJC 3E1IA 2WWWA 5AVTB 2NPSC 1N2DC 1GZLA 3OAKA 1JY3P 3V2QA 2JHLF 2A45H 1FZFA 3HD7A 4JZCA 5AW0B 1QL1A 1T3UA 3P7KA 2J3FD 1GL2B 1JY2O 2NPSA 3C9IA 4C7RA 3TNUB 5CJ0A 1FZBC 1JY2N 1JCCA 1T2KD 4OH8B 2P1JA 1EQ7A 1L4AB 2PAJA 1M1JA 4NYTA 2OYIA 1IFIA 4EIJA 2ZXEB 4EPUA 3E1IB 3MIWA 3U1AA 2J1GA 4JYCA 1N86C 4Y99C 1JNMA 1IO4A 2J5ZA 3IFMA 3M9BA 2WTYA 5AW1B 1QL2A 2WITA 3EFGA 3LIEA 1SQBK 3L37A 2XDJA 2PP6A 2HYNA 1LTJB 1L0NK 1GU4A 2NPSB 3BVHA 4RESB 3RL0D 2WSCH 1FDMA 2LKMA 2A45I 1JO5A 2XZRA 2XU6A 2KYVA 4N6JA 1CI6B 1Z3SA 1N7SC 2YO3A 3A3YB 4JYBA 3V4WA 2WNPF 2XKMA 1XTGB 5KJ7D 3V5BA 3VN0A 4M7FA 2JHIF 1FZBB 1J1EC 1XTCC 4WB4A 1H88A 2WSFH 1A02F 5CCGA 3LIDA 3V2RA 1URQC 5AVWB 5AVSB 1DX7A 2JEEA 5APVA 3V4QA 1CW5A 1SFCC 2YNYA 3BATA 4Y99B 3MGNA 2M3BA 5AW7B 1A02J 3I5CA 2R5DA 1G1IA 4N78E 2WT7B 3BRTB 4C46A 3L35A 1URQA 1SLQA 1FZCC 5KTBA 1RF0A 2IX7C 3KQGA 5BU8B 2HLOC 3T97A 2O01H 2YMYA 3TK1A 3NMDA 1GTWA 2J3FA 2QM8A 2KB7P 5AVYB 1FZDA 1NTMK 1N7SB 3VMZA 2N1TD 1HGZA 1L4AC 3HRNA 4XA4A 4R9TA 4EOTA 3OJAB 1L0LK 1KFNA 2C0XA 3M91A 5APSA 4R9JA 4B86A 1JOCA 3B5ND 5CCHC 1LTIC 5APWA 1H89A 3E1IC 5KLVK 1GD2E 2WZ7A 1J1EB 2XV5A 1NHLA 1GK6A 3KDPB 1URQB 2CPBA 2YKPA 1NAFA 2E42A 3G3ZA 1FZFC 3HD7C 2IFMA 3CI9A 5APTA 2XNXC 4I1LA 2Q5UA 3U1CA 2J0HA 5CCHA 1SFCB 4N78D 2N9BA 3VP9A 1IFDA 1G2CA 3RK2D 4HH2A 3VOPA 1JC9A 3KPEA 1FZCB 1M1JC 1YTZT 2XNXA 1FIBA 3TSIA 3NTNA 2OYIC 2HLOB 5AVZB 3PP5A 1KFMA 1ZR4A 2J60A 5AW6B 4GKGA 4M3LA 4IFMA 4AQRD 2KP8A 2HODA 1LWUA 4JF7A 5CHXA 3P8CD 4IFDK 2C9LY 3KYQA 3BRVB 1S9KD 5APXA 2J3OA 1RE3A 4LGDE 3FIBA 3RK3D 1MZ9A 1J2JB 1GU5A 5BU5A 1T3JA 2JJLA 1SQXK 3CL3D 3M0DA 1IFNA 3BVHC 2KSJA 1JMMA 1NWQA 1LTAC 3HUSA 1G2CB 1FIDA 4W7ZA 1KILC 1FZFB 4ZKUA 3HD7B 3N4XA 2XNXB 1N73A 1DEBA 2HFED 1FJPA 3VMYA 2Q9IA 1T8ZA 1HJBA 2D39A 1E5WA 1GL2D 4GT1A 3M9QA 4WY4D 1LWUB 1DH3A 1GW3A 3HTKA 2C9NY 1IK9A 4LC1A 1HWTC 1KILA 3M9HA 1M1JB 5CCGC 3SWFA 1RE3B 4M7HA 3H32A 2OYIB 2P2UA 3MUDA 5AW4B 1JY2P 1OWAA 1HUCA 2N1TA 3B8EB 3VMXA 2JHMF 2ZFCA 3SWYA 2FIBA 1NTZK 1KQLA 2H8PD 4W7YA 2W6AA 5APQA 5AVVB 1CZQA 2J59M 2OYHC 3TYYA 2POHA 1KZUB 3O8ZA 1IFMA 1N73B 2VRSA 3L36A 1WT6A 3A2AA 1RF0C 1SQPK 2NPSD 3BVHB 1G1JA 2HPCC 1YYCA 5AVRB 2H43A 3HTKB 2OYHA 1JUNA 2Q3IA 5BVZA 1GK4A 1J1DC 4ZFGA 1KILB 1M7LA 3H32B 4DZOA 1FZGA 3MTUE 3EQ2A 1H8AA 5AW9B 2A45G 1T2KC 2JHHC 1X8YA 2HPCA 3M06A 2H7HA 1HVVA 2O1JA 4DOJA 2JHKF 3HE4A 1MFZA 1RE4A 2I1KA 4WBAA 2FYUK 2MJZA 2OARA 4I2LC 3GHGA 4AYCA 2YO2A 2OYHB 1LTSC 2H43B 1LT9C 2J3GA 2C0WA 2R32A 2CPSA 2J2PA 1NTKK 4N3YB 1LTGC 1RF0B 1NKZB 5AW2B 1ZLLA 2J3UA 2WPSA 2HPCB 4W80A 1CSBA 3P8MC 1LTBC 1FOSF 1LT9A 1LWUC 2HODC 1J1DB 5KJ7C 1WRGA 1N7SD 5CCGD 4WY4A 1SQVK 3M0AA 1RE3C 3HE4B 2FKWB 1RE4B 2Z5HA 3M0DC 3P32A 1LGHB 1AQ5A 3GHGB 3OA7A 5KJ7A 3HUSC 1FJKA 3VYIA 1URQD 2J58A 2R5BA 3VTPC 2FFDC 2P67A 3IR9A 4O9BA 1N73C 1MUUA 1SVFA 2GUVA 2M8RA 2Q9IC 2J0YA 1AFOA 1IJDB 1SFCD 1IFJA 1SQQK 2QM7A 1W2EA 1LTJA 1LT9B 1FZEC 4GIFA 2GUSA 3A5TA 2WPRA 4WY4B 2FFDA 3II6A 3RL0B 2WSEH 2W6BA 5CMZA 2YKQA 3H32C 1HH0A 1CI6A 1VDFA 2N1TC 3NFQA 2J61A 1RY3A 4IFFA 4XE5B 2HODB 1FZEA 1GW4A 5AVXB 2Z4EC 1VPCA 3A7OA 1JTHA 3B5NC 1L4AD 4C7NA 1RF1C 1FZBA 3V2NA 1NOHA 2P7JA 5CCHD 1FZAC 1X79B 2KLVA 2Z4EA 3HUSB 2H43C 3U59A 3B5NA 1N7LA 1N86A 2FFDB 1RF1A 3HD7D 1YTZI 1FZGC 4HYTB 2Q9IB 2WT7A 3RK2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHK F;  4EPU A;  2J61 B;  3E1I B;  2J0G A;  1FZA A;  2J1G A;  1N86 C;  1JC9 A;  1RE4 A;  1FZE B;  1FZC B;  1M1J C;  1FIB A;  2XNX A;  2J5Z A;  2OYI C;  2HLO B;  3GHG A;  2OYH B;  2H43 B;  2J60 A;  1LT9 C;  2J3G A;  2HOD A;  2J2P A;  1LTJ B;  1LWU A;  1RE4 C;  3BVH A;  1RF0 B;  2J3O A;  2Z4E B;  3GHG C;  1RE3 A;  3FIB A;  2J3U A;  2A45 I;  1N86 B;  2HPC B;  1Z3U A;  1Z3S A;  1RF1 B;  2HOD C;  1LT9 A;  1LWU C;  3BVH C;  1JY3 O;  2GY7 A;  2WNP F;  3HUS A;  4M7F A;  1RE3 C;  1FID A;  1FZA B;  1JY3 N;  1RE4 B;  1FZF B;  2JHI F;  1FZB B;  2XNX B;  1N73 A;  2Q9I A;  3GHG B;  2D39 A;  1FZG B;  3HUS C;  2FFD C;  1LWU B;  1FZC A;  1N73 C;  2HLO A;  2Q9I C;  2J0Y A;  1M1J B;  4M7H A;  1RE3 B;  3H32 A;  2OYI B;  1FIC A;  1JY2 P;  1W2E A;  4JYO X;  1LTJ A;  1LT9 B;  1FZE C;  1FZC C;  2JHM F;  2FIB A;  1RF0 A;  2FFD A;  2HLO C;  2OYH C;  3H32 C;  2J64 A;  2J3F A;  1LTJ C;  1N73 B;  3E1I A;  2J61 A;  1FZD A;  1RF0 C;  4R9T A;  2HOD B;  1FZE A;  1JY3 P;  2JHL F;  2Z4E C;  3BVH B;  4R9J A;  2HPC C;  2A45 H;  2OYH A;  2H43 A;  1FZF A;  1RF1 C;  1FZB A;  4JZC A;  3E1I C;  1T3U A;  4ZFG A;  2J3F D;  3H32 B;  1FZG A;  1JY2 O;  1FZA C;  2A45 G;  2Z4E A;  3HUS B;  2H43 C;  2JHH C;  1FZF C;  1FZB C;  1JY2 N;  2XNX C;  1N86 A;  2HPC A;  2FFD B;  1M1J A;  1RF1 A;  2J0H A;  4NYT A;  1FZG C;  2OYI A;  2Q9I B; 
#chains in the Genus database with same CATH topology
 1FE6 A;  3UIA A;  2B87 A;  1BCC G;  3BCC J;  5KLI C;  4ZNC A;  1FBM A;  2IYP A;  4KJM A;  5AVU B;  4L75 A;  3CMA P;  3R2P A;  1NKN A;  1NU1 G;  3H1K G;  3RK3 C;  3AEA C;  3MD0 A;  2YXQ B;  3GHG C;  2A06 D;  2JWD A;  1Z56 A;  3V2P A;  1RF1 B;  1EZV D;  2B87 B;  2YKO A;  1FAV A;  4K3A A;  2G8Y A;  1Y8A A;  1R8E A;  4OGQ B;  3RBZ A;  3P8C E;  1FZC A;  1S9K E;  3H1I D;  3CC2 P;  3RK3 E;  3LW5 H;  5E79 H;  1LTT C;  2QJP C;  2M0B A;  2I1J A;  2N9Y B;  1HBW A;  2BAS A;  1HTL C;  2FYU E;  3BAS A;  2HG5 D;  3H1J J;  4BXL A;  3L4F A;  1VQ9 P;  2WWW A;  5AVT B;  3H25 A;  2YXR B;  3CD6 P;  1JY3 P;  1QVG O;  1IZN B;  2V7Q H;  1FZF A;  3P7K A;  2BCC D;  3C9I A;  4C7R A;  3GF7 A;  3RGU A;  1FC2 C;  1JY2 N;  1ZXG A;  3WUT A;  1T2K D;  1SQB G;  1EQ7 A;  1IFI A;  2LR2 A;  1JNM A;  5KAF E;  5GTI H;  1PP9 G;  2XDJ A;  1K05 A;  2PP6 A;  1VQ7 P;  1NTK D;  2M3E A;  1QGK B;  4D6T E;  1L0N K;  1K9M Q;  3RL0 D;  3ITK A;  2SPZ A;  4N6J A;  1N7S C;  1Y47 A;  4H44 C;  2YO3 A;  3TGU J;  4JYB A;  1S5L H;  1XTG B;  2E76 B;  1AA0 A;  1FZB B;  4GOE A;  1H88 A;  4WB4 A;  2WSF H;  1QEX A;  3V2R A;  1DX7 A;  3AE6 C;  2AXT H;  4Y99 B;  3MGN A;  3L75 G;  1JM0 A;  3O6Q B;  1SQQ D;  5B5E H;  2WT7 B;  1OW6 A;  3E1R A;  3FGA D;  3CCQ P;  1VF5 B;  1LP1 A;  3G71 P;  2WPV B;  3AE9 C;  1Q90 D;  3VMZ A;  2QJY B;  5KKZ B;  1PPJ G;  3B5N D;  5APW A;  2W90 A;  3CCU P;  4Z1M H;  3H1H J;  3PLN A;  3CCS P;  2W8Z A;  3CPW O;  1ZW0 A;  2PRR A;  2IFM A;  4U3F E;  3U1C A;  1LP1 B;  1KYO H;  2OTK E;  3CCV P;  1OFC X;  3L70 E;  4DJG A;  3KPE A;  2XNX A;  3TSI A;  2WSS H;  2HLO B;  1OMI A;  3VMA A;  3SSU A;  1KFM A;  5AW6 B;  4GKG A;  4IFM A;  4AQR D;  4IFD K;  3P8C D;  1NAY A;  1S9K D;  5APX A;  3H1J G;  4LGD E;  3RK3 D;  1J2J B;  3AEB C;  1OVU A;  2AEF A;  2KZI A;  1SQX K;  1SQP J;  1JMM A;  1LTA C;  3CX5 H;  2FYU D;  1FID A;  3S1K A;  1KB9 H;  1KIL C;  3LW5 J;  3WU2 E;  3HD7 B;  3N4X A;  2XNX B;  1YQ3 C;  1DEB A;  1FJP A;  1KYO I;  1E5W A;  2Y0C A;  4GT1 A;  1U7J A;  3L72 G;  1EDL A;  1DH3 A;  1GW3 A;  3FWL A;  4K35 A;  2YMK A;  4H0L C;  1HWT C;  1M1J B;  2OYI B;  2P2U A;  5AW4 B;  3KZI E;  1JY2 P;  4W7Y A;  2V7Q J;  1CZQ A;  2J59 M;  2ZVO B;  5GTH H;  1JMB A;  3A0B E;  1KIL E;  4MN4 C;  3CX5 I;  1M56 D;  1YYC A;  1KQG B;  5AVR B;  1P84 I;  2Q3I A;  1KB9 I;  4JBZ A;  3I56 P;  4PJ0 H;  1FZG A;  4D6T D;  3D6Y A;  2A45 G;  4Y28 J;  3MP7 B;  2HPC A;  5TJH A;  3AEF C;  4PV1 C;  5DJT B;  3AE3 C;  2O1J A;  4DOJ A;  3AE5 C;  2I1K A;  3CXH E;  2FYU K;  3TDK A;  2Q6Q A;  4IL6 X;  2OAR A;  3S4R A;  3GHG A;  1LTS C;  5E79 E;  2QA4 P;  1M1K Q;  1RF0 B;  3H1L J;  5KAI E;  2J3U A;  2WPS A;  2E75 B;  2WSF J;  2HPC B;  3L73 E;  2Y9Y A;  4W80 A;  3P8M C;  1LTB C;  1FOS F;  1LWU C;  1J1D B;  1NTM E;  3RBX A;  1N7S D;  4H44 D;  5CCG D;  3M0A A;  1RQV A;  1L0L E;  1YHQ P;  2KI7 B;  1SS1 A;  3H1H G;  5KLV E;  3GHG B;  1L0N J;  3HUS C;  2J58 A;  2QE7 H;  5K5G B;  4XFJ A;  1BE3 E;  1K04 A;  4R4L A;  2GUV A;  2Q9I C;  2J0Y A;  3AEG C;  3GMA A;  1PGO A;  1FZE C;  2GUS A;  1SQV E;  4U3F D;  2OYO A;  2LXB A;  2D2C C;  2E5T A;  1RQU A;  5GTI E;  4IFF A;  3L70 D;  2Z4E C;  2QJP B;  2Q3E A;  4C7N A;  3V2N A;  1WMK A;  1FZA C;  1X79 B;  1NU1 J;  1S5L E;  1N7L A;  1R5S A;  1AVO A;  1YTZ I;  1QX8 A;  1W5C E;  3RK2 C;  5AVQ B;  1KOR A;  2FXM A;  4JQ0 D;  1HGV A;  2KOG A;  4IOI H;  4AUW A;  2J0G A;  4I6M C;  3H6P A;  3H1I E;  1IFP A;  5EFW B;  4C7N B;  3CC4 P;  2AXT E;  1FU1 A;  2IPP A;  4ASV A;  1N7S A;  2N1T B;  1FOS E;  1SP4 A;  3CLQ A;  4TT3 H;  1DEE G;  1GDT A;  3HE5 A;  1Z3U A;  2K37 A;  3CCJ P;  3OW2 O;  1S4X A;  1Y9B A;  1ZV8 A;  2WPQ A;  3CWB E;  4U7J A;  1JY3 N;  3NXS A;  3N7N A;  3L71 G;  1KIL D;  3RL0 C;  1JCD A;  4H44 B;  4ZKP A;  1S2E A;  1PFI A;  1BCC E;  4H0L D;  1GL2 A;  1X9V A;  3HE5 B;  5APY A;  3A0H H;  3G9R A;  4RO0 A;  1NJI Q;  2KXP B;  2O1K A;  5APU A;  3H1K E;  1LTJ C;  1M8O B;  1Q82 Q;  1GZL A;  3OAK A;  1SQP D;  3V2Q A;  2FYN B;  3Q1M A;  1JB0 J;  3CXH D;  1N8R Q;  3L74 J;  3AEC C;  2A45 H;  1USE A;  4JZC A;  1T3U A;  4EYY Q;  2W6J H;  1GL2 B;  1JY2 O;  3C8V A;  2NPS A;  1EZV G;  4IL6 H;  1OZH A;  4UB6 E;  5CJ0 A;  3CX5 E;  2P1J A;  3L73 D;  1S1C X;  1L0N G;  1NTM D;  2ZYG A;  2ZXE B;  4EPU A;  1L0L D;  4YXD C;  3U1A A;  2J1G A;  1N86 C;  2UWJ E;  1IO4 A;  2WTY A;  4WVZ A;  5KLV D;  2WIT A;  1GU4 A;  1Q86 Q;  2NPS B;  1BE3 D;  4RES B;  2WSC H;  2PGD A;  2LKM A;  2A45 I;  2W83 C;  3L75 J;  1CI6 B;  5L8R J;  5GTH E;  1SQV D;  2WNP F;  3AE4 C;  2XKM A;  3VN0 A;  4M7F A;  2IZ0 A;  2KK7 A;  2JHI F;  2ZYA A;  1XTC C;  1A02 F;  3LID A;  1URQ C;  5AVW B;  1SQB E;  4A7P A;  2JEE A;  4PJ0 E;  5CBO A;  3ZDM A;  1CW5 A;  1SFC C;  2YNY A;  3EFF K;  3WUU A;  1BDD A;  2M3B A;  1A02 J;  3I5C A;  4ASW A;  1PP9 E;  3T97 A;  2H89 C;  2O01 H;  3H1L D;  2WQY C;  2D2C D;  2PFX A;  3NMD A;  2NRG A;  1NTM K;  3IF4 A;  3PRJ A;  1HGZ A;  1L4A C;  4XA4 A;  4R9T A;  2QJK C;  3OJA B;  1L0L K;  2C0X A;  5APS A;  2IZ1 A;  4B86 A;  1EDI A;  5CCH C;  3E1I C;  5KLV K;  1ZME C;  3JSV C;  1J1E B;  3D70 A;  3GG2 A;  2XV5 A;  1U57 A;  2E42 A;  3CI9 A;  2Q5U A;  1VQP P;  3T97 B;  3KHU A;  2ZJS E;  5DJU B;  4N78 D;  2N9B A;  2QG4 A;  3CWB D;  3RK2 D;  4UB8 H;  1FZC B;  1YTZ T;  3CME P;  1SQX G;  3BCC E;  2WVR A;  2J60 A;  4M3L A;  1NTZ J;  1MKM A;  4PV1 B;  1LWU A;  5CHX A;  4PD4 E;  2NZ2 A;  3L72 J;  1KN7 A;  2J3O A;  4YPC A;  3Q2Y A;  3FIB A;  2K9J A;  1BCC D;  1GU5 A;  1QLE D;  2IBZ I;  3BVH C;  3L74 G;  1PPJ E;  1NWQ A;  3HUS A;  3H1K D;  4CPG A;  1FZF B;  1JEK A;  4QMA A;  4ZKU A;  2KLU A;  2Q9I A;  1HJB A;  1LWU B;  1EC5 A;  4I7Z C;  2O01 N;  5CCG C;  4M7H A;  2E74 C;  3VMX A;  1M90 Q;  2JHM F;  2H8P D;  3CX5 D;  2YIU C;  5AVV B;  3FXD A;  3TYY A;  2POH A;  1KZU B;  1BGY J;  3C1L A;  1VQL P;  3H1J E;  1PZQ A;  3S9O A;  1E79 H;  3GW6 A;  3RL0 g;  1GMJ A;  2OYH A;  1JUN A;  4R4M A;  3PTZ A;  1M7L A;  2D2C B;  3MTU E;  1DD3 A;  1H8A A;  2FYU G;  2H88 C;  1KMI Z;  3AE1 C;  3G6E P;  3L72 E;  1HVV A;  2JHK F;  2WSC J;  2OQQ A;  4WBA A;  2MJZ A;  2OYH B;  2AEM A;  1SQB D;  2J3G A;  1TU3 F;  2C0W A;  4HB1 A;  1NTK K;  4N3Y B;  4JPZ B;  1NKZ B;  1EZV I;  1ZLL A;  2KIK A;  1X22 A;  2JO1 A;  2FBW C;  1PV3 A;  2HOD C;  1L2P A;  1LT9 A;  5KJ7 C;  3AEE C;  1PP9 D;  3TGU E;  3M0D C;  2ZT9 D;  1NYH A;  1VQ8 P;  2QSI A;  3VYI A;  1URQ D;  3VTP C;  2P67 A;  4O9B A;  2O01 J;  1MUU A;  1SVF A;  1SFC D;  1IFJ A;  1SQQ K;  1W2E A;  1LTJ A;  1LT9 B;  4ZMD A;  4GIF A;  3A5T A;  2QRX A;  1P84 H;  1YQ4 C;  3II6 A;  2FFD A;  3RL0 B;  2WSE H;  2YKQ A;  3H32 C;  3V6I A;  1HH0 A;  3MUD C;  1NTZ G;  2J61 A;  3L75 D;  4XE5 B;  1GW4 A;  5AVX B;  1L4A D;  3BCC D;  1RF1 C;  1NOH A;  2P7J A;  5CCH D;  4PD4 D;  1KC8 Q;  3H1H E;  2Y0D A;  2H43 C;  3U59 A;  3B5N A;  1N86 A;  2QIW A;  2FFD B;  1NGM B;  1AV1 A;  1PPJ D;  5AW5 B;  3Q5P A;  2J61 B;  2OTJ P;  1ZR2 A;  1LT1 A;  1IC2 A;  3L71 J;  4WWI A;  2GM4 A;  1BGY G;  2KZJ A;  4LLH A;  3B5N B;  2B89 A;  1NO4 A;  2W27 A;  1N86 B;  2QEX P;  1NH4 A;  1JY3 O;  1SQP E;  2LXC B;  3VP8 A;  1ZN5 A;  2O3J A;  1SFC A;  3H1J D;  4WY4 C;  1FZG B;  2P10 A;  2J5U A;  4L73 A;  5KLI B;  2E74 D;  3TNU A;  4JYO X;  3WMM 0;  1L4A A;  2Q1K A;  3RK3 B;  1Q81 Q;  2J64 A;  3L72 D;  3JCU H;  2Q7C A;  3E1I A;  1U7M A;  2BEZ F;  3G4S P;  2KSE A;  3F89 A;  5AW0 B;  1QL1 A;  2E76 C;  3Q5S A;  3TNU B;  3WUV A;  2BEQ D;  1FZB C;  4OH8 B;  1L4A B;  2B9B A;  1YJN P;  4NYT A;  4EIJ A;  3TGU D;  3E1I B;  3MIW A;  2JR8 A;  4Y99 C;  1OW8 A;  3IFM A;  1LJ2 A;  5AW1 B;  1QL2 A;  3EFG A;  1EXJ A;  3LIE A;  1BSN A;  2BCC J;  3SWK A;  1VF5 C;  3PHL A;  3AE7 C;  2IBZ G;  3BVH A;  5KAF H;  1FDM A;  3H1L E;  2XZR A;  2XU6 A;  2K9Y A;  3A3Y B;  3V4W A;  3IN6 A;  5KKZ C;  2P58 A;  3V5B A;  5KJ7 D;  3W68 A;  4NPD A;  5CCG A;  1PGQ A;  3FWN A;  5B5E E;  1NTK J;  2WSE J;  1L0N E;  3V4Q A;  1YJ9 P;  5AW7 B;  4YTP C;  1G1I A;  4N78 E;  4C46 A;  3H1H D;  3Q3D A;  2KNC A;  2HLO C;  2M5A A;  3TK1 A;  3AE2 C;  2I8D A;  5AVY B;  1FZD A;  1N7S B;  3SFE C;  1KFN A;  1ZP0 C;  3M91 A;  2IDB A;  4BWN A;  4R9J A;  2K1A A;  1JOC A;  1SQX J;  1LTI C;  1OVR A;  3PH0 A;  4YXW H;  1SQQ J;  1KYO E;  2K88 A;  3EWK A;  3W67 A;  1NHL A;  1GK6 A;  2CPB A;  2YKP A;  1NAF A;  3G3Z A;  3HD7 C;  2XNX C;  4H13 C;  4I1L A;  1NU1 E;  2KNC B;  2AEJ A;  2J0H A;  1H0T A;  2M5A B;  1QVF O;  4OGQ D;  3VP9 A;  1YJW P;  2MKV A;  1G2C A;  4HH2 A;  2A06 G;  1JC9 A;  1M1J C;  3NTN A;  2OYI C;  3PP5 A;  1ZR4 A;  2R44 A;  5H2F H;  1UIX A;  2HOD A;  4JF7 A;  2C9L Y;  3BRV B;  3B4S A;  1P84 E;  1MZ9 A;  1KB9 E;  1S5L X;  1H0T B;  3M0D A;  2KSJ A;  2ZXX A;  3H1I G;  1K73 Q;  1UII A;  1G2C B;  4GOD A;  2R3S A;  2KUB A;  3VMY A;  3TF5 A;  2D39 A;  2L91 A;  3M9Q A;  4WY4 D;  1IK9 A;  4LC1 A;  2G3A A;  3WU2 H;  1KIL A;  3M9H A;  1Q7Y Q;  3H32 A;  2WMM A;  3MUD A;  1OWA A;  1K8A Q;  2QVA A;  2FYU J;  2FIB A;  2W6A A;  2ZT9 C;  1EXI A;  2BCC G;  1WT6 A;  2ZVN B;  3AED C;  1RF0 C;  1SQP K;  1G1J A;  2E75 C;  2HPC C;  2H43 A;  5B66 H;  3L74 E;  1GK4 A;  1J1D C;  4ZFG A;  1KIL B;  3A0B H;  3H32 B;  4DZO A;  1VQM P;  3EQ2 A;  5AW9 B;  1EDK A;  2E76 D;  1X8Y A;  3PJS K;  1M57 D;  3M06 A;  4H0L B;  1NTK G;  1LNQ A;  1HF9 A;  1ZOY C;  3KXD A;  3QWO C;  4I2L C;  4AYC A;  2H43 B;  4D6T J;  2CPS A;  3MHV A;  1L0N D;  1LTG C;  3I55 P;  3CXH H;  2JP3 A;  1VF5 D;  1KQF B;  2FXP A;  1VL2 A;  1CSB A;  1VQ4 P;  2FY8 A;  3JCU E;  3SFD C;  3L75 E;  4WY4 A;  1SQV K;  1RE3 C;  5KAI H;  2FKW B;  2JWA A;  1SQQ G;  3P32 A;  1AQ5 A;  4KT0 J;  4RKU J;  1S72 P;  1FJK A;  3IR9 A;  1N73 C;  2M8R A;  1KYO D;  1IJD B;  2QM7 A;  4WY4 B;  1NU1 D;  3CCR P;  2W6B A;  3CXH I;  2N1T C;  3NFQ A;  1RY3 A;  1FZE A;  1VPC A;  3A7O A;  1JTH A;  2V4H A;  1KQS O;  2RH0 A;  2K9J B;  1FZB A;  2KLV A;  4U3F J;  2Z4E A;  3HUS B;  1P84 D;  1KB9 D;  1VQK P;  3HD7 D;  3GF3 A;  4H13 D;  3O6Q A;  2Q9I B;  2WT7 A;  3L70 J;  4GDO A;  1FZA A;  1VQ5 P;  1FZE B;  3CCL P;  1JTH B;  2KS1 A;  2ZYD A;  4L74 A;  2JKV A;  2DW3 A;  2E43 A;  1X0T A;  1FS0 E;  1RE4 C;  2R3C A;  1NTZ E;  3E7K A;  4DT0 A;  2Z4E B;  2Z5I A;  2IFN A;  2FYZ A;  1SQX D;  2L5G B;  2FYN C;  1YBK A;  4HKZ H;  2GY7 A;  2RMZ A;  3BCC G;  1FZA B;  2JDI H;  1NU1 K;  5AW3 B;  2KS1 B;  1GL2 C;  1OXZ A;  3RK2 B;  3A0H E;  1MV8 A;  3L74 D;  4DCK A;  2HLO A;  4NPF X;  5CJ4 A;  1FIC A;  1BSH A;  3D71 A;  4KHX A;  3GLM A;  1USD A;  1IK7 A;  5AW8 B;  2Y0E A;  1PGP A;  4D6T G;  4EDF A;  4BRY A;  1BGY E;  2NPS C;  1N2D C;  5H2F E;  2JHL F;  1R5L A;  4IL6 E;  4RJT A;  3D6Z A;  1VQO P;  3HD7 A;  2E75 D;  2J3F D;  4OVN F;  1JCC A;  1MFT A;  2PAJ A;  1M1J A;  1AQT A;  1KTM A;  2AXC A;  2OYI A;  3F5H A;  4BRY B;  4UB6 H;  4JYC A;  2J5Z A;  3M9B A;  2XND H;  1D7M A;  4H13 B;  3Q5R A;  1SQB K;  3L37 A;  2HYN A;  5TIS H;  1LTJ B;  1Q2N A;  1BDC A;  4OGQ C;  3L73 J;  1JO5 A;  2KYV A;  1NTM J;  1Z3S A;  4GOF A;  1ZRT E;  1L0L J;  1NVO A;  5KLV J;  1J1E C;  5B66 E;  4U3F G;  5AVS B;  2OTL P;  1BE3 J;  2FXO A;  5APV A;  3BAT A;  3L70 G;  2OGU A;  2R5D A;  3USS A;  3TGU G;  3BRT B;  3L35 A;  1URQ A;  1SQV J;  1SLQ A;  1FZC C;  5KTB A;  1RF0 A;  2IX7 C;  3KQG A;  5BU8 B;  3CC7 P;  2YMY A;  2IBZ E;  1GTW A;  2J3F A;  2QM8 A;  2KB7 P;  2E5Y A;  2N1T D;  3HRN A;  4EOT A;  1DIP A;  1OW7 A;  1H89 A;  2ZT9 B;  5CBN A;  1OX3 A;  1GD2 E;  2WZ7 A;  1NTZ D;  3KDP B;  1URQ B;  4UB8 E;  1FZF C;  1RH5 B;  5APT A;  1YIJ P;  5CCH A;  1SFC B;  3JC2 2;  1VQN P;  1IFD A;  1YIT P;  3H1I J;  3VOP A;  2ITA A;  1FIB A;  5AVZ B;  2KP8 A;  3L71 E;  3KYQ A;  2QJK B;  1RE3 A;  5BU5 A;  1T3J A;  2JJL A;  3FXE A;  3CL3 D;  1IFN A;  3CWB J;  4PD4 H;  4W7Z A;  1N73 A;  2HFE D;  1BGY D;  1T8Z A;  1GL2 D;  3B71 A;  2ZAE B;  1PIX A;  3QH9 A;  4OWF A;  3HTK A;  4NPE A;  2C9N Y;  1BCC J;  3CCE P;  3SWF A;  1RE3 B;  2A06 E;  1SQP G;  5M1B A;  2QJY C;  2CK3 H;  1HUC A;  2N1T A;  3B8E B;  1KV4 A;  2ZFC A;  3SWY A;  1NTZ K;  1KQL A;  5APQ A;  1EZV E;  3H1K J;  2OYH C;  3O8Z A;  1IFM A;  1N73 B;  1OIP A;  2VRS A;  3L36 A;  1DD4 A;  4L76 A;  3A2A A;  3L73 G;  4PD4 I;  2NPS D;  1PGJ A;  4EI2 A;  1AJY A;  3BVH B;  1NTM G;  3HTK B;  3ABV C;  5BVZ A;  1L0L G;  2RN0 A;  1VQ6 P;  1T2K C;  5KLV G;  2JHH C;  1HJ0 A;  4HJG H;  2HR3 A;  2Y9Z A;  5C39 A;  1ZRT D;  1YI2 P;  4I7Z B;  2H7H A;  1BE3 G;  2E74 B;  3HE4 A;  3FX0 A;  1MFZ A;  3K5B A;  1RE4 A;  2YIU B;  2YO2 A;  1SQV G;  1T6A A;  1LT9 C;  3MZW B;  2R32 A;  4TLF A;  2J2P A;  2BCC E;  3AE8 C;  2RKL A;  5AW2 B;  1KD1 Q;  2IYO A;  1WRG A;  3HE4 B;  1RE4 B;  2IBZ D;  1FDI A;  2Z5H A;  1SQB J;  1LGH B;  3IAO A;  3OA7 A;  5KJ7 A;  1NTK E;  2R5B A;  3H1L G;  2FFD C;  2GA1 A;  2K3R A;  1W2B O;  1AFO A;  1PL5 A;  1PP9 J;  3R4Y A;  2WPR A;  5CMZ A;  1EDJ A;  1CI6 A;  1VDF A;  1OVV A;  4PV1 D;  2HOD B;  5TIS E;  3B5N C;  3CCM P;  2B88 A;  1AVY A;  1FDO A;  3CWB G;  1S3J A;  1SQX E;  3L71 D;  1SQQ E;  1RHZ B;  1RF1 A;  3KZI H;  1FZG C;  4HYT B; 
#chains in the Genus database with same CATH homology
 5AVQ B;  5AW5 B;  2FXM A;  3UIA A;  4AUW A;  1HGV A;  2KOG A;  2J61 B;  2J0G A;  1FZA A;  4I6M C;  1FZE B;  3H6P A;  1FBM A;  1ZR2 A;  1JTH B;  5AVU B;  4C7N B;  3R2P A;  1FU1 A;  1NKN A;  2IPP A;  1IC2 A;  2E43 A;  1N7S A;  2N1T B;  1RE4 C;  1FOS E;  1SP4 A;  2R3C A;  2GM4 A;  3RK3 C;  3CLQ A;  3MD0 A;  2Z4E B;  3GHG C;  2Z5I A;  2IFN A;  4LLH A;  3B5N B;  1GDT A;  1N86 B;  1NO4 A;  2W27 A;  3HE5 A;  1Z56 A;  1Z3U A;  3V2P A;  2FYZ A;  1RF1 B;  2L5G B;  1NH4 A;  1JY3 O;  2GY7 A;  1ZV8 A;  3VP8 A;  2WPQ A;  1ZN5 A;  2YKO A;  1FZA B;  1JY3 N;  3NXS A;  1NU1 K;  1FAV A;  5AW3 B;  3N7N A;  1GL2 C;  1OXZ A;  1SFC A;  1KIL D;  4WY4 C;  3RL0 C;  1FZG B;  1JCD A;  3RK2 B;  3P8C E;  4ZKP A;  1FZC A;  1MV8 A;  1S9K E;  1PFI A;  2HLO A;  3LW5 H;  1GL2 A;  5CJ4 A;  1LTT C;  1FIC A;  1X9V A;  3HE5 B;  5APY A;  4JYO X;  3TNU A;  4KHX A;  2I1J A;  3WMM 0;  1HBW A;  2BAS A;  1L4A A;  1HTL C;  5AW8 B;  3BAS A;  2O1K A;  2HG5 D;  5APU A;  3RK3 B;  2J64 A;  2Q7C A;  3L4F A;  1LTJ C;  3E1I A;  2WWW A;  5AVT B;  2NPS C;  1N2D C;  1GZL A;  3OAK A;  1JY3 P;  3V2Q A;  2JHL F;  2A45 H;  1FZF A;  3HD7 A;  4JZC A;  5AW0 B;  1QL1 A;  1T3U A;  3P7K A;  2J3F D;  1GL2 B;  1JY2 O;  2NPS A;  3C9I A;  4C7R A;  3TNU B;  5CJ0 A;  1FZB C;  1JY2 N;  1JCC A;  1T2K D;  4OH8 B;  2P1J A;  1EQ7 A;  1L4A B;  2PAJ A;  1M1J A;  4NYT A;  2OYI A;  1IFI A;  4EIJ A;  2ZXE B;  4EPU A;  3E1I B;  3MIW A;  3U1A A;  2J1G A;  4JYC A;  1N86 C;  4Y99 C;  1JNM A;  1IO4 A;  2J5Z A;  3IFM A;  3M9B A;  2WTY A;  5AW1 B;  1QL2 A;  2WIT A;  3EFG A;  3LIE A;  1SQB K;  3L37 A;  2XDJ A;  2PP6 A;  2HYN A;  1LTJ B;  1L0N K;  1GU4 A;  2NPS B;  3BVH A;  4RES B;  3RL0 D;  2WSC H;  1FDM A;  2LKM A;  2A45 I;  1JO5 A;  2XZR A;  2XU6 A;  2KYV A;  4N6J A;  1CI6 B;  1Z3S A;  1N7S C;  2YO3 A;  3A3Y B;  4JYB A;  3V4W A;  2WNP F;  2XKM A;  1XTG B;  5KJ7 D;  3V5B A;  3VN0 A;  4M7F A;  2JHI F;  1FZB B;  1J1E C;  1XTC C;  4WB4 A;  1H88 A;  2WSF H;  1A02 F;  5CCG A;  3LID A;  3V2R A;  1URQ C;  5AVW B;  5AVS B;  1DX7 A;  2JEE A;  5APV A;  3V4Q A;  1CW5 A;  1SFC C;  2YNY A;  3BAT A;  4Y99 B;  3MGN A;  2M3B A;  5AW7 B;  1A02 J;  3I5C A;  2R5D A;  1G1I A;  4N78 E;  2WT7 B;  3BRT B;  4C46 A;  3L35 A;  1URQ A;  1SLQ A;  1FZC C;  5KTB A;  1RF0 A;  2IX7 C;  3KQG A;  5BU8 B;  2HLO C;  3T97 A;  2O01 H;  2YMY A;  3TK1 A;  3NMD A;  1GTW A;  2J3F A;  2QM8 A;  2KB7 P;  5AVY B;  1FZD A;  1NTM K;  1N7S B;  3VMZ A;  2N1T D;  1HGZ A;  1L4A C;  3HRN A;  4XA4 A;  4R9T A;  4EOT A;  3OJA B;  1L0L K;  1KFN A;  2C0X A;  3M91 A;  5APS A;  4R9J A;  4B86 A;  1JOC A;  3B5N D;  5CCH C;  1LTI C;  5APW A;  1H89 A;  3E1I C;  5KLV K;  1GD2 E;  2WZ7 A;  1J1E B;  2XV5 A;  1NHL A;  1GK6 A;  3KDP B;  1URQ B;  2CPB A;  2YKP A;  1NAF A;  2E42 A;  3G3Z A;  1FZF C;  3HD7 C;  2IFM A;  3CI9 A;  5APT A;  2XNX C;  4I1L A;  2Q5U A;  3U1C A;  2J0H A;  5CCH A;  1SFC B;  4N78 D;  2N9B A;  3VP9 A;  1IFD A;  1G2C A;  3RK2 D;  4HH2 A;  3VOP A;  1JC9 A;  3KPE A;  1FZC B;  1M1J C;  1YTZ T;  2XNX A;  1FIB A;  3TSI A;  3NTN A;  2OYI C;  2HLO B;  5AVZ B;  3PP5 A;  1KFM A;  1ZR4 A;  2J60 A;  5AW6 B;  4GKG A;  4M3L A;  4IFM A;  4AQR D;  2KP8 A;  2HOD A;  1LWU A;  4JF7 A;  5CHX A;  3P8C D;  4IFD K;  2C9L Y;  3KYQ A;  3BRV B;  1S9K D;  5APX A;  2J3O A;  1RE3 A;  4LGD E;  3FIB A;  3RK3 D;  1MZ9 A;  1J2J B;  1GU5 A;  5BU5 A;  1T3J A;  2JJL A;  1SQX K;  3CL3 D;  3M0D A;  1IFN A;  3BVH C;  2KSJ A;  1JMM A;  1NWQ A;  1LTA C;  3HUS A;  1G2C B;  1FID A;  4W7Z A;  1KIL C;  1FZF B;  4ZKU A;  3HD7 B;  3N4X A;  2XNX B;  1N73 A;  1DEB A;  2HFE D;  1FJP A;  3VMY A;  2Q9I A;  1T8Z A;  1HJB A;  2D39 A;  1E5W A;  1GL2 D;  4GT1 A;  3M9Q A;  4WY4 D;  1LWU B;  1DH3 A;  1GW3 A;  3HTK A;  2C9N Y;  1IK9 A;  4LC1 A;  1HWT C;  1KIL A;  3M9H A;  1M1J B;  5CCG C;  3SWF A;  1RE3 B;  4M7H A;  3H32 A;  2OYI B;  2P2U A;  3MUD A;  5AW4 B;  1JY2 P;  1OWA A;  1HUC A;  2N1T A;  3B8E B;  3VMX A;  2JHM F;  2ZFC A;  3SWY A;  2FIB A;  1NTZ K;  1KQL A;  2H8P D;  4W7Y A;  2W6A A;  5APQ A;  5AVV B;  1CZQ A;  2J59 M;  2OYH C;  3TYY A;  2POH A;  1KZU B;  3O8Z A;  1IFM A;  1N73 B;  2VRS A;  3L36 A;  1WT6 A;  3A2A A;  1RF0 C;  1SQP K;  2NPS D;  3BVH B;  1G1J A;  2HPC C;  1YYC A;  5AVR B;  2H43 A;  3HTK B;  2OYH A;  1JUN A;  2Q3I A;  5BVZ A;  1GK4 A;  1J1D C;  4ZFG A;  1KIL B;  1M7L A;  3H32 B;  4DZO A;  1FZG A;  3MTU E;  3EQ2 A;  1H8A A;  5AW9 B;  2A45 G;  1T2K C;  2JHH C;  1X8Y A;  2HPC A;  3M06 A;  2H7H A;  1HVV A;  2O1J A;  4DOJ A;  2JHK F;  3HE4 A;  1MFZ A;  1RE4 A;  2I1K A;  4WBA A;  2FYU K;  2MJZ A;  2OAR A;  4I2L C;  3GHG A;  4AYC A;  2YO2 A;  2OYH B;  1LTS C;  2H43 B;  1LT9 C;  2J3G A;  2C0W A;  2R32 A;  2CPS A;  2J2P A;  1NTK K;  4N3Y B;  1LTG C;  1RF0 B;  1NKZ B;  5AW2 B;  1ZLL A;  2J3U A;  2WPS A;  2HPC B;  4W80 A;  1CSB A;  3P8M C;  1LTB C;  1FOS F;  1LT9 A;  1LWU C;  2HOD C;  1J1D B;  5KJ7 C;  1WRG A;  1N7S D;  5CCG D;  4WY4 A;  1SQV K;  3M0A A;  1RE3 C;  3HE4 B;  2FKW B;  1RE4 B;  2Z5H A;  3M0D C;  3P32 A;  1LGH B;  1AQ5 A;  3GHG B;  3OA7 A;  5KJ7 A;  3HUS C;  1FJK A;  3VYI A;  1URQ D;  2J58 A;  2R5B A;  3VTP C;  2FFD C;  2P67 A;  3IR9 A;  4O9B A;  1N73 C;  1MUU A;  1SVF A;  2GUV A;  2M8R A;  2Q9I C;  2J0Y A;  1AFO A;  1IJD B;  1SFC D;  1IFJ A;  1SQQ K;  2QM7 A;  1W2E A;  1LTJ A;  1LT9 B;  1FZE C;  4GIF A;  2GUS A;  3A5T A;  2WPR A;  4WY4 B;  2FFD A;  3II6 A;  3RL0 B;  2WSE H;  2W6B A;  5CMZ A;  2YKQ A;  3H32 C;  1HH0 A;  1CI6 A;  1VDF A;  2N1T C;  3NFQ A;  2J61 A;  1RY3 A;  4IFF A;  4XE5 B;  2HOD B;  1FZE A;  1GW4 A;  5AVX B;  2Z4E C;  1VPC A;  3A7O A;  1JTH A;  3B5N C;  1L4A D;  4C7N A;  1RF1 C;  1FZB A;  3V2N A;  1NOH A;  2P7J A;  5CCH D;  1FZA C;  1X79 B;  2KLV A;  2Z4E A;  3HUS B;  2H43 C;  3U59 A;  3B5N A;  1N7L A;  1N86 A;  2FFD B;  1RF1 A;  3HD7 D;  1YTZ I;  1FZG C;  4HYT B;  2Q9I B;  2WT7 A;  3RK2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...