2J3UA

L-ficolin complexed to galactose
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
217
structure length
217
Chain Sequence
PCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 68
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j3uA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j3uA02
1FZCB 3HUSB 1N86B 2HLOB 1FZFC 1Z3UA 2HODC 3E1IB 2J61A 1FZFB 2FFDC 4M7HA 2J3FD 2HPCB 2WNPF 2HODB 4ZFGA 2J3OA 1N73C 3HUSC 2H43C 2J60A 1FICA 1N73B 3E1IC 2J61B 2J3GA 2H43B 1JC9A 2HPCC 1FIDA 2D39A 3GHGC 2J5ZA 1FZDA 2J1GA 1RE4C 1M1JC 1RF0C 2J3FA 2J2PA 2JHHC 4EPUA 4JYOX 1RE4B 2J64A 4R9JA 1M1JB 1RF0B 2OYIC 2Z4EC 4NYTA 3BVHC 1LWUC 2OYHC 1RE3C 1RF1B 2OYIB 2Z4EB 1FZBB 3BVHB 2GY7A 1LWUB 4R9TA 2XNXC 1FZEC 2OYHB 1RE3B 1FIBA 2J0GA 1FZAB 1FZGC 3H32C 1LT9C 2JHLF 4M7FA 2Q9IC 2J0HA 2XNXB 1FZEB 2J3UA 1Z3SA 2J0YA 1RF1C 1LTJC 1FZGB 3H32B 1LT9B 1FZBC 2JHMF 2Q9IB 2FIBA 1FZCC 3FIBA 1LTJB 4JZCA 2JHKF 1FZAC 2JHIF 1N86C 2HLOC 2FFDB
chains in the Genus database with same CATH superfamily
1FZCB 3HUSB 1N86B 2HLOB 1FZFC 1Z3UA 2HODC 3E1IB 2J61A 1FZFB 2FFDC 4M7HA 2J3FD 2HPCB 2WNPF 2HODB 4ZFGA 2J3OA 1N73C 3HUSC 2H43C 2J60A 1FICA 1N73B 3E1IC 2J61B 2J3GA 2H43B 1JC9A 2HPCC 1FIDA 2D39A 3GHGC 2J5ZA 1FZDA 2J1GA 1RE4C 3GHGB 1M1JC 1RF0C 2J3FA 2J2PA 2JHHC 4EPUA 4JYOX 1RE4B 2J64A 4R9JA 1M1JB 1RF0B 2OYIC 2Z4EC 4NYTA 3BVHC 1LWUC 2OYHC 1RE3C 1RF1B 2OYIB 2Z4EB 1FZBB 3BVHB 2GY7A 1LWUB 4R9TA 2XNXC 1FZEC 2OYHB 1RE3B 1FIBA 2J0GA 1FZAB 1FZGC 3H32C 1LT9C 2JHLF 4M7FA 2Q9IC 2J0HA 2XNXB 1FZEB 2J3UA 1Z3SA 2J0YA 1RF1C 1LTJC 1FZGB 3H32B 1LT9B 1FZBC 2JHMF 2Q9IB 2FIBA 1FZCC 3FIBA 1LTJB 4JZCA 2JHKF 1FZAC 2JHIF 1N86C 2HLOC 2FFDB
chains in the Genus database with same CATH topology
1FZCB 3HUSB 1N86B 2HLOB 1FZFC 1Z3UA 2HODC 3E1IB 2J61A 1FZFB 2FFDC 4M7HA 2J3FD 2HPCB 2WNPF 2HODB 4ZFGA 2J3OA 1N73C 3HUSC 2H43C 2J60A 1FICA 1N73B 3E1IC 2J61B 2J3GA 2H43B 1JC9A 2HPCC 1FIDA 2D39A 3GHGC 2J5ZA 1FZDA 2J1GA 1RE4C 1M1JC 1RF0C 2J3FA 2J2PA 2JHHC 4EPUA 4JYOX 1RE4B 2J64A 4R9JA 1M1JB 1RF0B 2OYIC 2Z4EC 4NYTA 3BVHC 1LWUC 2OYHC 1RE3C 1RF1B 2OYIB 2Z4EB 1FZBB 3BVHB 2GY7A 1LWUB 4R9TA 2XNXC 1FZEC 2OYHB 1RE3B 1FIBA 2J0GA 1FZAB 1FZGC 3H32C 1LT9C 2JHLF 4M7FA 2Q9IC 2J0HA 2XNXB 1FZEB 2J3UA 1Z3SA 2J0YA 1RF1C 1LTJC 1FZGB 3H32B 1LT9B 1FZBC 2JHMF 2Q9IB 2FIBA 1FZCC 3FIBA 1LTJB 4JZCA 2JHKF 1FZAC 2JHIF 1N86C 2HLOC 2FFDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZC B;  3HUS B;  1N86 B;  2HLO B;  1FZF C;  1Z3U A;  2HOD C;  3E1I B;  2J61 A;  1FZF B;  2FFD C;  4M7H A;  2J3F D;  2HPC B;  2WNP F;  2HOD B;  4ZFG A;  2J3O A;  1N73 C;  3HUS C;  2H43 C;  2J60 A;  1FIC A;  1N73 B;  3E1I C;  2J61 B;  2J3G A;  2H43 B;  1JC9 A;  2HPC C;  1FID A;  2D39 A;  3GHG C;  2J5Z A;  1FZD A;  2J1G A;  1RE4 C;  1M1J C;  1RF0 C;  2J3F A;  2J2P A;  2JHH C;  4EPU A;  4JYO X;  1RE4 B;  2J64 A;  4R9J A;  1M1J B;  1RF0 B;  2OYI C;  2Z4E C;  4NYT A;  3BVH C;  1LWU C;  2OYH C;  1RE3 C;  1RF1 B;  2OYI B;  2Z4E B;  1FZB B;  3BVH B;  2GY7 A;  1LWU B;  4R9T A;  2XNX C;  1FZE C;  2OYH B;  1RE3 B;  1FIB A;  2J0G A;  1FZA B;  1FZG C;  3H32 C;  1LT9 C;  2JHL F;  4M7F A;  2Q9I C;  2J0H A;  2XNX B;  1FZE B;  2J3U A;  1Z3S A;  2J0Y A;  1RF1 C;  1LTJ C;  1FZG B;  3H32 B;  1LT9 B;  1FZB C;  2JHM F;  2Q9I B;  2FIB A;  1FZC C;  3FIB A;  1LTJ B;  4JZC A;  2JHK F;  1FZA C;  2JHI F;  1N86 C;  2HLO C;  2FFD B; 
#chains in the Genus database with same CATH topology
 1FZC B;  3HUS B;  1N86 B;  2HLO B;  1FZF C;  1Z3U A;  2HOD C;  3E1I B;  2J61 A;  1FZF B;  2FFD C;  4M7H A;  2J3F D;  2HPC B;  2WNP F;  2HOD B;  4ZFG A;  2J3O A;  1N73 C;  3HUS C;  2H43 C;  2J60 A;  1FIC A;  1N73 B;  3E1I C;  2J61 B;  2J3G A;  2H43 B;  1JC9 A;  2HPC C;  1FID A;  2D39 A;  3GHG C;  2J5Z A;  1FZD A;  2J1G A;  1RE4 C;  3GHG B;  1M1J C;  1RF0 C;  2J3F A;  2J2P A;  2JHH C;  4EPU A;  4JYO X;  1RE4 B;  2J64 A;  4R9J A;  1M1J B;  1RF0 B;  2OYI C;  2Z4E C;  4NYT A;  3BVH C;  1LWU C;  2OYH C;  1RE3 C;  1RF1 B;  2OYI B;  2Z4E B;  1FZB B;  3BVH B;  2GY7 A;  1LWU B;  4R9T A;  2XNX C;  1FZE C;  2OYH B;  1RE3 B;  1FIB A;  2J0G A;  1FZA B;  1FZG C;  3H32 C;  1LT9 C;  2JHL F;  4M7F A;  2Q9I C;  2J0H A;  2XNX B;  1FZE B;  2J3U A;  1Z3S A;  2J0Y A;  1RF1 C;  1LTJ C;  1FZG B;  3H32 B;  1LT9 B;  1FZB C;  2JHM F;  2Q9I B;  2FIB A;  1FZC C;  3FIB A;  1LTJ B;  4JZC A;  2JHK F;  1FZA C;  2JHI F;  1N86 C;  2HLO C;  2FFD B; 
#chains in the Genus database with same CATH homology
 1FZC B;  3HUS B;  1N86 B;  2HLO B;  1FZF C;  1Z3U A;  2HOD C;  3E1I B;  2J61 A;  1FZF B;  2FFD C;  4M7H A;  2J3F D;  2HPC B;  2WNP F;  2HOD B;  4ZFG A;  2J3O A;  1N73 C;  3HUS C;  2H43 C;  2J60 A;  1FIC A;  1N73 B;  3E1I C;  2J61 B;  2J3G A;  2H43 B;  1JC9 A;  2HPC C;  1FID A;  2D39 A;  3GHG C;  2J5Z A;  1FZD A;  2J1G A;  1RE4 C;  1M1J C;  1RF0 C;  2J3F A;  2J2P A;  2JHH C;  4EPU A;  4JYO X;  1RE4 B;  2J64 A;  4R9J A;  1M1J B;  1RF0 B;  2OYI C;  2Z4E C;  4NYT A;  3BVH C;  1LWU C;  2OYH C;  1RE3 C;  1RF1 B;  2OYI B;  2Z4E B;  1FZB B;  3BVH B;  2GY7 A;  1LWU B;  4R9T A;  2XNX C;  1FZE C;  2OYH B;  1RE3 B;  1FIB A;  2J0G A;  1FZA B;  1FZG C;  3H32 C;  1LT9 C;  2JHL F;  4M7F A;  2Q9I C;  2J0H A;  2XNX B;  1FZE B;  2J3U A;  1Z3S A;  2J0Y A;  1RF1 C;  1LTJ C;  1FZG B;  3H32 B;  1LT9 B;  1FZB C;  2JHM F;  2Q9I B;  2FIB A;  1FZC C;  3FIB A;  1LTJ B;  4JZC A;  2JHK F;  1FZA C;  2JHI F;  1N86 C;  2HLO C;  2FFD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...