2OYIB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
NSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 93
structure length 301
sequence length 301
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiB03
1FZEC 1N86C 1FZBB 2J3FA 2OYHA 1JY2O 1RE3A 3GHGB 1LTJC 1FZFB 3E1IC 1LWUA 2J2PA 4M7HA 2FIBA 3BVHA 1Z3UA 1LT9A 3HUSC 1FZGA 1RE3B 2OYHB 2OYIC 2J1GA 2FFDB 2H43B 2J5ZA 2HODC 4R9JA 4EPUA 2Q9IA 2JHHC 2HODA 2J61B 1LT9C 3HUSA 2H43A 1FZGC 1LT9B 1FZGB 2OYIA 1RF0B 1JY3P 2J3FD 2Z4EA 1RF1A 4JZCA 1Z3SA 2OYHC 2HLOB 1M1JB 2XNXB 4M7FA 1FZEA 1RF0A 2XNXC 1M1JC 3GHGC 2JHKF 2J0YA 3FIBA 3GHGA 2J3OA 2WNPF 1FZFA 1FIBA 2JHMF 2Q9IC 1FZEB 3BVHC 2HPCA 1FZCC 1FZCB 4R9TA 3H32C 3BVHB 1T3UA 2HODB 2J61A 2Q9IB 1JY2N 2A45H 1W2EA 1RE3C 2Z4EC 3HUSB 1N73A 3E1IB 1LWUB 2JHIF 2XNXA 1FZFC 1N73B 2HLOC 1FZAA 1LTJB 1FZBA 1JY3N 2J0HA 1JY3O 1RF0C 2A45G 1FZBC 2J3UA 1N86B 1JC9A 1RF1C 3H32A 1FZAC 2GY7A 1FZCA 1RE4C 2HPCB 2H43C 1LTJA 1FZAB 2FFDC 4JYOX 2JHLF 2OYIB 4NYTA 1N86A 1FZDA 2HLOA 2FFDA 2A45I 2J60A 1FICA 1N73C 2J3GA 2J0GA 1LWUC 1JY2P 2D39A 4ZFGA 2Z4EB 3E1IA 2HPCC 1FIDA 1M1JA 1RE4B 3H32B 2J64A 1RE4A 1RF1B
chains in the Genus database with same CATH superfamily
1N86C 3D71A 1JY2O 1Y8AA 3TNUA 2QE7H 4IL6X 2ZFCA 2V4HA 2YXRB 4M7HA 1BDCA 1J1DC 5CCGC 3EFFK 1R8EA 1NTKK 4YTPC 2YO2A 4RESB 2XKMA 1LT9C 3NMDA 3B8EB 4OWFA 1A02J 1KILD 3MIWA 1BSNA 3A0HH 4AQRD 4EDFA 3K5BA 1HTLC 3NTNA 4I7ZC 2WNPF 3G3ZA 4PD4D 4UB8H 1FZCB 1BDDA 3W67A 3A0BH 1NO4A 2NPSC 2R5BA 4U7JA 2IFMA 1CI6A 3JCUH 2JHIF 1N73B 3WUTA 2BCCJ 1BE3G 1N86B 4W7ZA 1LTTC 4BXLA 1Y9BA 2Y0CA 2JHLF 3L72G 1PP9G 2C0XA 5H2FH 3CCRP 1L4AA 1PPJD 2WSEH 2AXCA 1XTCC 1NAYA 3SFDC 1QL2A 5KAIH 3S9OA 1JY2P 3L71E 4OGQB 2BEQD 2W83C 3AE8C 1JM0A 1VQ7P 1KFNA 4ZNCA 1L4AD 2WSFJ 3H1KE 4C46A 2W6AA 4XE5B 1SVFA 2KSJA 3WUVA 1N8RQ 1MFZA 3M0DA 1KYOE 5AVTB 2A06E 2H43B 3AEDC 2JO1A 4WY4D 2KP8A 2KUBA 1FZGB 1EXIA 1RQVA 3IAOA 2WVRA 3VOPA 1M1JB 2JR8A 4WY4C 4H13D 2FXMA 1OXZA 2J0YA 1A02F 1NVOA 1LTIC 2O3JA 3H1JD 3L71G 1G1IA 2IX7C 1NU1D 3KZIE 1S4XA 3H1HG 3G9RA 1M1KQ 2YNYA 3B5NC 4AUWA 1LWUB 1U7MA 5AW1B 2NPSA 2H89C 4W7YA 1BCCD 4O9BA 3TGUG 1NTMG 3RK3C 3L75E 1L0LD 3HD7D 3RL0C 3P8CE 1URQA 1MUUA 1SQPE 1WRGA 5DJTB 3AE4C 3L72J 3RK2B 2LKMA 4JF7A 3HD7C 3KXDA 3H32B 3LIEA 3L73G 2FYNB 1RE4A 3HE4B 2J3FA 3TSIA 3CCSP 3GF7A 1LGHB 1AVYA 1UIXA 2OTKE 3CWBE 1J2JB 4N6JA 5KAIE 1PL5A 4GODA 2E5TA 2IDBA 1GDTA 1KB9E 4K3AA 2J3FD 3EWKA 1SQBJ 1FDMA 3AE6C 1EXJA 2ITAA 3JSVC 3MP7B 1JOCA 1KILE 1H0TB 1BGYE 1IK7A 2QJPC 1KQGB 1S5LE 1YIJP 1USDA 1NOHA 4TT3H 4HH2A 1SLQA 4R4LA 1JCDA 4XA4A 2J61A 1NTKE 2ZYGA 1PP9E 3FWNA 1SQBE 2O1KA 2N1TD 2Q1KA 4EI2A 1NWQA 4MN4C 3VMXA 1DH3A 1FJKA 1T8ZA 4LGDE 1CI6B 3CWBJ 3CXHD 4N78D 1JY3N 1KYOH 3IFMA 2E42A 1GU5A 4M3LA 2P67A 5APVA 1S2EA 2R32A 2B87A 2ZT9D 4H44D 5AVYB 3L73E 3L75J 2E43A 2FYUG 3GW6A 1GW4A 2M5AA 3L75D 3L71D 2WPRA 3L73D 4RJTA 5AW8B 1RHZB 3NFQA 2P10A 1G2CA 1GD2E 4H0LD 1NTZE 3MUDA 3L36A 1FZEC 1AA0A 2LXBA 1YYCA 3CCVP 1M90Q 1DIPA 2P7JA 3CXHE 4N78E 1UIIA 1NTMD 5E79H 4CPGA 1YBKA 1M7LA 4B86A 1VL2A 5AVWB 4R4MA 3BRTB 3H1JJ 3HUSA 3CC4P 1NU1J 3AE3C 3H1KG 2RKLA 3BATA 3TNUB 1FZEA 3CI9A 3GHGA 3E7KA 2YMKA 3MHVA 5AVSB 1L0NE 2M3EA 4C7NA 2IYPA 2H8PD 4UB6E 5APSA 1AV1A 4RKUJ 3RK2C 1IJDB 1KYOI 1HBWA 2LR2A 3GG2A 1VF5C 2I1JA 1SQBK 2PGDA 2BCCG 2AXTE 3CX5I 1YQ4C 3A0HE 1NTME 1FZAA 1LTJB 3FGAD 2FYZA 5B5EH 2QM8A 2ZJSE 1RF1C 1M57D 1ZRTD 4DOJA 3A5TA 1Z56A 1FC2C 1SQQD 3CCQP 1T6AA 2M8RA 1VQ6P 5CCGA 3Q5PA 3V2NA 5KLVK 4QMAA 4ZFGA 3E1IA 1QLED 2E74B 1FIDA 3LW5J 2J64A 1EC5A 1NH4A 2LXCB 2IFNA 3CX5E 5M1BA 1SQBD 4L75A 3BCCD 2WSSH 2J1GA 3T97A 1VQKP 5K5GB 3RK3E 2H43A 1LNQA 5CBOA 1OW8A 1K73Q 1IK9A 1EDIA 2WSEJ 1NTKG 1N7LA 3H1JG 5E79E 1VQ8P 4A7PA 3H25A 5CJ0A 5DJUB 5AW7B 4H0LC 3OAKA 1ZN5A 3OA7A 1EZVI 1D7MA 1BGYG 1IFJA 2PRRA 2FYUE 1N7SD 2IBZE 1S5LH 1EDKA 2YIUB 4JYBA 3H1KD 3VN0A 5GTIH 2J0HA 1FZBC 5B66H 1MZ9A 1NKNA 2L5GB 3WUUA 1KB9H 4Y99C 5C39A 3RGUA 5KKZB 4DCKA 1L0LE 3CCLP 3TDKA 1N73C 3H1IJ 1ZMEC 3H1IG 2R5DA 1L4AC 1PPJE 1VQ9P 2J59M 3PLNA 5BVZA 3AEBC 2NRGA 3WMM0 1S72P 2A06G 2YKOA 1GW3A 2FIBA 1Z3UA 1NU1E 2HFED 5KLVD 2KS1B 4PV1B 3HE5B 1KD1Q 2OYIA 3MGNA 1AJYA 2NZ2A 2ZT9B 1Z3SA 1PGJA 5AVZB 2H7HA 1SQBG 4WY4B 4NPEA 3ZDMA 2RMZA 1H0TA 1EDJA 1JCCA 3IN6A 5CJ4A 4HJGH 1QL1A 1FIBA 2NPSD 5AW3B 1FDIA 3L75G 4H0LB 4R9TA 1LTAC 3GF3A 3BVHB 2A45H 2E74C 4U3FD 2JWAA 3A0BE 1N73A 2PFXA 1YHQP 2WMMA 3B71A 3FWLA 3I55P 2QA4P 2D2CD 2A45G 1KN7A 1ZR2A 1SQXD 2OARA 1RE4C 2FXOA 1RY3A 4HB1A 4RO0A 4NYTA 1H8AA 2IPPA 3HTKB 4U3FG 2UWJE 1ZR4A 4H13C 2R44A 2MKVA 1PZQA 3R2PA 2E76C 2K37A 3TK1A 1NTMK 1EZVG 1P84D 3AEGC 2B88A 2QRXA 2I8DA 4IFDK 1S5LX 3CLQA 5CCGD 3FXEA 1LTGC 4H13B 4AYCA 1NJIQ 1PGPA 2SPZA 3B5NA 2BEZF 1PGOA 1FS0E 2E5YA 3ITKA 3M0DC 3S1KA 4IL6E 2HODC 2JP3A 5B5EE 3CC2P 1VQPP 2AEMA 5CCHD 1J1EC 4I7ZB 2QJPB 4L74A 2CPBA 4LLHA 2PAJA 2RH0A 1ZV8A 1BGYD 1KB9D 1YJNP 2K9YA 1Q86Q 2K88A 2JJLA 1PFIA 4C7NB 1JY2N 1L4AB 1DEBA 3AE2C 4Z1MH 3RBZA 1KV4A 1KILA 3I5CA 4GIFA 3H1LJ 5TISE 5APWA 1JO5A 1J1DB 2W6BA 3KDPB 1VQ5P 5AW5B 1MKMA 3PRJA 2DW3A 2Q7CA 2WPQA 2Q3EA 3U1CA 1OFCX 1IFNA 5B66E 1YJWP 3P7KA 2G3AA 5AVUB 5H2FE 1BSHA 1NTMJ 1N7SA 2YXQB 2JWDA 2GUVA 5APTA 1FICA 1NYHA 4JPZB 1NTZG 1KILC 1X8YA 3P8CD 1SQQK 1ZRTE 1IO4A 2QJKC 1HF9A 1RE4B 3KZIH 4ZKUA 3HE4A 1DD4A 3MTUE 4PD4H 5GTHH 1R5SA 3RK2D 2IBZD 4GOEA 1GK6A 1L0NG 4JBZA 1VQ4P 2V7QJ 1ZOYC 4ZKPA 1LT9A 2WSFH 4R9JA 4D6TG 1NU1K 2J61B 1E79H 1YTZI 4OVNF 2E75B 5CBNA 3HRNA 2WITA 3D6ZA 5TISH 2KZJA 2XNXB 2FKWB 3VP8A 3V2QA 1LP1A 1YI2P 3H1HD 4IOIH 2XNXC 4U3FJ 3SWYA 2IYOA 3PJSK 1K9MQ 3CCEP 3Q5RA 2N1TB 4WY4A 3O8ZA 3M9BA 2IBZI 3CCUP 3H1LG 3KYQA 1EDLA 1Q7YQ 1OVVA 4WVZA 3FX0A 2O1JA 2HLOC 2OTJP 3RK3B 2P1JA 3F89A 4WWIA 2WTYA 2JEEA 3HE5A 5APUA 2FFDC 4JYOX 5TJHA 2BCCE 4OGQC 3ABVC 4EIJA 1FZDA 2POHA 3L73J 1NTZJ 2ZYAA 2XU6A 2XNDH 1JTHA 2J0GA 1K8AQ 3C9IA 1JMBA 1FDOA 4YXDC 1L2PA 5AW2B 1FZBB 2N1TC 4BRYB 4PJ0E 3CC7P 3HD7A 2KB7P 2KNCA 1FZFB 3SFEC 1PP9J 3E1IC 4PV1D 3H6PA 1PPJG 1PP9D 2AEJA 3BASA 1IFDA 2BASA 2E75C 1VQLP 1FZGC 2QG4A 3PHLA 3N7NA 1RF1A 2D2CC 3H1HE 2OYHC 1HGZA 3P8MC 2KZIA 3GMAA 4M7FA 1QEXA 1P84H 4D6TD 2K9JA 3TGUD 2RN0A 1BCCG 4D6TJ 4D6TE 3QH9A 1AQTA 3AE1C 1FZFA 4GOFA 1LP1B 1KQLA 2YKPA 2E74D 2Z5IA 1BE3J 2IBZG 3I56P 3PP5A 4K35A 2QEXP 4TLFA 1CW5A 1GL2C 3IR9A 1Q81Q 4WBAA 2XDJA 1NTZK 5KJ7A 3EFGA 3Q2YA 3L37A 3II6A 1CSBA 2Y0DA 3VMYA 1HJ0A 2K1AA 2GY7A 3FXDA 1QGKB 2N1TA 3BCCG 1WMKA 3CCJP 3E1RA 2P2UA 1L0NK 5CCHC 2QJYC 2I1KA 2IZ0A 1BCCE 2W90A 2HPCC 1SQQE 2GA1A 4L73A 2PP6A 3KPEA 5AW0B 3V2RA 3WU2H 4JZCA 4I2LC 3L72E 2Y9ZA 1KILB 2FYUD 2Q3IA 1RE3B 3V6IA 1LTBC 2J5ZA 2Q9IA 1LT9B 2HG5D 1JY3P 2OGUA 3CXHH 1OIPA 3VP9A 3JCUE 3L74E 1R5LA 4PD4I 3U59A 3L4FA 1G1JA 1KFMA 2JHMF 2C0WA 1PV3A 2WQYC 3H32C 2L91A 2KIKA 3L71J 1VQOP 4IFFA 5AVRB 5KAFE 2XNXA 5KLIB 1FJPA 1YJ9P 1JEKA 1NTZD 1SQVK 2WSCH 1Q90D 5AW4B 4KHXA 3C8VA 1U57A 1BE3D 3D70A 2KYVA 1LWUC 3D6YA 1T3JA 2BCCD 1VDFA 3T97B 1Q82Q 1Q2NA 3USSA 2XV5A 3N4XA 2Y0EA 3VMAA 5CCHA 3RL0B 2R3SA 3G4SP 1GL2B 2FY8A 3HUSC 1OVUA 3L70E 1FE6A 3SWKA 1M56D 3M06A 1AFOA 3TGUE 1YITP 4WB4A 3V4WA 4DJGA 1EQ7A 1ZXGA 1SFCD 1SS1A 3CMEP 1PIXA 2QVAA 3KQGA 2E75D 4L76A 1VQNP 1J1EB 3AEAC 2ZXEB 2B87B 4PJ0H 3BVHC 2A06D 2B89A 1L0LK 1MV8A 4YXWH 1NKZB 1T2KD 1JUNA 1KYOD 2W27A 2YO3A 3E1IB 1KTMA 2K9JB 1S1CX 3CX5D 1VF5D 3C1LA 1MFTA 5GTIE 4PV1C 3CL3D 4OH8B 2M0BA 1OW7A 2H43C 3V2PA 3W68A 1SQVE 1N86A 4IL6H 2YIUC 3SSUA 3BCCJ 1JB0J 3AE9C 1FAVA 5L8RJ 5KJ7D 2QM7A 1Y47A 1RQUA 3CD6P 4GKGA 4EYYQ 1SQPK 1OZHA 1OX3A 3A3YB 2JDIH 1W2BO 1VQMP 1FU1A 1NAFA 3GHGB 3AEFC 1H88A 2P58A 1QVFO 4KJMA 3B5NB 1SQQG 4JYCA 4Y28J 1NTKD 1DD3A 1IZNB 2QIWA 3H1JE 2HODA 1XTGB 3EQ2A 2KK7A 1X0TA 1ZW0A 5KJ7C 1ZLLA 1FOSE 4I6MC 1KMIZ 3CPWO 1GTWA 1M1JC 1E5WA 3WU2E 2ZT9C 2J58A 1NU1G 2ZXXA 1KB9I 2KLVA 1KORA 2Q9IB 1SQVG 1W2EA 1H89A 1X79B 1RE3C 2AEFA 3KHUA 1X22A 5AVQB 2O01J 3OJAB 3L70G 1P84E 1OWAA 1FBMA 3L72D 1KZUB 1FZCA 4C7RA 3CMAP 2C9NY 2OYOA 1SQPD 3O6QA 4GT1A 2HLOA 3BRVB 1SQQJ 2J3GA 1EZVD 2HR3A 5KKZC 2D39A 3IF4A 1VF5B 4UB8E 1HJBA 1DEEG 5KLVJ 5AW6B 2YMYA 1YQ3C 5APQA 3Q5SA 1OVRA 2QSIA 3AE7C 1G2CB 2OYHA 3MUDC 2KS1A 3P32A 1LWUA 2J2PA 2R3CA 1K04A 1JMMA 1OW6A 3H1IE 3O6QB 1KQFB 2OYIC 3UIAA 2NPSB 2JHHC 1SFCB 2K3RA 1NHLA 2KOGA 2WPVB 1L0LG 3M0AA 4N3YB 3H1HJ 1ZP0C 1AQ5A 5KLIC 4I1LA 3B5ND 2WT7A 3PH0A 3RK3D 2ZVOB 1FZEB 2HPCA 1HUCA 1HVVA 1GMJA 3CWBD 4JQ0D 1LTSC 3VMZA 1AVOA 1S9KD 3HUSB 1SFCA 3L70J 1FZFC 2IZ1A 1QX8A 3QWOC 2O01H 4H44B 5APYA 2WSCJ 1RF0C 3TGUJ 1N7SB 1SQPG 2YKQA 1FZAC 5AVVB 1LTJA 1FZAB 4LC1A 1EZVE 2KNCB 4NPDA 3TF5A 3VYIA 1LJ2A 1T2KC 1HGVA 2MJZA 3U1AA 2VRSA 1K05A 2Q5UA 3CWBG 2KI7B 4W80A 2J5UA 1RF1B 2QJYB 3LW5H 1SQXE 1P84I 1LTJC 1TU3F 1OMIA 2Q6QA 1URQB 3BVHA 2OYHB 2C9LY 1GL2A 1L0NJ 3G71P 1VPCA 1L0ND 4U3FE 2WPSA 1RF0B 2ZAEB 4ASVA 2OQQA 2KXPB 5BU5A 2W8ZA 5KAFH 2M3BA 2M5AB 2HYNA 1GL2D 2AXTH 4BWNA 3L74D 3FIBA 2J3OA 3M9QA 3L74J 3AEEC 3RL0g 5GTHE 2FYNC 1CZQA 4HYTB 5CHXA 2WT7B 3L74G 2Z4EC 2GUSA 2H88C 1QVGO 5EFWB 1IFIA 2WWWA 3BCCE 3L35A 3RL0D 2Y9YA 3TYYA 3A7OA 1S3JA 3GLMA 1JY3O 1JC9A 3NXSA 1JNMA 3MZWB 5AW9B 1JTHB 1SQXJ 1IFMA 2FFDA 1SQXG 2A45I 3H1LE 3V5BA 2E76D 4HKZH 4Y99B 2Z4EB 4BRYA 2KLUA 3HD7B 1SQVD 5AVXB 3CXHI 1SP4A 2V7QH 4UB6H 1BCCJ 1USEA 4NPFX 3CCMP 3S4RA 1IFPA 4EOTA 3PTZA 3M9HA 4ASWA 2FFDB 1RH5B 1YTZT 4KT0J 2Z4EA 2CPSA 5BU8B 1NTKJ 4PD4E 2HLOB 1WT6A 1URQC 3GHGC 2O01N 2N9BA 2D2CB 3AE5C 2Q9IC 3L70D 1BGYJ 5KLVE 2XZRA 2HODB 3VTPC 4DZOA 4GDOA 3Q1MA 2FYUK 3H1ID 5KTBA 2KSEA 2OTLP 1NGMB 2J3UA 3H32A 1N2DC 1X9VA 1HWTC 3RBXA 4H44C 3CX5H 4YPCA 4DT0A 2Z5HA 2CK3H 3HTKA 1SQPJ 1KC8Q 1W5CE 2QJKB 3OW2O 1RE3A 5APXA 2WZ7A 3A2AA 1S9KE 2B9BA 1FZGA 3V4QA 5CMZA 3JC22 1GK4A 4EPUA 1N7SC 2FXPA 1KQSO 1SFCC 1RF0A 1IC2A 3F5HA 1GU4A 2ZVNB 1HH0A 2JHKF 4OGQD 1FOSF 3SWFA 1FZCC 1T3UA 3MD0A 3R4YA 2JKVA 3LIDA 1DX7A 1LT1A 3M91A 4ZMDA 2GM4A 1SQXK 1URQD 1U7JA 2G8YA 5KLVG 1FZBA 1PGQA 1GZLA 3AECC 3H1KJ 3B4SA 2HPCB 2W6JH 2OYIB 3H1LD 1SQVJ 2J60A 1M8OB 2ZYDA 3Q3DA 2FYUJ 2N9YB 3G6EP 4XFJA 2FBWC 1BE3E 1L0LJ 1M1JA 4IFMA 2E76B
chains in the Genus database with same CATH topology
1N86C 5AW2B 1FZBB 1NH4A 2N1TC 1G2CB 2OYHA 1JY2O 3HD7A 2KB7P 2IFNA 3TNUA 1FZFB 2ZFCA 3P32A 3E1IC 1LWUA 2J2PA 4M7HA 2R3CA 1J1DC 1JMMA 5CCGC 3H6PA 1NTKK 3BASA 1IFDA 2BASA 2OYIC 3UIAA 2J1GA 2YO2A 3T97A 2NPSB 4RESB 2JHHC 1SFCB 2XKMA 1LT9C 1FZGC 2H43A 1NHLA 2KOGA 3NMDA 3B8EB 3M0AA 3N7NA 1RF1A 4N3YB 1A02J 2OYHC 1HGZA 3P8MC 1KILD 5APQA 4M7FA 1AQ5A 1IK9A 3MIWA 4I1LA 4AQRD 1HTLC 1N7LA 3B5ND 3NTNA 2WT7A 2WNPF 3RK3D 3G3ZA 1FZFA 1FZEB 1KQLA 5CJ0A 2Z5IA 2YKPA 5AW7B 2HPCA 1HUCA 1FZCB 1HVVA 3OAKA 1NO4A 3PP5A 1ZN5A 2NPSC 3OA7A 1LTSC 2R5BA 3VMZA 1IFJA 2IFMA 1CW5A 1CI6A 1S9KD 3HUSB 1SFCA 1N7SD 1GL2C 3IR9A 2JHIF 1FZFC 4WBAA 1N73B 2XDJA 1NTZK 2O01H 5KJ7A 5APYA 4JYBA 3EFGA 3VN0A 2J0HA 3L37A 1RF0C 1FZBC 1N86B 4W7ZA 3II6A 1CSBA 1LTTC 3VMYA 1N7SB 2YKQA 1FZAC 1MZ9A 1NKNA 5AVVB 2L5GB 2GY7A 1LTJA 1FZAB 2JHLF 4LC1A 2N1TA 4Y99C 2C0XA 1L4AA 2WSEH 1XTCC 1N73C 3VYIA 2P2UA 1QL2A 1L0NK 1T2KC 1JY2P 5CCHC 1HGVA 2MJZA 2I1KA 3U1AA 2VRSA 2R5DA 2HPCC 1L4AC 2Q5UA 2J59M 2PP6A 4W80A 3KPEA 5AW0B 1KFNA 3V2RA 1L4AD 5BVZA 1RF1B 4JZCA 4I2LC 3LW5H 1KILB 3WMM0 1LTJC 4C46A 2YKOA 1GW3A 2W6AA 4XE5B 1SVFA 2FIBA 1URQB 2Q3IA 3BVHA 2KSJA 1Z3UA 1RE3B 2OYHB 2C9LY 1GL2A 1MFZA 3M0DA 2HFED 5AVTB 1LTBC 1VPCA 2H43B 2J5ZA 2Q9IA 4WY4D 3HE5B 2KP8A 1LT9B 1FZGB 2OYIA 2WPSA 2HG5D 1RF0B 1JY3P 3MGNA 1Z3SA 5AVZB 5BU5A 3VOPA 1M1JB 2H7HA 3VP9A 2M3BA 4WY4B 2HYNA 4WY4C 1GL2D 2FXMA 1JCCA 5CJ4A 1OXZA 3U59A 3L4FA 2J0YA 3FIBA 1G1JA 1KFMA 1A02F 2J3OA 1QL1A 3M9QA 1FIBA 2JHMF 1LTIC 2NPSD 5AW3B 2C0WA 1G1IA 2IX7C 4R9TA 3H32C 1LTAC 3BVHB 1CZQA 4HYTB 5CHXA 2A45H 2WT7B 4IFFA 5AVRB 2Z4EC 2GUSA 2YNYA 3B5NC 1N73A 4AUWA 1LWUB 1IFIA 2WWWA 3L35A 3RL0D 2XNXA 3TYYA 5AW1B 3A7OA 1FJPA 1JY3O 2NPSA 2A45G 1ZR2A 1JC9A 3NXSA 1JNMA 4W7YA 2OARA 4O9BA 1SQVK 2WSCH 1RE4C 5AW9B 1RY3A 1JTHB 5AW4B 4NYTA 3RK3C 1H8AA 4KHXA 2IPPA 3HTKB 1IFMA 1ZR4A 3HD7D 2FFDA 2A45I 3RL0C 3P8CE 1URQA 2KYVA 3V5BA 1LWUC 1T3JA 1MUUA 3R2PA 1VDFA 1WRGA 4Y99B 2Z4EB 3RK2B 2LKMA 4JF7A 3HD7B 3TK1A 1NTMK 3HD7C 3H32B 5AVXB 3LIEA 1SP4A 1RE4A 3HE4B 2XV5A 3N4XA 2J3FA 3TSIA 4IFDK 5CCHA 3CLQA 5CCGD 1LGHB 4EOTA 1LTGC 3RL0B 4AYCA 1GL2B 3HUSC 1J2JB 4N6JA 3B5NA 3M9HA 2FFDB 3M0DC 2HODC 1GDTA 1YTZT 2J3FD 2Z4EA 1FDMA 3M06A 2CPSA 1AFOA 5CCHD 1J1EC 5BU8B 4WB4A 3V4WA 2HLOB 1EQ7A 1WT6A 1JOCA 1URQC 1SFCD 2CPBA 2PAJA 4LLHA 1ZV8A 3KQGA 3GHGC 1J1EB 2ZXEB 2N9BA 1NOHA 2Q9IC 4HH2A 3BVHC 1SLQA 1PFIA 2JJLA 1JCDA 4C7NB 4XA4A 2XZRA 2HODB 3VTPC 2J61A 1L0LK 1JY2N 1L4AB 1MV8A 1DEBA 4DZOA 1NKZB 2O1KA 1T2KD 2N1TD 1KILA 1JUNA 3I5CA 4GIFA 2W27A 1NWQA 2FYUK 5APWA 2YO3A 3VMXA 1DH3A 1JO5A 1J1DB 1FJKA 1T8ZA 3E1IB 2W6BA 3KDPB 5KTBA 5AW5B 4LGDE 1CI6B 2Q7CA 2WPQA 4N78D 3U1CA 1JY3N 3IFMA 2J3UA 2E42A 1IFNA 1GU5A 3H32A 3CL3D 4M3LA 2P67A 4OH8B 1N2DC 3P7KA 2H43C 1X9VA 5APVA 5AVUB 3V2PA 2R32A 5AVYB 1HWTC 1N86A 2E43A 1N7SA 2GUVA 1GW4A 5APTA 1FICA 2WPRA 1FAVA 2Z5HA 1KILC 1X8YA 5AW8B 5KJ7D 2QM7A 3HTKA 3NFQA 3P8CD 1SQQK 4GKGA 1IO4A 1G2CA 1SQPK 3A3YB 1GD2E 1RE4B 3MUDA 4ZKUA 3HE4A 3L36A 1FZEC 1FU1A 3MTUE 1NAFA 1YYCA 1RE3A 3GHGB 5APXA 3RK2D 2P7JA 2WZ7A 1GK6A 3A2AA 1S9KE 4N78E 1H88A 3B5NB 4ZKPA 1LT9A 1FZGA 4JYCA 1M7LA 2WSFH 3V4QA 4B86A 5CMZA 5AVWB 1GK4A 4R9JA 4EPUA 1NU1K 2HODA 3BRTB 3HUSA 2J61B 1N7SC 1SFCC 1YTZI 1XTGB 3EQ2A 3HRNA 2WITA 3BATA 2XNXB 3TNUB 1ZLLA 2FKWB 5KJ7C 1FOSE 3VP8A 3V2QA 1FZEA 4I6MC 1RF0A 1IC2A 2XNXC 1GU4A 3SWYA 1GTWA 1M1JC 1E5WA 1HH0A 2JHKF 3CI9A 3GHGA 2N1TB 2J58A 5AVSB 1FOSF 4WY4A 4C7NA 3O8ZA 2KLVA 2H8PD 3SWFA 1FZCC 1T3UA 3M9BA 5APSA 2Q9IB 3MD0A 3RK2C 1W2EA 1IJDB 3KYQA 1HBWA 3LIDA 1H89A 1X79B 1RE3C 2I1JA 1DX7A 2O1JA 1SQBK 5AVQB 3M91A 2GM4A 1SQXK 2HLOC 1URQD 1FZAA 1LTJB 3OJAB 2FYZA 1OWAA 1FZBA 1FBMA 3RK3B 1GZLA 2P1JA 2QM8A 1RF1C 1KZUB 2WTYA 2JEEA 1FZCA 2HPCB 4DOJA 4C7RA 3HE5A 5APUA 2FFDC 2C9NY 4JYOX 3A5TA 2OYIB 1Z56A 4GT1A 4EIJA 1FZDA 2HLOA 2POHA 2M8RA 2XU6A 3BRVB 2J60A 2J3GA 1JTHA 5CCGA 2J0GA 3V2NA 5KLVK 2D39A 4ZFGA 1HJBA 3E1IA 3C9IA 1FIDA 5AW6B 1M1JA 2YMYA 4IFMA 2J64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZE C;  1N86 C;  1FZB B;  2J3F A;  2OYH A;  1JY2 O;  1RE3 A;  3GHG B;  1LTJ C;  1FZF B;  3E1I C;  1LWU A;  2J2P A;  4M7H A;  2FIB A;  3BVH A;  1Z3U A;  1LT9 A;  3HUS C;  1FZG A;  1RE3 B;  2OYH B;  2OYI C;  2J1G A;  2FFD B;  2H43 B;  2J5Z A;  2HOD C;  4R9J A;  4EPU A;  2Q9I A;  2JHH C;  2HOD A;  2J61 B;  1LT9 C;  3HUS A;  2H43 A;  1FZG C;  1LT9 B;  1FZG B;  2OYI A;  1RF0 B;  1JY3 P;  2J3F D;  2Z4E A;  1RF1 A;  4JZC A;  1Z3S A;  2OYH C;  2HLO B;  1M1J B;  2XNX B;  4M7F A;  1FZE A;  1RF0 A;  2XNX C;  1M1J C;  3GHG C;  2JHK F;  2J0Y A;  3FIB A;  3GHG A;  2J3O A;  2WNP F;  1FZF A;  1FIB A;  2JHM F;  2Q9I C;  1FZE B;  3BVH C;  2HPC A;  1FZC C;  1FZC B;  4R9T A;  3H32 C;  3BVH B;  1T3U A;  2HOD B;  2J61 A;  2Q9I B;  1JY2 N;  2A45 H;  1W2E A;  1RE3 C;  2Z4E C;  3HUS B;  1N73 A;  3E1I B;  1LWU B;  2JHI F;  2XNX A;  1FZF C;  1N73 B;  2HLO C;  1FZA A;  1LTJ B;  1FZB A;  1JY3 N;  2J0H A;  1JY3 O;  1RF0 C;  2A45 G;  1FZB C;  2J3U A;  1N86 B;  1JC9 A;  1RF1 C;  3H32 A;  1FZA C;  2GY7 A;  1FZC A;  1RE4 C;  2HPC B;  2H43 C;  1LTJ A;  1FZA B;  2FFD C;  4JYO X;  2JHL F;  2OYI B;  4NYT A;  1N86 A;  1FZD A;  2HLO A;  2FFD A;  2A45 I;  2J60 A;  1FIC A;  1N73 C;  2J3G A;  2J0G A;  1LWU C;  1JY2 P;  2D39 A;  4ZFG A;  2Z4E B;  3E1I A;  2HPC C;  1FID A;  1M1J A;  1RE4 B;  3H32 B;  2J64 A;  1RE4 A;  1RF1 B; 
#chains in the Genus database with same CATH topology
 1N86 C;  3D71 A;  1JY2 O;  1Y8A A;  3TNU A;  2QE7 H;  4IL6 X;  2ZFC A;  2V4H A;  2YXR B;  4M7H A;  1BDC A;  1J1D C;  5CCG C;  3EFF K;  1R8E A;  1NTK K;  4YTP C;  2YO2 A;  4RES B;  2XKM A;  1LT9 C;  3NMD A;  3B8E B;  4OWF A;  1A02 J;  1KIL D;  3MIW A;  1BSN A;  3A0H H;  4AQR D;  4EDF A;  3K5B A;  1HTL C;  3NTN A;  4I7Z C;  2WNP F;  3G3Z A;  4PD4 D;  4UB8 H;  1FZC B;  1BDD A;  3W67 A;  3A0B H;  1NO4 A;  2NPS C;  2R5B A;  4U7J A;  2IFM A;  1CI6 A;  3JCU H;  2JHI F;  1N73 B;  3WUT A;  2BCC J;  1BE3 G;  1N86 B;  4W7Z A;  1LTT C;  4BXL A;  1Y9B A;  2Y0C A;  2JHL F;  3L72 G;  1PP9 G;  2C0X A;  5H2F H;  3CCR P;  1L4A A;  1PPJ D;  2WSE H;  2AXC A;  1XTC C;  1NAY A;  3SFD C;  1QL2 A;  5KAI H;  3S9O A;  1JY2 P;  3L71 E;  4OGQ B;  2BEQ D;  2W83 C;  3AE8 C;  1JM0 A;  1VQ7 P;  1KFN A;  4ZNC A;  1L4A D;  2WSF J;  3H1K E;  4C46 A;  2W6A A;  4XE5 B;  1SVF A;  2KSJ A;  3WUV A;  1N8R Q;  1MFZ A;  3M0D A;  1KYO E;  5AVT B;  2A06 E;  2H43 B;  3AED C;  2JO1 A;  4WY4 D;  2KP8 A;  2KUB A;  1FZG B;  1EXI A;  1RQV A;  3IAO A;  2WVR A;  3VOP A;  1M1J B;  2JR8 A;  4WY4 C;  4H13 D;  2FXM A;  1OXZ A;  2J0Y A;  1A02 F;  1NVO A;  1LTI C;  2O3J A;  3H1J D;  3L71 G;  1G1I A;  2IX7 C;  1NU1 D;  3KZI E;  1S4X A;  3H1H G;  3G9R A;  1M1K Q;  2YNY A;  3B5N C;  4AUW A;  1LWU B;  1U7M A;  5AW1 B;  2NPS A;  2H89 C;  4W7Y A;  1BCC D;  4O9B A;  3TGU G;  1NTM G;  3RK3 C;  3L75 E;  1L0L D;  3HD7 D;  3RL0 C;  3P8C E;  1URQ A;  1MUU A;  1SQP E;  1WRG A;  5DJT B;  3AE4 C;  3L72 J;  3RK2 B;  2LKM A;  4JF7 A;  3HD7 C;  3KXD A;  3H32 B;  3LIE A;  3L73 G;  2FYN B;  1RE4 A;  3HE4 B;  2J3F A;  3TSI A;  3CCS P;  3GF7 A;  1LGH B;  1AVY A;  1UIX A;  2OTK E;  3CWB E;  1J2J B;  4N6J A;  5KAI E;  1PL5 A;  4GOD A;  2E5T A;  2IDB A;  1GDT A;  1KB9 E;  4K3A A;  2J3F D;  3EWK A;  1SQB J;  1FDM A;  3AE6 C;  1EXJ A;  2ITA A;  3JSV C;  3MP7 B;  1JOC A;  1KIL E;  1H0T B;  1BGY E;  1IK7 A;  2QJP C;  1KQG B;  1S5L E;  1YIJ P;  1USD A;  1NOH A;  4TT3 H;  4HH2 A;  1SLQ A;  4R4L A;  1JCD A;  4XA4 A;  2J61 A;  1NTK E;  2ZYG A;  1PP9 E;  3FWN A;  1SQB E;  2O1K A;  2N1T D;  2Q1K A;  4EI2 A;  1NWQ A;  4MN4 C;  3VMX A;  1DH3 A;  1FJK A;  1T8Z A;  4LGD E;  1CI6 B;  3CWB J;  3CXH D;  4N78 D;  1JY3 N;  1KYO H;  3IFM A;  2E42 A;  1GU5 A;  4M3L A;  2P67 A;  5APV A;  1S2E A;  2R32 A;  2B87 A;  2ZT9 D;  4H44 D;  5AVY B;  3L73 E;  3L75 J;  2E43 A;  2FYU G;  3GW6 A;  1GW4 A;  2M5A A;  3L75 D;  3L71 D;  2WPR A;  3L73 D;  4RJT A;  5AW8 B;  1RHZ B;  3NFQ A;  2P10 A;  1G2C A;  1GD2 E;  4H0L D;  1NTZ E;  3MUD A;  3L36 A;  1FZE C;  1AA0 A;  2LXB A;  1YYC A;  3CCV P;  1M90 Q;  1DIP A;  2P7J A;  3CXH E;  4N78 E;  1UII A;  1NTM D;  5E79 H;  4CPG A;  1YBK A;  1M7L A;  4B86 A;  1VL2 A;  5AVW B;  4R4M A;  3BRT B;  3H1J J;  3HUS A;  3CC4 P;  1NU1 J;  3AE3 C;  3H1K G;  2RKL A;  3BAT A;  3TNU B;  1FZE A;  3CI9 A;  3GHG A;  3E7K A;  2YMK A;  3MHV A;  5AVS B;  1L0N E;  2M3E A;  4C7N A;  2IYP A;  2H8P D;  4UB6 E;  5APS A;  1AV1 A;  4RKU J;  3RK2 C;  1IJD B;  1KYO I;  1HBW A;  2LR2 A;  3GG2 A;  1VF5 C;  2I1J A;  1SQB K;  2PGD A;  2BCC G;  2AXT E;  3CX5 I;  1YQ4 C;  3A0H E;  1NTM E;  1FZA A;  1LTJ B;  3FGA D;  2FYZ A;  5B5E H;  2QM8 A;  2ZJS E;  1RF1 C;  1M57 D;  1ZRT D;  4DOJ A;  3A5T A;  1Z56 A;  1FC2 C;  1SQQ D;  3CCQ P;  1T6A A;  2M8R A;  1VQ6 P;  5CCG A;  3Q5P A;  3V2N A;  5KLV K;  4QMA A;  4ZFG A;  3E1I A;  1QLE D;  2E74 B;  1FID A;  3LW5 J;  2J64 A;  1EC5 A;  1NH4 A;  2LXC B;  2IFN A;  3CX5 E;  5M1B A;  1SQB D;  4L75 A;  3BCC D;  2WSS H;  2J1G A;  3T97 A;  1VQK P;  5K5G B;  3RK3 E;  2H43 A;  1LNQ A;  5CBO A;  1OW8 A;  1K73 Q;  1IK9 A;  1EDI A;  2WSE J;  1NTK G;  1N7L A;  3H1J G;  5E79 E;  1VQ8 P;  4A7P A;  3H25 A;  5CJ0 A;  5DJU B;  5AW7 B;  4H0L C;  3OAK A;  1ZN5 A;  3OA7 A;  1EZV I;  1D7M A;  1BGY G;  1IFJ A;  2PRR A;  2FYU E;  1N7S D;  2IBZ E;  1S5L H;  1EDK A;  2YIU B;  4JYB A;  3H1K D;  3VN0 A;  5GTI H;  2J0H A;  1FZB C;  5B66 H;  1MZ9 A;  1NKN A;  2L5G B;  3WUU A;  1KB9 H;  4Y99 C;  5C39 A;  3RGU A;  5KKZ B;  4DCK A;  1L0L E;  3CCL P;  3TDK A;  1N73 C;  3H1I J;  1ZME C;  3H1I G;  2R5D A;  1L4A C;  1PPJ E;  1VQ9 P;  2J59 M;  3PLN A;  5BVZ A;  3AEB C;  2NRG A;  3WMM 0;  1S72 P;  2A06 G;  2YKO A;  1GW3 A;  2FIB A;  1Z3U A;  1NU1 E;  2HFE D;  5KLV D;  2KS1 B;  4PV1 B;  3HE5 B;  1KD1 Q;  2OYI A;  3MGN A;  1AJY A;  2NZ2 A;  2ZT9 B;  1Z3S A;  1PGJ A;  5AVZ B;  2H7H A;  1SQB G;  4WY4 B;  4NPE A;  3ZDM A;  2RMZ A;  1H0T A;  1EDJ A;  1JCC A;  3IN6 A;  5CJ4 A;  4HJG H;  1QL1 A;  1FIB A;  2NPS D;  5AW3 B;  1FDI A;  3L75 G;  4H0L B;  4R9T A;  1LTA C;  3GF3 A;  3BVH B;  2A45 H;  2E74 C;  4U3F D;  2JWA A;  3A0B E;  1N73 A;  2PFX A;  1YHQ P;  2WMM A;  3B71 A;  3FWL A;  3I55 P;  2QA4 P;  2D2C D;  2A45 G;  1KN7 A;  1ZR2 A;  1SQX D;  2OAR A;  1RE4 C;  2FXO A;  1RY3 A;  4HB1 A;  4RO0 A;  4NYT A;  1H8A A;  2IPP A;  3HTK B;  4U3F G;  2UWJ E;  1ZR4 A;  4H13 C;  2R44 A;  2MKV A;  1PZQ A;  3R2P A;  2E76 C;  2K37 A;  3TK1 A;  1NTM K;  1EZV G;  1P84 D;  3AEG C;  2B88 A;  2QRX A;  2I8D A;  4IFD K;  1S5L X;  3CLQ A;  5CCG D;  3FXE A;  1LTG C;  4H13 B;  4AYC A;  1NJI Q;  1PGP A;  2SPZ A;  3B5N A;  2BEZ F;  1PGO A;  1FS0 E;  2E5Y A;  3ITK A;  3M0D C;  3S1K A;  4IL6 E;  2HOD C;  2JP3 A;  5B5E E;  3CC2 P;  1VQP P;  2AEM A;  5CCH D;  1J1E C;  4I7Z B;  2QJP B;  4L74 A;  2CPB A;  4LLH A;  2PAJ A;  2RH0 A;  1ZV8 A;  1BGY D;  1KB9 D;  1YJN P;  2K9Y A;  1Q86 Q;  2K88 A;  2JJL A;  1PFI A;  4C7N B;  1JY2 N;  1L4A B;  1DEB A;  3AE2 C;  4Z1M H;  3RBZ A;  1KV4 A;  1KIL A;  3I5C A;  4GIF A;  3H1L J;  5TIS E;  5APW A;  1JO5 A;  1J1D B;  2W6B A;  3KDP B;  1VQ5 P;  5AW5 B;  1MKM A;  3PRJ A;  2DW3 A;  2Q7C A;  2WPQ A;  2Q3E A;  3U1C A;  1OFC X;  1IFN A;  5B66 E;  1YJW P;  3P7K A;  2G3A A;  5AVU B;  5H2F E;  1BSH A;  1NTM J;  1N7S A;  2YXQ B;  2JWD A;  2GUV A;  5APT A;  1FIC A;  1NYH A;  4JPZ B;  1NTZ G;  1KIL C;  1X8Y A;  3P8C D;  1SQQ K;  1ZRT E;  1IO4 A;  2QJK C;  1HF9 A;  1RE4 B;  3KZI H;  4ZKU A;  3HE4 A;  1DD4 A;  3MTU E;  4PD4 H;  5GTH H;  1R5S A;  3RK2 D;  2IBZ D;  4GOE A;  1GK6 A;  1L0N G;  4JBZ A;  1VQ4 P;  2V7Q J;  1ZOY C;  4ZKP A;  1LT9 A;  2WSF H;  4R9J A;  4D6T G;  1NU1 K;  2J61 B;  1E79 H;  1YTZ I;  4OVN F;  2E75 B;  5CBN A;  3HRN A;  2WIT A;  3D6Z A;  5TIS H;  2KZJ A;  2XNX B;  2FKW B;  3VP8 A;  3V2Q A;  1LP1 A;  1YI2 P;  3H1H D;  4IOI H;  2XNX C;  4U3F J;  3SWY A;  2IYO A;  3PJS K;  1K9M Q;  3CCE P;  3Q5R A;  2N1T B;  4WY4 A;  3O8Z A;  3M9B A;  2IBZ I;  3CCU P;  3H1L G;  3KYQ A;  1EDL A;  1Q7Y Q;  1OVV A;  4WVZ A;  3FX0 A;  2O1J A;  2HLO C;  2OTJ P;  3RK3 B;  2P1J A;  3F89 A;  4WWI A;  2WTY A;  2JEE A;  3HE5 A;  5APU A;  2FFD C;  4JYO X;  5TJH A;  2BCC E;  4OGQ C;  3ABV C;  4EIJ A;  1FZD A;  2POH A;  3L73 J;  1NTZ J;  2ZYA A;  2XU6 A;  2XND H;  1JTH A;  2J0G A;  1K8A Q;  3C9I A;  1JMB A;  1FDO A;  4YXD C;  1L2P A;  5AW2 B;  1FZB B;  2N1T C;  4BRY B;  4PJ0 E;  3CC7 P;  3HD7 A;  2KB7 P;  2KNC A;  1FZF B;  3SFE C;  1PP9 J;  3E1I C;  4PV1 D;  3H6P A;  1PPJ G;  1PP9 D;  2AEJ A;  3BAS A;  1IFD A;  2BAS A;  2E75 C;  1VQL P;  1FZG C;  2QG4 A;  3PHL A;  3N7N A;  1RF1 A;  2D2C C;  3H1H E;  2OYH C;  1HGZ A;  3P8M C;  2KZI A;  3GMA A;  4M7F A;  1QEX A;  1P84 H;  4D6T D;  2K9J A;  3TGU D;  2RN0 A;  1BCC G;  4D6T J;  4D6T E;  3QH9 A;  1AQT A;  3AE1 C;  1FZF A;  4GOF A;  1LP1 B;  1KQL A;  2YKP A;  2E74 D;  2Z5I A;  1BE3 J;  2IBZ G;  3I56 P;  3PP5 A;  4K35 A;  2QEX P;  4TLF A;  1CW5 A;  1GL2 C;  3IR9 A;  1Q81 Q;  4WBA A;  2XDJ A;  1NTZ K;  5KJ7 A;  3EFG A;  3Q2Y A;  3L37 A;  3II6 A;  1CSB A;  2Y0D A;  3VMY A;  1HJ0 A;  2K1A A;  2GY7 A;  3FXD A;  1QGK B;  2N1T A;  3BCC G;  1WMK A;  3CCJ P;  3E1R A;  2P2U A;  1L0N K;  5CCH C;  2QJY C;  2I1K A;  2IZ0 A;  1BCC E;  2W90 A;  2HPC C;  1SQQ E;  2GA1 A;  4L73 A;  2PP6 A;  3KPE A;  5AW0 B;  3V2R A;  3WU2 H;  4JZC A;  4I2L C;  3L72 E;  2Y9Z A;  1KIL B;  2FYU D;  2Q3I A;  1RE3 B;  3V6I A;  1LTB C;  2J5Z A;  2Q9I A;  1LT9 B;  2HG5 D;  1JY3 P;  2OGU A;  3CXH H;  1OIP A;  3VP9 A;  3JCU E;  3L74 E;  1R5L A;  4PD4 I;  3U59 A;  3L4F A;  1G1J A;  1KFM A;  2JHM F;  2C0W A;  1PV3 A;  2WQY C;  3H32 C;  2L91 A;  2KIK A;  3L71 J;  1VQO P;  4IFF A;  5AVR B;  5KAF E;  2XNX A;  5KLI B;  1FJP A;  1YJ9 P;  1JEK A;  1NTZ D;  1SQV K;  2WSC H;  1Q90 D;  5AW4 B;  4KHX A;  3C8V A;  1U57 A;  1BE3 D;  3D70 A;  2KYV A;  1LWU C;  3D6Y A;  1T3J A;  2BCC D;  1VDF A;  3T97 B;  1Q82 Q;  1Q2N A;  3USS A;  2XV5 A;  3N4X A;  2Y0E A;  3VMA A;  5CCH A;  3RL0 B;  2R3S A;  3G4S P;  1GL2 B;  2FY8 A;  3HUS C;  1OVU A;  3L70 E;  1FE6 A;  3SWK A;  1M56 D;  3M06 A;  1AFO A;  3TGU E;  1YIT P;  4WB4 A;  3V4W A;  4DJG A;  1EQ7 A;  1ZXG A;  1SFC D;  1SS1 A;  3CME P;  1PIX A;  2QVA A;  3KQG A;  2E75 D;  4L76 A;  1VQN P;  1J1E B;  3AEA C;  2ZXE B;  2B87 B;  4PJ0 H;  3BVH C;  2A06 D;  2B89 A;  1L0L K;  1MV8 A;  4YXW H;  1NKZ B;  1T2K D;  1JUN A;  1KYO D;  2W27 A;  2YO3 A;  3E1I B;  1KTM A;  2K9J B;  1S1C X;  3CX5 D;  1VF5 D;  3C1L A;  1MFT A;  5GTI E;  4PV1 C;  3CL3 D;  4OH8 B;  2M0B A;  1OW7 A;  2H43 C;  3V2P A;  3W68 A;  1SQV E;  1N86 A;  4IL6 H;  2YIU C;  3SSU A;  3BCC J;  1JB0 J;  3AE9 C;  1FAV A;  5L8R J;  5KJ7 D;  2QM7 A;  1Y47 A;  1RQU A;  3CD6 P;  4GKG A;  4EYY Q;  1SQP K;  1OZH A;  1OX3 A;  3A3Y B;  2JDI H;  1W2B O;  1VQM P;  1FU1 A;  1NAF A;  3GHG B;  3AEF C;  1H88 A;  2P58 A;  1QVF O;  4KJM A;  3B5N B;  1SQQ G;  4JYC A;  4Y28 J;  1NTK D;  1DD3 A;  1IZN B;  2QIW A;  3H1J E;  2HOD A;  1XTG B;  3EQ2 A;  2KK7 A;  1X0T A;  1ZW0 A;  5KJ7 C;  1ZLL A;  1FOS E;  4I6M C;  1KMI Z;  3CPW O;  1GTW A;  1M1J C;  1E5W A;  3WU2 E;  2ZT9 C;  2J58 A;  1NU1 G;  2ZXX A;  1KB9 I;  2KLV A;  1KOR A;  2Q9I B;  1SQV G;  1W2E A;  1H89 A;  1X79 B;  1RE3 C;  2AEF A;  3KHU A;  1X22 A;  5AVQ B;  2O01 J;  3OJA B;  3L70 G;  1P84 E;  1OWA A;  1FBM A;  3L72 D;  1KZU B;  1FZC A;  4C7R A;  3CMA P;  2C9N Y;  2OYO A;  1SQP D;  3O6Q A;  4GT1 A;  2HLO A;  3BRV B;  1SQQ J;  2J3G A;  1EZV D;  2HR3 A;  5KKZ C;  2D39 A;  3IF4 A;  1VF5 B;  4UB8 E;  1HJB A;  1DEE G;  5KLV J;  5AW6 B;  2YMY A;  1YQ3 C;  5APQ A;  3Q5S A;  1OVR A;  2QSI A;  3AE7 C;  1G2C B;  2OYH A;  3MUD C;  2KS1 A;  3P32 A;  1LWU A;  2J2P A;  2R3C A;  1K04 A;  1JMM A;  1OW6 A;  3H1I E;  3O6Q B;  1KQF B;  2OYI C;  3UIA A;  2NPS B;  2JHH C;  1SFC B;  2K3R A;  1NHL A;  2KOG A;  2WPV B;  1L0L G;  3M0A A;  4N3Y B;  3H1H J;  1ZP0 C;  1AQ5 A;  5KLI C;  4I1L A;  3B5N D;  2WT7 A;  3PH0 A;  3RK3 D;  2ZVO B;  1FZE B;  2HPC A;  1HUC A;  1HVV A;  1GMJ A;  3CWB D;  4JQ0 D;  1LTS C;  3VMZ A;  1AVO A;  1S9K D;  3HUS B;  1SFC A;  3L70 J;  1FZF C;  2IZ1 A;  1QX8 A;  3QWO C;  2O01 H;  4H44 B;  5APY A;  2WSC J;  1RF0 C;  3TGU J;  1N7S B;  1SQP G;  2YKQ A;  1FZA C;  5AVV B;  1LTJ A;  1FZA B;  4LC1 A;  1EZV E;  2KNC B;  4NPD A;  3TF5 A;  3VYI A;  1LJ2 A;  1T2K C;  1HGV A;  2MJZ A;  3U1A A;  2VRS A;  1K05 A;  2Q5U A;  3CWB G;  2KI7 B;  4W80 A;  2J5U A;  1RF1 B;  2QJY B;  3LW5 H;  1SQX E;  1P84 I;  1LTJ C;  1TU3 F;  1OMI A;  2Q6Q A;  1URQ B;  3BVH A;  2OYH B;  2C9L Y;  1GL2 A;  1L0N J;  3G71 P;  1VPC A;  1L0N D;  4U3F E;  2WPS A;  1RF0 B;  2ZAE B;  4ASV A;  2OQQ A;  2KXP B;  5BU5 A;  2W8Z A;  5KAF H;  2M3B A;  2M5A B;  2HYN A;  1GL2 D;  2AXT H;  4BWN A;  3L74 D;  3FIB A;  2J3O A;  3M9Q A;  3L74 J;  3AEE C;  3RL0 g;  5GTH E;  2FYN C;  1CZQ A;  4HYT B;  5CHX A;  2WT7 B;  3L74 G;  2Z4E C;  2GUS A;  2H88 C;  1QVG O;  5EFW B;  1IFI A;  2WWW A;  3BCC E;  3L35 A;  3RL0 D;  2Y9Y A;  3TYY A;  3A7O A;  1S3J A;  3GLM A;  1JY3 O;  1JC9 A;  3NXS A;  1JNM A;  3MZW B;  5AW9 B;  1JTH B;  1SQX J;  1IFM A;  2FFD A;  1SQX G;  2A45 I;  3H1L E;  3V5B A;  2E76 D;  4HKZ H;  4Y99 B;  2Z4E B;  4BRY A;  2KLU A;  3HD7 B;  1SQV D;  5AVX B;  3CXH I;  1SP4 A;  2V7Q H;  4UB6 H;  1BCC J;  1USE A;  4NPF X;  3CCM P;  3S4R A;  1IFP A;  4EOT A;  3PTZ A;  3M9H A;  4ASW A;  2FFD B;  1RH5 B;  1YTZ T;  4KT0 J;  2Z4E A;  2CPS A;  5BU8 B;  1NTK J;  4PD4 E;  2HLO B;  1WT6 A;  1URQ C;  3GHG C;  2O01 N;  2N9B A;  2D2C B;  3AE5 C;  2Q9I C;  3L70 D;  1BGY J;  5KLV E;  2XZR A;  2HOD B;  3VTP C;  4DZO A;  4GDO A;  3Q1M A;  2FYU K;  3H1I D;  5KTB A;  2KSE A;  2OTL P;  1NGM B;  2J3U A;  3H32 A;  1N2D C;  1X9V A;  1HWT C;  3RBX A;  4H44 C;  3CX5 H;  4YPC A;  4DT0 A;  2Z5H A;  2CK3 H;  3HTK A;  1SQP J;  1KC8 Q;  1W5C E;  2QJK B;  3OW2 O;  1RE3 A;  5APX A;  2WZ7 A;  3A2A A;  1S9K E;  2B9B A;  1FZG A;  3V4Q A;  5CMZ A;  3JC2 2;  1GK4 A;  4EPU A;  1N7S C;  2FXP A;  1KQS O;  1SFC C;  1RF0 A;  1IC2 A;  3F5H A;  1GU4 A;  2ZVN B;  1HH0 A;  2JHK F;  4OGQ D;  1FOS F;  3SWF A;  1FZC C;  1T3U A;  3MD0 A;  3R4Y A;  2JKV A;  3LID A;  1DX7 A;  1LT1 A;  3M91 A;  4ZMD A;  2GM4 A;  1SQX K;  1URQ D;  1U7J A;  2G8Y A;  5KLV G;  1FZB A;  1PGQ A;  1GZL A;  3AEC C;  3H1K J;  3B4S A;  2HPC B;  2W6J H;  2OYI B;  3H1L D;  1SQV J;  2J60 A;  1M8O B;  2ZYD A;  3Q3D A;  2FYU J;  2N9Y B;  3G6E P;  4XFJ A;  2FBW C;  1BE3 E;  1L0L J;  1M1J A;  4IFM A;  2E76 B; 
#chains in the Genus database with same CATH homology
 1N86 C;  5AW2 B;  1FZB B;  1NH4 A;  2N1T C;  1G2C B;  2OYH A;  1JY2 O;  3HD7 A;  2KB7 P;  2IFN A;  3TNU A;  1FZF B;  2ZFC A;  3P32 A;  3E1I C;  1LWU A;  2J2P A;  4M7H A;  2R3C A;  1J1D C;  1JMM A;  5CCG C;  3H6P A;  1NTK K;  3BAS A;  1IFD A;  2BAS A;  2OYI C;  3UIA A;  2J1G A;  2YO2 A;  3T97 A;  2NPS B;  4RES B;  2JHH C;  1SFC B;  2XKM A;  1LT9 C;  1FZG C;  2H43 A;  1NHL A;  2KOG A;  3NMD A;  3B8E B;  3M0A A;  3N7N A;  1RF1 A;  4N3Y B;  1A02 J;  2OYH C;  1HGZ A;  3P8M C;  1KIL D;  5APQ A;  4M7F A;  1AQ5 A;  1IK9 A;  3MIW A;  4I1L A;  4AQR D;  1HTL C;  1N7L A;  3B5N D;  3NTN A;  2WT7 A;  2WNP F;  3RK3 D;  3G3Z A;  1FZF A;  1FZE B;  1KQL A;  5CJ0 A;  2Z5I A;  2YKP A;  5AW7 B;  2HPC A;  1HUC A;  1FZC B;  1HVV A;  3OAK A;  1NO4 A;  3PP5 A;  1ZN5 A;  2NPS C;  3OA7 A;  1LTS C;  2R5B A;  3VMZ A;  1IFJ A;  2IFM A;  1CW5 A;  1CI6 A;  1S9K D;  3HUS B;  1SFC A;  1N7S D;  1GL2 C;  3IR9 A;  2JHI F;  1FZF C;  4WBA A;  1N73 B;  2XDJ A;  1NTZ K;  2O01 H;  5KJ7 A;  5APY A;  4JYB A;  3EFG A;  3VN0 A;  2J0H A;  3L37 A;  1RF0 C;  1FZB C;  1N86 B;  4W7Z A;  3II6 A;  1CSB A;  1LTT C;  3VMY A;  1N7S B;  2YKQ A;  1FZA C;  1MZ9 A;  1NKN A;  5AVV B;  2L5G B;  2GY7 A;  1LTJ A;  1FZA B;  2JHL F;  4LC1 A;  2N1T A;  4Y99 C;  2C0X A;  1L4A A;  2WSE H;  1XTC C;  1N73 C;  3VYI A;  2P2U A;  1QL2 A;  1L0N K;  1T2K C;  1JY2 P;  5CCH C;  1HGV A;  2MJZ A;  2I1K A;  3U1A A;  2VRS A;  2R5D A;  2HPC C;  1L4A C;  2Q5U A;  2J59 M;  2PP6 A;  4W80 A;  3KPE A;  5AW0 B;  1KFN A;  3V2R A;  1L4A D;  5BVZ A;  1RF1 B;  4JZC A;  4I2L C;  3LW5 H;  1KIL B;  3WMM 0;  1LTJ C;  4C46 A;  2YKO A;  1GW3 A;  2W6A A;  4XE5 B;  1SVF A;  2FIB A;  1URQ B;  2Q3I A;  3BVH A;  2KSJ A;  1Z3U A;  1RE3 B;  2OYH B;  2C9L Y;  1GL2 A;  1MFZ A;  3M0D A;  2HFE D;  5AVT B;  1LTB C;  1VPC A;  2H43 B;  2J5Z A;  2Q9I A;  4WY4 D;  3HE5 B;  2KP8 A;  1LT9 B;  1FZG B;  2OYI A;  2WPS A;  2HG5 D;  1RF0 B;  1JY3 P;  3MGN A;  1Z3S A;  5AVZ B;  5BU5 A;  3VOP A;  1M1J B;  2H7H A;  3VP9 A;  2M3B A;  4WY4 B;  2HYN A;  4WY4 C;  1GL2 D;  2FXM A;  1JCC A;  5CJ4 A;  1OXZ A;  3U59 A;  3L4F A;  2J0Y A;  3FIB A;  1G1J A;  1KFM A;  1A02 F;  2J3O A;  1QL1 A;  3M9Q A;  1FIB A;  2JHM F;  1LTI C;  2NPS D;  5AW3 B;  2C0W A;  1G1I A;  2IX7 C;  4R9T A;  3H32 C;  1LTA C;  3BVH B;  1CZQ A;  4HYT B;  5CHX A;  2A45 H;  2WT7 B;  4IFF A;  5AVR B;  2Z4E C;  2GUS A;  2YNY A;  3B5N C;  1N73 A;  4AUW A;  1LWU B;  1IFI A;  2WWW A;  3L35 A;  3RL0 D;  2XNX A;  3TYY A;  5AW1 B;  3A7O A;  1FJP A;  1JY3 O;  2NPS A;  2A45 G;  1ZR2 A;  1JC9 A;  3NXS A;  1JNM A;  4W7Y A;  2OAR A;  4O9B A;  1SQV K;  2WSC H;  1RE4 C;  5AW9 B;  1RY3 A;  1JTH B;  5AW4 B;  4NYT A;  3RK3 C;  1H8A A;  4KHX A;  2IPP A;  3HTK B;  1IFM A;  1ZR4 A;  3HD7 D;  2FFD A;  2A45 I;  3RL0 C;  3P8C E;  1URQ A;  2KYV A;  3V5B A;  1LWU C;  1T3J A;  1MUU A;  3R2P A;  1VDF A;  1WRG A;  4Y99 B;  2Z4E B;  3RK2 B;  2LKM A;  4JF7 A;  3HD7 B;  3TK1 A;  1NTM K;  3HD7 C;  3H32 B;  5AVX B;  3LIE A;  1SP4 A;  1RE4 A;  3HE4 B;  2XV5 A;  3N4X A;  2J3F A;  3TSI A;  4IFD K;  5CCH A;  3CLQ A;  5CCG D;  1LGH B;  4EOT A;  1LTG C;  3RL0 B;  4AYC A;  1GL2 B;  3HUS C;  1J2J B;  4N6J A;  3B5N A;  3M9H A;  2FFD B;  3M0D C;  2HOD C;  1GDT A;  1YTZ T;  2J3F D;  2Z4E A;  1FDM A;  3M06 A;  2CPS A;  1AFO A;  5CCH D;  1J1E C;  5BU8 B;  4WB4 A;  3V4W A;  2HLO B;  1EQ7 A;  1WT6 A;  1JOC A;  1URQ C;  1SFC D;  2CPB A;  2PAJ A;  4LLH A;  1ZV8 A;  3KQG A;  3GHG C;  1J1E B;  2ZXE B;  2N9B A;  1NOH A;  2Q9I C;  4HH2 A;  3BVH C;  1SLQ A;  1PFI A;  2JJL A;  1JCD A;  4C7N B;  4XA4 A;  2XZR A;  2HOD B;  3VTP C;  2J61 A;  1L0L K;  1JY2 N;  1L4A B;  1MV8 A;  1DEB A;  4DZO A;  1NKZ B;  2O1K A;  1T2K D;  2N1T D;  1KIL A;  1JUN A;  3I5C A;  4GIF A;  2W27 A;  1NWQ A;  2FYU K;  5APW A;  2YO3 A;  3VMX A;  1DH3 A;  1JO5 A;  1J1D B;  1FJK A;  1T8Z A;  3E1I B;  2W6B A;  3KDP B;  5KTB A;  5AW5 B;  4LGD E;  1CI6 B;  2Q7C A;  2WPQ A;  4N78 D;  3U1C A;  1JY3 N;  3IFM A;  2J3U A;  2E42 A;  1IFN A;  1GU5 A;  3H32 A;  3CL3 D;  4M3L A;  2P67 A;  4OH8 B;  1N2D C;  3P7K A;  2H43 C;  1X9V A;  5APV A;  5AVU B;  3V2P A;  2R32 A;  5AVY B;  1HWT C;  1N86 A;  2E43 A;  1N7S A;  2GUV A;  1GW4 A;  5APT A;  1FIC A;  2WPR A;  1FAV A;  2Z5H A;  1KIL C;  1X8Y A;  5AW8 B;  5KJ7 D;  2QM7 A;  3HTK A;  3NFQ A;  3P8C D;  1SQQ K;  4GKG A;  1IO4 A;  1G2C A;  1SQP K;  3A3Y B;  1GD2 E;  1RE4 B;  3MUD A;  4ZKU A;  3HE4 A;  3L36 A;  1FZE C;  1FU1 A;  3MTU E;  1NAF A;  1YYC A;  1RE3 A;  3GHG B;  5APX A;  3RK2 D;  2P7J A;  2WZ7 A;  1GK6 A;  3A2A A;  1S9K E;  4N78 E;  1H88 A;  3B5N B;  4ZKP A;  1LT9 A;  1FZG A;  4JYC A;  1M7L A;  2WSF H;  3V4Q A;  4B86 A;  5CMZ A;  5AVW B;  1GK4 A;  4R9J A;  4EPU A;  1NU1 K;  2HOD A;  3BRT B;  3HUS A;  2J61 B;  1N7S C;  1SFC C;  1YTZ I;  1XTG B;  3EQ2 A;  3HRN A;  2WIT A;  3BAT A;  2XNX B;  3TNU B;  1ZLL A;  2FKW B;  5KJ7 C;  1FOS E;  3VP8 A;  3V2Q A;  1FZE A;  4I6M C;  1RF0 A;  1IC2 A;  2XNX C;  1GU4 A;  3SWY A;  1GTW A;  1M1J C;  1E5W A;  1HH0 A;  2JHK F;  3CI9 A;  3GHG A;  2N1T B;  2J58 A;  5AVS B;  1FOS F;  4WY4 A;  4C7N A;  3O8Z A;  2KLV A;  2H8P D;  3SWF A;  1FZC C;  1T3U A;  3M9B A;  5APS A;  2Q9I B;  3MD0 A;  3RK2 C;  1W2E A;  1IJD B;  3KYQ A;  1HBW A;  3LID A;  1H89 A;  1X79 B;  1RE3 C;  2I1J A;  1DX7 A;  2O1J A;  1SQB K;  5AVQ B;  3M91 A;  2GM4 A;  1SQX K;  2HLO C;  1URQ D;  1FZA A;  1LTJ B;  3OJA B;  2FYZ A;  1OWA A;  1FZB A;  1FBM A;  3RK3 B;  1GZL A;  2P1J A;  2QM8 A;  1RF1 C;  1KZU B;  2WTY A;  2JEE A;  1FZC A;  2HPC B;  4DOJ A;  4C7R A;  3HE5 A;  5APU A;  2FFD C;  2C9N Y;  4JYO X;  3A5T A;  2OYI B;  1Z56 A;  4GT1 A;  4EIJ A;  1FZD A;  2HLO A;  2POH A;  2M8R A;  2XU6 A;  3BRV B;  2J60 A;  2J3G A;  1JTH A;  5CCG A;  2J0G A;  3V2N A;  5KLV K;  2D39 A;  4ZFG A;  1HJB A;  3E1I A;  3C9I A;  1FID A;  5AW6 B;  1M1J A;  2YMY A;  4IFM A;  2J64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...