2J3UA

L-ficolin complexed to galactose
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
PCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j3uA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j3uA02
2Q9IC 2HODB 2WNPF 2JHHC 2FFDC 1FZFC 1N86C 2J3UA 1M1JB 1N73C 1RE3C 1Z3SA 4R9JA 2J64A 2HPCC 1RF1C 2JHLF 3HUSC 2OYIC 1FZAB 2J0GA 4JYOX 1FZDA 2J0YA 4ZFGA 2H43C 3BVHC 1Z3UA 2XNXC 4JZCA 3E1IB 1RF0B 2JHKF 1FZGC 1LT9B 1FZBB 1LWUB 1RE4B 2J60A 3H32B 2OYHC 2J3OA 1LTJB 2JHMF 1FZCC 2JHIF 1FICA 2J2PA 1FZEC 2J61B 2Q9IB 3GHGC 2FFDB 1FZFB 1N86B 1N73B 1RE3B 1JC9A 4NYTA 2HPCB 1RF1B 2OYIB 2Z4EC 2HLOC 2J3FD 2H43B 3BVHB 2XNXB 2HODC 2GY7A 1FIDA 2D39A 1FZGB 1M1JC 4EPUA 2J3FA 2OYHB 3FIBA 4R9TA 1FZCB 1FZAC 1FZEB 3HUSB 1FIBA 3E1IC 1RF0C 1LT9C 2J61A 1FZBC 1LWUC 1RE4C 2J3GA 2J0HA 3H32C 1LTJC 2J1GA 4M7FA 2Z4EB 2HLOB 2J5ZA 2FIBA 4M7HA
chains in the Genus database with same CATH superfamily
2Q9IC 2HODB 2WNPF 2JHHC 2FFDC 1FZFC 1N86C 2J3UA 1M1JB 1N73C 1RE3C 1Z3SA 4R9JA 2J64A 2HPCC 1RF1C 2JHLF 3HUSC 2OYIC 1FZAB 2J0GA 4JYOX 1FZDA 2J0YA 4ZFGA 2H43C 3BVHC 1Z3UA 2XNXC 4JZCA 3E1IB 1RF0B 2JHKF 1FZGC 1LT9B 1FZBB 1LWUB 1RE4B 2J60A 3H32B 2OYHC 2J3OA 1LTJB 2JHMF 1FZCC 2JHIF 1FICA 2J2PA 1FZEC 2J61B 2Q9IB 3GHGC 2FFDB 1FZFB 1N86B 1N73B 1RE3B 1JC9A 4NYTA 2HPCB 1RF1B 2OYIB 2Z4EC 2HLOC 2J3FD 2H43B 3BVHB 2XNXB 2HODC 2GY7A 1FIDA 2D39A 1FZGB 1M1JC 4EPUA 2J3FA 2OYHB 3FIBA 4R9TA 1FZCB 1FZAC 1FZEB 3HUSB 3GHGB 1FIBA 3E1IC 1RF0C 1LT9C 2J61A 1FZBC 1LWUC 1RE4C 2J3GA 2J0HA 3H32C 1LTJC 2J1GA 4M7FA 2Z4EB 2HLOB 2J5ZA 2FIBA 4M7HA
chains in the Genus database with same CATH topology
2Q9IC 2HODB 2WNPF 2JHHC 2FFDC 1FZFC 1N86C 2J3UA 1M1JB 1N73C 1RE3C 1Z3SA 4R9JA 2J64A 2HPCC 1RF1C 2JHLF 3HUSC 2OYIC 1FZAB 2J0GA 4JYOX 1FZDA 2J0YA 4ZFGA 2H43C 3BVHC 1Z3UA 2XNXC 4JZCA 3E1IB 1RF0B 2JHKF 1FZGC 1LT9B 1FZBB 1LWUB 1RE4B 2J60A 3H32B 2OYHC 2J3OA 1LTJB 2JHMF 1FZCC 2JHIF 1FICA 2J2PA 1FZEC 2J61B 2Q9IB 3GHGC 2FFDB 1FZFB 1N86B 1N73B 1RE3B 1JC9A 4NYTA 2HPCB 1RF1B 2OYIB 2Z4EC 2HLOC 2J3FD 2H43B 3BVHB 2XNXB 2HODC 2GY7A 1FIDA 2D39A 1FZGB 1M1JC 4EPUA 2J3FA 2OYHB 3FIBA 4R9TA 1FZCB 1FZAC 1FZEB 3HUSB 1FIBA 3E1IC 1RF0C 1LT9C 2J61A 1FZBC 1LWUC 1RE4C 2J3GA 2J0HA 3H32C 1LTJC 2J1GA 4M7FA 2Z4EB 2HLOB 2J5ZA 2FIBA 4M7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9I C;  2HOD B;  2WNP F;  2JHH C;  2FFD C;  1FZF C;  1N86 C;  2J3U A;  1M1J B;  1N73 C;  1RE3 C;  1Z3S A;  4R9J A;  2J64 A;  2HPC C;  1RF1 C;  2JHL F;  3HUS C;  2OYI C;  1FZA B;  2J0G A;  4JYO X;  1FZD A;  2J0Y A;  4ZFG A;  2H43 C;  3BVH C;  1Z3U A;  2XNX C;  4JZC A;  3E1I B;  1RF0 B;  2JHK F;  1FZG C;  1LT9 B;  1FZB B;  1LWU B;  1RE4 B;  2J60 A;  3H32 B;  2OYH C;  2J3O A;  1LTJ B;  2JHM F;  1FZC C;  2JHI F;  1FIC A;  2J2P A;  1FZE C;  2J61 B;  2Q9I B;  3GHG C;  2FFD B;  1FZF B;  1N86 B;  1N73 B;  1RE3 B;  1JC9 A;  4NYT A;  2HPC B;  1RF1 B;  2OYI B;  2Z4E C;  2HLO C;  2J3F D;  2H43 B;  3BVH B;  2XNX B;  2HOD C;  2GY7 A;  1FID A;  2D39 A;  1FZG B;  1M1J C;  4EPU A;  2J3F A;  2OYH B;  3FIB A;  4R9T A;  1FZC B;  1FZA C;  1FZE B;  3HUS B;  1FIB A;  3E1I C;  1RF0 C;  1LT9 C;  2J61 A;  1FZB C;  1LWU C;  1RE4 C;  2J3G A;  2J0H A;  3H32 C;  1LTJ C;  2J1G A;  4M7F A;  2Z4E B;  2HLO B;  2J5Z A;  2FIB A;  4M7H A; 
#chains in the Genus database with same CATH topology
 2Q9I C;  2HOD B;  2WNP F;  2JHH C;  2FFD C;  1FZF C;  1N86 C;  2J3U A;  1M1J B;  1N73 C;  1RE3 C;  1Z3S A;  4R9J A;  2J64 A;  2HPC C;  1RF1 C;  2JHL F;  3HUS C;  2OYI C;  1FZA B;  2J0G A;  4JYO X;  1FZD A;  2J0Y A;  4ZFG A;  2H43 C;  3BVH C;  1Z3U A;  2XNX C;  4JZC A;  3E1I B;  1RF0 B;  2JHK F;  1FZG C;  1LT9 B;  1FZB B;  1LWU B;  1RE4 B;  2J60 A;  3H32 B;  2OYH C;  2J3O A;  1LTJ B;  2JHM F;  1FZC C;  2JHI F;  1FIC A;  2J2P A;  1FZE C;  2J61 B;  2Q9I B;  3GHG C;  2FFD B;  1FZF B;  1N86 B;  1N73 B;  1RE3 B;  1JC9 A;  4NYT A;  2HPC B;  1RF1 B;  2OYI B;  2Z4E C;  2HLO C;  2J3F D;  2H43 B;  3BVH B;  2XNX B;  2HOD C;  2GY7 A;  1FID A;  2D39 A;  1FZG B;  1M1J C;  4EPU A;  2J3F A;  2OYH B;  3FIB A;  4R9T A;  1FZC B;  1FZA C;  1FZE B;  3HUS B;  3GHG B;  1FIB A;  3E1I C;  1RF0 C;  1LT9 C;  2J61 A;  1FZB C;  1LWU C;  1RE4 C;  2J3G A;  2J0H A;  3H32 C;  1LTJ C;  2J1G A;  4M7F A;  2Z4E B;  2HLO B;  2J5Z A;  2FIB A;  4M7H A; 
#chains in the Genus database with same CATH homology
 2Q9I C;  2HOD B;  2WNP F;  2JHH C;  2FFD C;  1FZF C;  1N86 C;  2J3U A;  1M1J B;  1N73 C;  1RE3 C;  1Z3S A;  4R9J A;  2J64 A;  2HPC C;  1RF1 C;  2JHL F;  3HUS C;  2OYI C;  1FZA B;  2J0G A;  4JYO X;  1FZD A;  2J0Y A;  4ZFG A;  2H43 C;  3BVH C;  1Z3U A;  2XNX C;  4JZC A;  3E1I B;  1RF0 B;  2JHK F;  1FZG C;  1LT9 B;  1FZB B;  1LWU B;  1RE4 B;  2J60 A;  3H32 B;  2OYH C;  2J3O A;  1LTJ B;  2JHM F;  1FZC C;  2JHI F;  1FIC A;  2J2P A;  1FZE C;  2J61 B;  2Q9I B;  3GHG C;  2FFD B;  1FZF B;  1N86 B;  1N73 B;  1RE3 B;  1JC9 A;  4NYT A;  2HPC B;  1RF1 B;  2OYI B;  2Z4E C;  2HLO C;  2J3F D;  2H43 B;  3BVH B;  2XNX B;  2HOD C;  2GY7 A;  1FID A;  2D39 A;  1FZG B;  1M1J C;  4EPU A;  2J3F A;  2OYH B;  3FIB A;  4R9T A;  1FZC B;  1FZA C;  1FZE B;  3HUS B;  1FIB A;  3E1I C;  1RF0 C;  1LT9 C;  2J61 A;  1FZB C;  1LWU C;  1RE4 C;  2J3G A;  2J0H A;  3H32 C;  1LTJ C;  2J1G A;  4M7F A;  2Z4E B;  2HLO B;  2J5Z A;  2FIB A;  4M7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...