1Z3SA

Angiopoietin-2 receptor binding domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
216
structure length
216
Chain Sequence
EFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-2
publication title Structure of the angiopoietin-2 receptor binding domain and identification of surfaces involved in Tie2 recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1z3sA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1z3sA02
2HPCC 2JHHC 2Z4EC 1N73B 4ZFGA 2J3UA 1FIBA 2H43B 2J3GA 1Z3SA 2HPCB 2D39A 3BVHC 2Z4EB 2J3OA 2J60A 1JC9A 3FIBA 4NYTA 3H32C 1RF0C 3BVHB 1N86C 1FIDA 2JHMF 2JHIF 1FICA 2FIBA 1FZCB 1FZEC 2JHKF 4EPUA 1Z3UA 1RF0B 3H32B 2J0HA 1N86B 2WNPF 1FZGC 2J61A 2Q9IB 1RF1C 2J61B 1FZEB 2OYHC 2J3FD 1RE3C 4R9TA 2JHLF 2OYIC 4JZCA 1RF1B 1LT9C 2OYHB 2J3FA 1RE3B 3E1IC 4JYOX 1M1JC 2HLOC 4R9JA 2OYIB 2J64A 2J0YA 4M7HA 1LT9B 3E1IB 1M1JB 2HLOB 2J5ZA 1LWUC 2HODC 1FZGB 4M7FA 3GHGC 2XNXC 2GY7A 1FZAC 1FZBC 1LWUB 2HODB 3HUSC 1RE4C 1FZFC 2FFDC 2XNXB 2J1GA 1FZAB 1FZBB 3HUSB 1RE4B 1LTJC 1FZFB 1FZCC 2FFDB 1N73C 2J0GA 2J2PA 2H43C 2Q9IC 1FZDA 1LTJB
chains in the Genus database with same CATH superfamily
2HPCC 2JHHC 2Z4EC 1N73B 4ZFGA 2J3UA 1FIBA 2H43B 2J3GA 1Z3SA 2HPCB 2D39A 3BVHC 2Z4EB 2J3OA 2J60A 1JC9A 3FIBA 4NYTA 3H32C 1RF0C 3BVHB 1N86C 1FIDA 2JHMF 2JHIF 1FICA 2FIBA 1FZCB 1FZEC 2JHKF 4EPUA 1Z3UA 1RF0B 3H32B 2J0HA 1N86B 2WNPF 1FZGC 2J61A 2Q9IB 1RF1C 2J61B 1FZEB 2OYHC 2J3FD 1RE3C 4R9TA 2JHLF 2OYIC 4JZCA 1RF1B 1LT9C 2OYHB 2J3FA 1RE3B 3E1IC 4JYOX 1M1JC 2HLOC 4R9JA 2OYIB 2J64A 2J0YA 4M7HA 1LT9B 3E1IB 1M1JB 2HLOB 2J5ZA 1LWUC 2HODC 1FZGB 4M7FA 3GHGC 2XNXC 2GY7A 1FZAC 1FZBC 1LWUB 2HODB 3HUSC 1RE4C 1FZFC 3GHGB 2FFDC 2XNXB 2J1GA 1FZAB 1FZBB 3HUSB 1RE4B 1LTJC 1FZFB 1FZCC 2FFDB 1N73C 2J0GA 2J2PA 2H43C 2Q9IC 1FZDA 1LTJB
chains in the Genus database with same CATH topology
2HPCC 2JHHC 2Z4EC 1N73B 4ZFGA 2J3UA 1FIBA 2H43B 2J3GA 1Z3SA 2HPCB 2D39A 3BVHC 2Z4EB 2J3OA 2J60A 1JC9A 3FIBA 4NYTA 3H32C 1RF0C 3BVHB 1N86C 1FIDA 2JHMF 2JHIF 1FICA 2FIBA 1FZCB 1FZEC 2JHKF 4EPUA 1Z3UA 1RF0B 3H32B 2J0HA 1N86B 2WNPF 1FZGC 2J61A 2Q9IB 1RF1C 2J61B 1FZEB 2OYHC 2J3FD 1RE3C 4R9TA 2JHLF 2OYIC 4JZCA 1RF1B 1LT9C 2OYHB 2J3FA 1RE3B 3E1IC 4JYOX 1M1JC 2HLOC 4R9JA 2OYIB 2J64A 2J0YA 4M7HA 1LT9B 3E1IB 1M1JB 2HLOB 2J5ZA 1LWUC 2HODC 1FZGB 4M7FA 3GHGC 2XNXC 2GY7A 1FZAC 1FZBC 1LWUB 2HODB 3HUSC 1RE4C 1FZFC 2FFDC 2XNXB 2J1GA 1FZAB 1FZBB 3HUSB 1RE4B 1LTJC 1FZFB 1FZCC 2FFDB 1N73C 2J0GA 2J2PA 2H43C 2Q9IC 1FZDA 1LTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPC C;  2JHH C;  2Z4E C;  1N73 B;  4ZFG A;  2J3U A;  1FIB A;  2H43 B;  2J3G A;  1Z3S A;  2HPC B;  2D39 A;  3BVH C;  2Z4E B;  2J3O A;  2J60 A;  1JC9 A;  3FIB A;  4NYT A;  3H32 C;  1RF0 C;  3BVH B;  1N86 C;  1FID A;  2JHM F;  2JHI F;  1FIC A;  2FIB A;  1FZC B;  1FZE C;  2JHK F;  4EPU A;  1Z3U A;  1RF0 B;  3H32 B;  2J0H A;  1N86 B;  2WNP F;  1FZG C;  2J61 A;  2Q9I B;  1RF1 C;  2J61 B;  1FZE B;  2OYH C;  2J3F D;  1RE3 C;  4R9T A;  2JHL F;  2OYI C;  4JZC A;  1RF1 B;  1LT9 C;  2OYH B;  2J3F A;  1RE3 B;  3E1I C;  4JYO X;  1M1J C;  2HLO C;  4R9J A;  2OYI B;  2J64 A;  2J0Y A;  4M7H A;  1LT9 B;  3E1I B;  1M1J B;  2HLO B;  2J5Z A;  1LWU C;  2HOD C;  1FZG B;  4M7F A;  3GHG C;  2XNX C;  2GY7 A;  1FZA C;  1FZB C;  1LWU B;  2HOD B;  3HUS C;  1RE4 C;  1FZF C;  2FFD C;  2XNX B;  2J1G A;  1FZA B;  1FZB B;  3HUS B;  1RE4 B;  1LTJ C;  1FZF B;  1FZC C;  2FFD B;  1N73 C;  2J0G A;  2J2P A;  2H43 C;  2Q9I C;  1FZD A;  1LTJ B; 
#chains in the Genus database with same CATH topology
 2HPC C;  2JHH C;  2Z4E C;  1N73 B;  4ZFG A;  2J3U A;  1FIB A;  2H43 B;  2J3G A;  1Z3S A;  2HPC B;  2D39 A;  3BVH C;  2Z4E B;  2J3O A;  2J60 A;  1JC9 A;  3FIB A;  4NYT A;  3H32 C;  1RF0 C;  3BVH B;  1N86 C;  1FID A;  2JHM F;  2JHI F;  1FIC A;  2FIB A;  1FZC B;  1FZE C;  2JHK F;  4EPU A;  1Z3U A;  1RF0 B;  3H32 B;  2J0H A;  1N86 B;  2WNP F;  1FZG C;  2J61 A;  2Q9I B;  1RF1 C;  2J61 B;  1FZE B;  2OYH C;  2J3F D;  1RE3 C;  4R9T A;  2JHL F;  2OYI C;  4JZC A;  1RF1 B;  1LT9 C;  2OYH B;  2J3F A;  1RE3 B;  3E1I C;  4JYO X;  1M1J C;  2HLO C;  4R9J A;  2OYI B;  2J64 A;  2J0Y A;  4M7H A;  1LT9 B;  3E1I B;  1M1J B;  2HLO B;  2J5Z A;  1LWU C;  2HOD C;  1FZG B;  4M7F A;  3GHG C;  2XNX C;  2GY7 A;  1FZA C;  1FZB C;  1LWU B;  2HOD B;  3HUS C;  1RE4 C;  1FZF C;  3GHG B;  2FFD C;  2XNX B;  2J1G A;  1FZA B;  1FZB B;  3HUS B;  1RE4 B;  1LTJ C;  1FZF B;  1FZC C;  2FFD B;  1N73 C;  2J0G A;  2J2P A;  2H43 C;  2Q9I C;  1FZD A;  1LTJ B; 
#chains in the Genus database with same CATH homology
 2HPC C;  2JHH C;  2Z4E C;  1N73 B;  4ZFG A;  2J3U A;  1FIB A;  2H43 B;  2J3G A;  1Z3S A;  2HPC B;  2D39 A;  3BVH C;  2Z4E B;  2J3O A;  2J60 A;  1JC9 A;  3FIB A;  4NYT A;  3H32 C;  1RF0 C;  3BVH B;  1N86 C;  1FID A;  2JHM F;  2JHI F;  1FIC A;  2FIB A;  1FZC B;  1FZE C;  2JHK F;  4EPU A;  1Z3U A;  1RF0 B;  3H32 B;  2J0H A;  1N86 B;  2WNP F;  1FZG C;  2J61 A;  2Q9I B;  1RF1 C;  2J61 B;  1FZE B;  2OYH C;  2J3F D;  1RE3 C;  4R9T A;  2JHL F;  2OYI C;  4JZC A;  1RF1 B;  1LT9 C;  2OYH B;  2J3F A;  1RE3 B;  3E1I C;  4JYO X;  1M1J C;  2HLO C;  4R9J A;  2OYI B;  2J64 A;  2J0Y A;  4M7H A;  1LT9 B;  3E1I B;  1M1J B;  2HLO B;  2J5Z A;  1LWU C;  2HOD C;  1FZG B;  4M7F A;  3GHG C;  2XNX C;  2GY7 A;  1FZA C;  1FZB C;  1LWU B;  2HOD B;  3HUS C;  1RE4 C;  1FZF C;  2FFD C;  2XNX B;  2J1G A;  1FZA B;  1FZB B;  3HUS B;  1RE4 B;  1LTJ C;  1FZF B;  1FZC C;  2FFD B;  1N73 C;  2J0G A;  2J2P A;  2H43 C;  2Q9I C;  1FZD A;  1LTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...