2OYIB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
NSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 301
sequence length 301
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiB03
2FFDC 2OYIB 1LT9B 1LWUC 4NYTA 1LT9C 1RF0C 2Z4EA 2FIBA 3H32B 1FZBC 1N86A 2J3GA 2A45G 1FZDA 2JHLF 2WNPF 1FZEA 3HUSC 2FFDA 1JC9A 2XNXA 1RE3C 2HLOC 3BVHB 3GHGC 2J64A 4M7FA 2OYIA 2Q9IC 1LT9A 1LWUB 2JHHC 1W2EA 1M1JB 1FZAB 2J5ZA 2J0HA 1RF0B 3H32A 1M1JC 1FZAC 4JZCA 1FZBB 2OYHC 2J0GA 1FIBA 2J60A 4M7HA 2J3OA 1FZCC 1LTJB 2HODC 2J2PA 3HUSB 2JHMF 3BVHA 1LTJC 1RE3B 2HLOB 4JYOX 3GHGB 2Q9IB 1FZFB 1LWUA 1M1JA 1RF1B 1FZAA 1FZFC 1RF0A 1JY2O 1RF1C 1FZBA 2J1GA 4R9TA 1Z3UA 2OYHB 1RE4B 2JHKF 2H43B 2HPCB 2J61B 4ZFGA 1LTJA 2GY7A 2Z4EB 1RE4C 3HUSA 1FZCB 2HODB 2H43C 2HPCC 1RE3A 2HLOA 2Z4EC 3GHGA 3E1IB 2Q9IA 1FZFA 1N86C 3E1IC 1RF1A 1FIDA 1FZEC 1JY3O 4EPUA 1N73B 4R9JA 2J3FD 2J3UA 2XNXC 1FZGB 1RE4A 1JY2P 2OYHA 1N73C 2H43A 2J3FA 2HPCA 2OYIC 2J61A 1JY3N 1FZGC 1FZCA 2HODA 2A45I 1FICA 2A45H 3E1IA 3H32C 1Z3SA 1JY2N 1N86B 2JHIF 2J0YA 1FZEB 1N73A 1T3UA 3FIBA 1JY3P 2FFDB 3BVHC 1FZGA 2D39A 2XNXB
chains in the Genus database with same CATH superfamily
4AQRD 1JCCA 1S3JA 4IFDK 2JR8A 1LT9B 3L73E 5BU8B 2KOGA 1X8YA 1NTME 2P10A 4IL6X 1EXJA 1VQNP 1KMIZ 1RE3C 2IPPA 2OYIA 5M1BA 1S9KD 2LXBA 3SWKA 4IFMA 1AQTA 2LR2A 3P8CD 1JO5A 3BCCD 3BRVB 1YITP 4DOJA 3SFEC 1L4AD 3VMYA 1OW7A 2JKVA 1W5CE 1J1EB 5BU5A 1SQVK 2H88C 1W2BO 3OA7A 1KQLA 3P7KA 5GTHH 4W7YA 3CXHI 2JO1A 2OYHB 1T2KD 2JHKF 3L75G 1NYHA 1CI6B 1OX3A 3HUSA 2HODB 3L75J 1SQQG 4RO0A 2Z4EC 2MJZA 1IJDB 2KXPB 2KNCA 1HF9A 3CCVP 1ZP0C 2KZJA 3SWFA 5AW8B 1HJ0A 1ZW0A 2FKWB 2Y9YA 1AV1A 2H8PD 2YMKA 1FZEB 4LC1A 2NPSA 5KJ7D 1N73A 3L74E 3L71E 2C9LY 2OTJP 1KILE 1EC5A 2IYPA 5KLVE 3FX0A 1GTWA 1G1IA 1LT9C 2FIBA 3H1LE 1KC8Q 1D7MA 1DD3A 1VDFA 4WY4C 1H88A 3CC4P 2M3EA 2HFED 3PHLA 3L72J 4XE5B 1JUNA 2ZYAA 1FZAB 1PGJA 2XZRA 1EDJA 3H1KG 1RF0B 2J59M 3HD7A 3H1KJ 1H8AA 4AYCA 1VQLP 4JYOX 1J1EC 3NMDA 2Q1KA 3A7OA 1ZRTD 2BCCG 4GIFA 4C7NB 1XTGB 1NTKJ 1JMBA 1LNQA 1EDKA 2OTKE 3IAOA 1LTSC 3PJSK 4QMAA 1KFNA 2O1JA 1FIDA 3N7NA 1KYOE 2ZYDA 1VQ5P 2KK7A 3TNUB 1SQXJ 3KXDA 3L75E 5AVUB 1SQQE 3CI9A 3TGUG 1QLED 3CWBD 1FBMA 2IYOA 2FFDB 1KQSO 4EOTA 2D39A 1HWTC 1XTCC 1L0NG 2YO3A 1NTKK 2FYZA 3AE1C 1Q86Q 5TJHA 3V4WA 2IDBA 1LWUB 2QIWA 1YI2P 3H32A 2GM4A 1SQXK 3BCCJ 1FZAC 4H0LB 2M8RA 1G2CA 1BCCD 2WSEH 1L0LK 2ZJSE 3HE5A 5CJ4A 3II6A 3G4SP 1IZNB 1P84D 3H1KE 4EDFA 3L70D 1BDDA 1R5LA 2HLOA 1FOSF 1JTHB 3GHGA 4NPDA 2JJLA 1N7SC 1BSHA 4NPEA 3O6QA 2QA4P 3B4SA 2AXCA 5GTHE 2J61A 1ZLLA 5CMZA 3CXHE 5APSA 2BCCE 1RHZB 1ZMEC 1Y8AA 5CCGD 4U3FG 2JDIH 3M91A 3V2PA 2WWWA 1N8RQ 3PTZA 2FFDC 2WVRA 1M1KQ 1E79H 1JOCA 2LXCB 2P58A 5E79H 2UWJE 1SFCD 1BE3G 4UB6H 1KQFB 2QE7H 2WNPF 4LGDE 4EIJA 3A0BH 3TGUE 2O1KA 1LP1B 2E42A 1OZHA 1URQA 1M1JB 4GKGA 1X0TA 3PP5A 2WPRA 4JZCA 1FOSE 1L0NE 5AVVB 2R32A 2J0GA 3L37A 4H0LC 3U1AA 3L35A 4Y99C 3MP7B 3A5TA 4MN4C 3U1CA 3H1JG 1ZR4A 2WSEJ 2Q9IB 1P84I 2KYVA 1P84H 3B8EB 1S9KE 1T6AA 3C8VA 3NXSA 3P8CE 3HE4B 5AW7B 3BCCE 1GL2B 1PZQA 5KAIH 3GF7A 1M56D 2Z5IA 2ZVNB 3RL0g 3RBXA 2QM8A 1IO4A 3WUVA 2WSCH 4BRYB 5CCHA 2J3FD 1OWAA 4TLFA 2E74B 2I1JA 1JM0A 5AVWB 3RK2D 1KILA 2OYIC 1YQ4C 1LGHB 2WT7B 2ITAA 5KAFE 2NZ2A 2YO2A 3CWBG 5AVRB 1JY3P 3H1IG 5CBNA 2A06D 2IBZD 5AVQB 3V2QA 3CPWO 5AVSB 3PH0A 1RH5B 2JHLF 3HUSC 2GA1A 2WSFH 2OQQA 2J0HA 1M1JC 4BXLA 3KYQA 1MUUA 2J60A 1BCCG 1UIIA 1BCCJ 2E75D 1RE3B 5BVZA 3L72D 2M5AA 1NTZK 3KZIE 2FY8A 3USSA 1HUCA 4B86A 3GG2A 2NPSC 2WITA 3LW5H 1YIJP 3L70G 1LTBC 1GL2C 5B66H 4M3LA 1SLQA 1JY3O 3B5ND 3L4FA 2RN0A 4N3YB 2WSCJ 3RGUA 2E74C 4YTPC 3RK3C 1YHQP 1FZCA 1ZRTE 2A45I 1LJ2A 1NTKD 2A45H 3CX5H 3AEFC 3AEAC 5AW5B 2FXMA 1Z3SA 3HD7C 5AVYB 2B87A 2WSSH 3L71G 2R44A 1OW6A 1YJ9P 2C0XA 2IBZI 1YJNP 2M3BA 1SQXD 3HRNA 2QG4A 1L0LD 2WPQA 1VQKP 4H13C 3CCSP 1SQVJ 3CWBE 2XNXA 3VMXA 2Z5HA 4EI2A 2KUBA 3CLQA 2O01H 2J5ZA 1Z56A 2WSFJ 5E79E 4I7ZB 2P67A 4WY4B 1GK4A 3G9RA 3BVHA 2WQYC 2W6BA 2NRGA 1WMKA 3CC2P 1FZBA 2RMZA 2J1GA 1RQUA 1RE4B 3HTKA 2H43B 4R4MA 3LW5J 4GOFA 2Q7CA 1A02J 4JPZB 1BCCE 1MKMA 1NKNA 2N9YB 1KFMA 1Q2NA 2PFXA 1PL5A 4ZKPA 1GL2D 3D70A 1P84E 3Q5PA 2HPCA 1PP9J 3L70E 4JYBA 3AEGC 4LLHA 3OW2O 5AW1B 3SWYA 3H32C 1OXZA 3MD0A 3GLMA 2HR3A 2E74D 1NHLA 1PGQA 3F89A 1FZGA 2A06G 4C7RA 3S4RA 3M9HA 1M90Q 1AFOA 1NH4A 2HLOC 3GHGC 4UB8H 3CMAP 3AE3C 2KS1B 2W6JH 1KB9H 4L73A 3BATA 3T97B 1K04A 4JBZA 4RKUJ 2O01J 2O3JA 4H44C 3MIWA 5AVTB 4I7ZC 1LTJB 1L4AA 2JHMF 5TISH 1S4XA 3L72G 1KD1Q 2K9JB 1QL2A 4PJ0E 3V2RA 1G1JA 4L76A 4R9TA 3CCJP 1RE4C 5AW9B 2H43C 1OVUA 1GU5A 3E1IB 1FZFA 1RF1A 3M0DA 1VQ7P 1EQ7A 1S2EA 3AE4C 1H0TA 1FDIA 1JY2P 3GMAA 3A0HE 1NTKG 5KKZC 4KT0J 3CCQP 2J0YA 1FU1A 1N7SB 1OW8A 2AXTE 4OWFA 5KJ7A 3V5BA 4Z1MH 2L91A 4IL6E 1SQXG 2N9BA 3JCUE 2XKMA 1L0LG 1NU1K 1R8EA 1N86A 4Y28J 5L8RJ 1DEBA 1L0LJ 5H2FH 2K9YA 1EZVD 1NTZD 2QJPB 1JMMA 2MKVA 1DEEG 1HVVA 2HYNA 1J2JB 1OVVA 2A06E 2IBZE 3U59A 2RKLA 4M7HA 2ZAEB 4OGQC 1LTJC 1FJKA 1SQPJ 2E5YA 4XA4A 2BEQD 3V2NA 1T3JA 2KB7P 1JY2O 2HG5D 3BCCG 4WY4D 3MUDC 1Z3UA 1NKZB 1MV8A 4I2LC 2GY7A 4Y99B 2N1TB 2XNDH 2OGUA 3VP8A 3E1IC 3L72E 4R9JA 3D6YA 1JY3N 1VQPP 2ZYGA 1FICA 1PPJD 1OVRA 4WWIA 4U7JA 1SQPK 5AW6B 3WUUA 1GK6A 1NAYA 3VTPC 1M7LA 2OYIB 2G3AA 3TF5A 1KN7A 4XFJA 4TT3H 1NTKE 4R4LA 1L0NK 5APVA 4DZOA 1QL1A 1S5LH 4HJGH 1FC2C 4A7PA 3CCMP 1EZVI 3QWOC 2Y0DA 2C9NY 1QEXA 2V7QH 3FGAD 2QJPC 1LT9A 1E5WA 2B89A 2FXPA 1VL2A 2QJKC 1SQXE 3W67A 2K88A 2YMYA 2W83C 1SVFA 1NWQA 1SQBJ 1IFMA 3O8ZA 1L0LE 1FZCC 3HUSB 1SQVD 3P8MC 3AEBC 2KNCB 1VQ8P 3AEEC 2YKPA 5AW4B 1LTTC 2IX7C 5EFWB 3WUTA 1AVOA 2N1TC 5TISE 3AECC 1HTLC 4EPUA 2NPSB 3IR9A 1N73B 1S5LX 1YJWP 3NFQA 2XNXC 1GU4A 2OYHA 1NJIQ 3FXDA 1YQ3C 1CI6A 2HODA 1SP4A 1SQBK 2P1JA 3I55P 2CK3H 3H25A 3AE8C 1BGYD 4ZMDA 2ZXEB 5CCGA 1AJYA 3A3YB 4PV1B 1T3UA 2D2CC 2Y0CA 3BVHC 2YNYA 1BDCA 1PP9D 2YKOA 2GUSA 3RK3B 2Y9ZA 2M0BA 4GT1A 3RBZA 1ZV8A 1K05A 2K1AA 1FZBC 1SFCA 1N7SD 2FYUJ 3HD7B 1FZEA 3CX5D 1DD4A 4HB1A 4WB4A 1X22A 3TYYA 2J64A 4M7FA 1NTZJ 1NAFA 4GOEA 4HH2A 3WU2H 2ZVOB 4WBAA 3E7KA 2YIUB 1IFNA 1HH0A 3LIEA 3D71A 3V6IA 4H13B 2J2PA 5APTA 3P32A 1KV4A 4BWNA 1FZAA 1AA0A 1RF0A 2DW3A 3L73J 1NTMJ 2FYUK 3JSVC 3K5BA 1HGVA 1RQVA 1VQOP 1GZLA 1UIXA 4RJTA 2CPSA 4H0LD 1S72P 3RL0B 1N73C 2J3FA 2O01N 2N1TD 4C7NA 1NU1D 4YXDC 3AE7C 1PPJG 1Y47A 2BEZF 1M8OB 2W6AA 2XDJA 1ZN5A 1L4AC 4GDOA 3TNUA 4PV1C 1IK9A 4C46A 3EFGA 2I8DA 4YPCA 3VMZA 3EQ2A 4N6JA 4IOIH 3CL3D 3H32B 1NTMK 3CX5I 5KTBA 2I1KA 3Q5SA 1G2CB 1VF5B 2QEXP 2FFDA 5APWA 1HJBA 1JC9A 1IFIA 1J1DB 1YYCA 3GW6A 3HE5B 1EDLA 2XU6A 1VPCA 1IFPA 2YIUC 4KHXA 2R3SA 1K73Q 2KLVA 3SFDC 1LTIC 1SQVG 3H1HD 1S5LE 5DJUB 2J58A 3WMM0 2HLOB 2E76B 3GHGB 2W27A 1EZVE 3BASA 2P2UA 1NTZE 2KSJA 2ZFCA 1LWUA 3L74J 1NOHA 1VQMP 1GW3A 2XV5A 1DX7A 3O6QB 1KB9D 2Q3EA 4H44B 2KP8A 2J61B 3ABVC 3H1LJ 2IZ0A 2Y0EA 4UB6E 1YTZI 4PD4D 2E43A 1IC2A 1SQPD 1N86C 1FE6A 1T8ZA 3TK1A 1VQ6P 1DH3A 3A0BE 1Y9BA 5APXA 2FYNC 3MGNA 1VQ9P 3B5NA 1CZQA 1JB0J 3I5CA 2AEFA 3RL0C 1L0ND 1IFJA 1OFCX 1JTHA 2VRSA 2NPSD 4ZNCA 1BGYG 1NVOA 1OIPA 3M06A 1MFZA 3QH9A 1IFDA 1BGYJ 2K3RA 2IZ1A 1PP9G 1URQB 5KKZB 5KLVK 2KSEA 1PPJE 3EWKA 4PV1D 2A45G 1FZDA 5KAIE 3AE6C 3M9QA 1ZR2A 4DT0A 2YXQB 3TDKA 1VF5C 2C0WA 3RK3D 1QVFO 3IN6A 3G6EP 1U7MA 1J1DC 2QM7A 3HD7D 3CXHH 2IBZG 2Q6QA 2W8ZA 4K35A 2J3OA 1A02F 1IK7A 4RESB 1SQQJ 4YXWH 2FBWC 1GDTA 1LP1A 2AEMA 3CCUP 3E1RA 2E76C 1M1JA 1FDMA 2Q5UA 2KZIA 1KB9I 3WU2E 5KLIC 2G8YA 2JWAA 1SQBD 2CPBA 1OMIA 4H13D 3M0AA 1KILB 4PD4I 2ZT9B 1SFCB 4JYCA 2IFMA 4OGQB 4PD4H 4U3FD 2QJYC 2H7HA 3NTNA 3KPEA 1SQVE 2Q9IA 3VOPA 3AE5C 4GODA 2P7JA 3Q1MA 1JCDA 3KDPB 3HE4A 1GL2A 1FS0E 1NU1G 3L36A 1BE3D 1NU1J 3Q2YA 3JC22 2JHIF 1SQQK 4BRYA 3RL0D 3FIBA 1L2PA 2R5DA 4L74A 3PLNA 1CSBA 2GUVA 2WT7A 1BSNA 1URQC 1Q90D 2J3GA 2IFNA 2WMMA 3AEDC 3FWNA 3OAKA 1N2DC 3H1JD 5B66E 1BGYE 4N78D 1JEKA 2M5AB 3CMEP 2JHHC 1PP9E 5CBOA 2B88A 3ZDMA 1VF5D 5AVZB 1TU3F 5KAFH 2FYUD 5AW3B 2OYHC 3RK2B 2BCCJ 3IFMA 3H1HG 2HODC 3CX5E 3H1HJ 1Q81Q 3CC7P 1KZUB 5CCGC 2QJKB 3R4YA 2ZXXA 5AW0B 1YTZT 2K37A 5CCHC 4D6TD 5GTIH 1FZCB 2E76D 4OH8B 1KILC 1RE3A 1PV3A 1SQPG 2ZT9C 1SFCC 3FWLA 4JQ0D 3TGUJ 2B87B 1FZEC 3H1ID 5DJTB 2J5UA 3BRTB 1QGKB 4H44D 1AVYA 3V4QA 2J3UA 2JEEA 3L73D 1QVGO 1VQ4P 3SSUA 2R3CA 2PP6A 1NTMD 1RY3A 1WRGA 1L0NJ 1FAVA 1MFTA 1N7LA 1EXIA 3KZIH 3VP9A 4L75A 2E75B 2XNXB 3UIAA 1K9MQ 3AE2C 1RF0C 2Z4EA 1NU1E 3D6ZA 4KJMA 2JP3A 3N4XA 3KQGA 2D2CB 3BVHB 1QX8A 4I6MC 1URQD 1PIXA 3KHUA 2PRRA 5B5EH 3B5NB 3H6PA 1FZBB 2QSIA 3F5HA 1R5SA 1FIBA 2QRXA 4WVZA 1PFIA 3HTKB 3LIDA 2WPSA 3RK2C 2B9BA 4W80A 2PAJA 3C9IA 4EYYQ 1FJPA 3CD6P 4ZKUA 3G71P 2W90A 2YXRB 1USEA 5AVXB 1SQBG 1GMJA 1U7JA 2HPCB 2JWDA 4WY4A 4CPGA 1HGZA 2L5GB 3H1HE 5CHXA 4U3FJ 3CCRP 2Q3IA 3L74D 5CCHD 3L71D 2WTYA 3EFFK 4DCKA 4DJGA 3W68A 1KILD 1NO4A 1KQGB 1FZGB 1RE4A 4UB8E 2H43A 2ZT9D 3GF3A 5KLVD 4O9BA 4OGQD 3Q5RA 1KB9E 1M57D 3H1LD 1BE3J 1PGPA 2H89C 1LTGC 3TSIA 3C1LA 2KIKA 4PD4E 1SQPE 4I1LA 1HBWA 2RH0A 4JF7A 1ZOYC 1Q7YQ 1USDA 2E75C 1LWUC 1FDOA 1X9VA 3MZWB 5C39A 5APQA 1L4AB 2V4HA 3PRJA 3MTUE 2POHA 3H1JJ 4NPFX 1LTAC 1JNMA 1X79B 1YBKA 2WZ7A 3CCLP 1NGMB 2FYUG 3B5NC 1EZVG 1NTZG 3AE9C 1FZFB 1AQ5A 2KS1A 3RK3E 1KYOD 1RF1B 3T97A 5K5GB 1S1CX 3Q3DA 2V7QJ 3OJAB 1H0TB 1PGOA 4D6TG 3L75D 1LTJA 4D6TJ 2HPCC 3A2AA 1SQQD 1GD2E 4W7ZA 3B71A 2K9JA 2PGDA 3I56P 5H2FE 3CWBJ 1GW4A 1WT6A 3G3ZA 3MUDA 1EDIA 3H1IJ 5CJ0A 3L73G 2LKMA 1NTMG 1FZGC 1SQBE 5AW2B 3M9BA 2QVAA 3E1IA 5GTIE 3FXEA 4U3FE 1N86B 1CW5A 1ZXGA 2FYNB 2BASA 4PJ0H 1KORA 1H89A 4NYTA 2YKQA 3IF4A 4OVNF 1BE3E 2FXOA 3S1KA 1Q82Q 1N7SA 2OARA 2OTLP 1U57A 2E5TA 5APYA 3ITKA 1MZ9A 2SPZA 3VYIA 4AUWA 2Q9IC 1W2EA 3A0HH 3S9OA 3H1KD 4IFFA 3L70J 2D2CD 2KI7B 2AXTH 3VMAA 3H1JE 1T2KC 1KYOI 1KYOH 1K8AQ 4IL6H 4N78E 3R2PA 1FZFC 1RF1C 3M0DC 3JCUH 5B5EE 3CXHD 3CCEP 2BCCD 4ZFGA 2FYUE 4HYTB 2Z4EB 2KLUA 2OYOA 4ASWA 1KTMA 1SS1A 3L74G 2R5BA 4HKZH 5APUA 3L71J 5KLIB 4ASVA 5KLVG 4K3AA 5KJ7C 5KLVJ 3H1LG 2N1TA 4D6TE 2AEJA 1LT1A 1JY2N 2QJYB 2WPVB 3MHVA 3VN0A 3TGUD 3H1IE 1DIPA
chains in the Genus database with same CATH topology
1M7LA 4AQRD 1JCCA 2OYIB 1CSBA 4IFDK 2GUVA 1LT9B 5BU8B 2KOGA 5AVQB 2WT7A 1X8YA 3V2QA 1URQC 1L0NK 5APVA 5AVSB 4DZOA 1QL1A 2J3GA 2JHLF 2IFNA 3OAKA 1N2DC 3HUSC 2C9NY 1RE3C 4N78D 2IPPA 2OYIA 1S9KD 1LT9A 1E5WA 2JHHC 2WSFH 4IFMA 3P8CD 1JO5A 2J0HA 2YMYA 1M1JC 1SVFA 1NWQA 3BRVB 3KYQA 5AVZB 4DOJA 1IFMA 1MUUA 2OYHC 5AW3B 3RK2B 1L4AD 3IFMA 3VMYA 2J60A 3O8ZA 1FZCC 2HODC 3HUSB 1J1EB 5BU5A 1RE3B 1SQVK 3P8MC 5BVZA 3OA7A 1KZUB 1KQLA 1NTZK 1HUCA 4B86A 5CCGC 2NPSC 2WITA 3P7KA 4W7YA 3LW5H 2OYHB 1LTBC 5AW0B 1YTZT 5CCHC 1T2KD 2JHKF 2YKPA 1CI6B 1GL2C 3HUSA 5AW4B 1FZCB 2HODB 4OH8B 1KILC 1LTTC 2IX7C 1RE3A 2Z4EC 1SFCC 2N1TC 2MJZA 1IJDB 4M3LA 1SLQA 1FZEC 1JY3O 1HTLC 4EPUA 2NPSB 3IR9A 3B5ND 3BRTB 3SWFA 1N73B 3L4FA 5AW8B 3NFQA 3V4QA 2J3UA 2XNXC 2JEEA 1GU4A 4N3YB 2OYHA 2R3CA 2PP6A 1CI6A 3RK3C 1FZCA 2HODA 1SP4A 2A45I 1RY3A 2FKWB 1SQBK 2A45H 1WRGA 2P1JA 5AW5B 2H8PD 2FXMA 1Z3SA 3HD7C 5AVYB 1FAVA 1N7LA 1FZEB 4LC1A 5CCGA 2ZXEB 2NPSA 3A3YB 5KJ7D 1N73A 1T3UA 3VP9A 3BVHC 2C9LY 2YNYA 2XNXB 2C0XA 3UIAA 2M3BA 2YKOA 2GUSA 3RK3B 3HRNA 4GT1A 1GTWA 1ZV8A 1G1IA 1LT9C 1RF0C 2Z4EA 2FIBA 1FZBC 1SFCA 1N7SD 3HD7B 1FZEA 2WPQA 1VDFA 4WY4C 4WB4A 1H88A 3N4XA 2HFED 3KQGA 2XNXA 3TYYA 4I6MC 3VMXA 3BVHB 2J64A 1URQD 4M7FA 1NAFA 2Z5HA 4HH2A 4XE5B 1JUNA 4WBAA 1FZAB 2XZRA 2O01H 3CLQA 2J5ZA 1RF0B 1Z56A 2J59M 3B5NB 3H6PA 3HD7A 1FZBB 1IFNA 1HH0A 1FIBA 1PFIA 3HTKB 3LIEA 3LIDA 2P67A 1H8AA 4WY4B 1GK4A 2WPSA 2J2PA 3RK2C 4AYCA 5APTA 4W80A 3BVHA 3P32A 2PAJA 3C9IA 4JYOX 1FJPA 2W6BA 1J1EC 4ZKUA 1FZAA 1RF0A 5AVXB 1FZBA 2J1GA 3NMDA 3A7OA 1RE4B 3HTKA 2H43B 2HPCB 4GIFA 1A02J 2Q7CA 4WY4A 4C7NB 1XTGB 2FYUK 1HGZA 2L5GB 1HGVA 1NKNA 1KFMA 5CHXA 1GZLA 2Q3IA 1LTSC 1KFNA 2O1JA 1FIDA 2WTYA 5CCHD 3N7NA 4ZKPA 1GL2D 1KILD 2CPSA 1NO4A 3TNUB 1FZGB 1RE4A 3RL0B 1N73C 2H43A 2J3FA 2HPCA 2N1TD 4O9BA 4C7NA 4JYBA 4LLHA 5AVUB 5AW1B 3SWYA 3H32C 1LTGC 1OXZA 3TSIA 3CI9A 2W6AA 2XDJA 1ZN5A 3MD0A 4I1LA 1NHLA 1HBWA 1L4AC 1FBMA 2FFDB 4JF7A 3TNUA 4EOTA 1FZGA 2D39A 1HWTC 1IK9A 4C46A 3EFGA 1LWUC 1XTCC 3VMZA 3EQ2A 4C7RA 4N6JA 3CL3D 3H32B 1NTMK 5KTBA 2YO3A 2I1KA 1NTKK 1X9VA 2FYZA 1G2CB 5APQA 3M9HA 3V4WA 1L4AB 2FFDA 5APWA 1HJBA 1AFOA 1JC9A 1NH4A 3MTUE 2HLOC 2POHA 3GHGC 1IFIA 1J1DB 1YYCA 1LTAC 1LWUB 1JNMA 1X79B 3HE5B 2WZ7A 3BATA 3H32A 2GM4A 1SQXK 2XU6A 1FZAC 1VPCA 2M8RA 4KHXA 3B5NC 1G2CA 3MIWA 5AVTB 1LTJB 2KLVA 1L4AA 1LTIC 1L0LK 2WSEH 2JHMF 2J58A 3WMM0 2HLOB 3GHGB 2W27A 3BASA 2P2UA 2KSJA 2ZFCA 1AQ5A 1LWUA 1FZFB 1NOHA 1QL2A 3HE5A 5CJ4A 1GW3A 1RF1B 3II6A 3T97A 2XV5A 3V2RA 1G1JA 3OJAB 1DX7A 4R9TA 2KP8A 2J61B 1LTJA 1RE4C 5AW9B 2H43C 2HPCC 1GU5A 3A2AA 2HLOA 1FOSF 1GD2E 1JTHB 3GHGA 1YTZI 4W7ZA 3E1IB 2E43A 1IC2A 1FZFA 1N86C 1T8ZA 3TK1A 1RF1A 2JJLA 1N7SC 1GW4A 1WT6A 3M0DA 1DH3A 3G3ZA 1EQ7A 5APXA 3MGNA 3MUDA 5CJ0A 2LKMA 1JY2P 3B5NA 1CZQA 2J61A 1ZLLA 3I5CA 1FZGC 5CMZA 3RL0C 5AW2B 1IFJA 3M9BA 5APSA 1JTHA 3E1IA 2VRSA 5CCGD 2NPSD 1N86B 2J0YA 1FU1A 3M91A 1CW5A 3V2PA 1N7SB 3M06A 1MFZA 1IFDA 2WWWA 2BASA 5KJ7A 3V5BA 1H89A 2FFDC 1JOCA 2N9BA 1URQB 4NYTA 2YKQA 1SFCD 5KLVK 2XKMA 1NU1K 1N86A 2A45G 1FZDA 2WNPF 4LGDE 1N7SA 1DEBA 2OARA 4EIJA 1ZR2A 3M9QA 5APYA 1JMMA 2C0WA 3RK3D 1HVVA 1MZ9A 3VYIA 4AUWA 2O1KA 2Q9IC 2E42A 1URQA 2HYNA 1W2EA 1J1DC 2QM7A 1J2JB 1M1JB 3HD7D 4GKGA 3PP5A 2WPRA 4JZCA 4IFFA 1FOSE 3U59A 5AVVB 2R32A 2J0GA 3L37A 3U1AA 4M7HA 2J3OA 1A02F 4RESB 3L35A 4Y99C 3A5TA 1LTJC 1FJKA 3U1CA 1GDTA 1T2KC 1ZR4A 2Q9IB 2KYVA 4XA4A 4N78E 3B8EB 1M1JA 1S9KE 3R2PA 1FDMA 1FZFC 2Q5UA 3V2NA 1T3JA 2KB7P 1JY2O 1RF1C 3NXSA 3M0DC 2HG5D 3P8CE 3HE4B 5AW7B 4WY4D 1Z3UA 2CPBA 1GL2B 3M0AA 1KILB 1NKZB 1MV8A 4ZFGA 4I2LC 4HYTB 2GY7A 2Z4EB 2Z5IA 4Y99B 1SFCB 2N1TB 4JYCA 2IFMA 2H7HA 3NTNA 3KPEA 2Q9IA 3VOPA 2QM8A 3VP8A 1IO4A 2P7JA 3E1IC 1JCDA 2WSCH 2R5BA 5APUA 3KDPB 5CCHA 2J3FD 4R9JA 3HE4A 1OWAA 5AVWB 2I1JA 1GL2A 3RK2D 1KILA 2OYIC 1JY3N 5KJ7C 3L36A 1LGHB 2N1TA 1FICA 2WT7B 1JY2N 2YO2A 2JHIF 1SQQK 3VN0A 5AVRB 1SQPK 3RL0D 3FIBA 5AW6B 1JY3P 1GK6A 2R5DA 3VTPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFD C;  2OYI B;  1LT9 B;  1LWU C;  4NYT A;  1LT9 C;  1RF0 C;  2Z4E A;  2FIB A;  3H32 B;  1FZB C;  1N86 A;  2J3G A;  2A45 G;  1FZD A;  2JHL F;  2WNP F;  1FZE A;  3HUS C;  2FFD A;  1JC9 A;  2XNX A;  1RE3 C;  2HLO C;  3BVH B;  3GHG C;  2J64 A;  4M7F A;  2OYI A;  2Q9I C;  1LT9 A;  1LWU B;  2JHH C;  1W2E A;  1M1J B;  1FZA B;  2J5Z A;  2J0H A;  1RF0 B;  3H32 A;  1M1J C;  1FZA C;  4JZC A;  1FZB B;  2OYH C;  2J0G A;  1FIB A;  2J60 A;  4M7H A;  2J3O A;  1FZC C;  1LTJ B;  2HOD C;  2J2P A;  3HUS B;  2JHM F;  3BVH A;  1LTJ C;  1RE3 B;  2HLO B;  4JYO X;  3GHG B;  2Q9I B;  1FZF B;  1LWU A;  1M1J A;  1RF1 B;  1FZA A;  1FZF C;  1RF0 A;  1JY2 O;  1RF1 C;  1FZB A;  2J1G A;  4R9T A;  1Z3U A;  2OYH B;  1RE4 B;  2JHK F;  2H43 B;  2HPC B;  2J61 B;  4ZFG A;  1LTJ A;  2GY7 A;  2Z4E B;  1RE4 C;  3HUS A;  1FZC B;  2HOD B;  2H43 C;  2HPC C;  1RE3 A;  2HLO A;  2Z4E C;  3GHG A;  3E1I B;  2Q9I A;  1FZF A;  1N86 C;  3E1I C;  1RF1 A;  1FID A;  1FZE C;  1JY3 O;  4EPU A;  1N73 B;  4R9J A;  2J3F D;  2J3U A;  2XNX C;  1FZG B;  1RE4 A;  1JY2 P;  2OYH A;  1N73 C;  2H43 A;  2J3F A;  2HPC A;  2OYI C;  2J61 A;  1JY3 N;  1FZG C;  1FZC A;  2HOD A;  2A45 I;  1FIC A;  2A45 H;  3E1I A;  3H32 C;  1Z3S A;  1JY2 N;  1N86 B;  2JHI F;  2J0Y A;  1FZE B;  1N73 A;  1T3U A;  3FIB A;  1JY3 P;  2FFD B;  3BVH C;  1FZG A;  2D39 A;  2XNX B; 
#chains in the Genus database with same CATH topology
 4AQR D;  1JCC A;  1S3J A;  4IFD K;  2JR8 A;  1LT9 B;  3L73 E;  5BU8 B;  2KOG A;  1X8Y A;  1NTM E;  2P10 A;  4IL6 X;  1EXJ A;  1VQN P;  1KMI Z;  1RE3 C;  2IPP A;  2OYI A;  5M1B A;  1S9K D;  2LXB A;  3SWK A;  4IFM A;  1AQT A;  2LR2 A;  3P8C D;  1JO5 A;  3BCC D;  3BRV B;  1YIT P;  4DOJ A;  3SFE C;  1L4A D;  3VMY A;  1OW7 A;  2JKV A;  1W5C E;  1J1E B;  5BU5 A;  1SQV K;  2H88 C;  1W2B O;  3OA7 A;  1KQL A;  3P7K A;  5GTH H;  4W7Y A;  3CXH I;  2JO1 A;  2OYH B;  1T2K D;  2JHK F;  3L75 G;  1NYH A;  1CI6 B;  1OX3 A;  3HUS A;  2HOD B;  3L75 J;  1SQQ G;  4RO0 A;  2Z4E C;  2MJZ A;  1IJD B;  2KXP B;  2KNC A;  1HF9 A;  3CCV P;  1ZP0 C;  2KZJ A;  3SWF A;  5AW8 B;  1HJ0 A;  1ZW0 A;  2FKW B;  2Y9Y A;  1AV1 A;  2H8P D;  2YMK A;  1FZE B;  4LC1 A;  2NPS A;  5KJ7 D;  1N73 A;  3L74 E;  3L71 E;  2C9L Y;  2OTJ P;  1KIL E;  1EC5 A;  2IYP A;  5KLV E;  3FX0 A;  1GTW A;  1G1I A;  1LT9 C;  2FIB A;  3H1L E;  1KC8 Q;  1D7M A;  1DD3 A;  1VDF A;  4WY4 C;  1H88 A;  3CC4 P;  2M3E A;  2HFE D;  3PHL A;  3L72 J;  4XE5 B;  1JUN A;  2ZYA A;  1FZA B;  1PGJ A;  2XZR A;  1EDJ A;  3H1K G;  1RF0 B;  2J59 M;  3HD7 A;  3H1K J;  1H8A A;  4AYC A;  1VQL P;  4JYO X;  1J1E C;  3NMD A;  2Q1K A;  3A7O A;  1ZRT D;  2BCC G;  4GIF A;  4C7N B;  1XTG B;  1NTK J;  1JMB A;  1LNQ A;  1EDK A;  2OTK E;  3IAO A;  1LTS C;  3PJS K;  4QMA A;  1KFN A;  2O1J A;  1FID A;  3N7N A;  1KYO E;  2ZYD A;  1VQ5 P;  2KK7 A;  3TNU B;  1SQX J;  3KXD A;  3L75 E;  5AVU B;  1SQQ E;  3CI9 A;  3TGU G;  1QLE D;  3CWB D;  1FBM A;  2IYO A;  2FFD B;  1KQS O;  4EOT A;  2D39 A;  1HWT C;  1XTC C;  1L0N G;  2YO3 A;  1NTK K;  2FYZ A;  3AE1 C;  1Q86 Q;  5TJH A;  3V4W A;  2IDB A;  1LWU B;  2QIW A;  1YI2 P;  3H32 A;  2GM4 A;  1SQX K;  3BCC J;  1FZA C;  4H0L B;  2M8R A;  1G2C A;  1BCC D;  2WSE H;  1L0L K;  2ZJS E;  3HE5 A;  5CJ4 A;  3II6 A;  3G4S P;  1IZN B;  1P84 D;  3H1K E;  4EDF A;  3L70 D;  1BDD A;  1R5L A;  2HLO A;  1FOS F;  1JTH B;  3GHG A;  4NPD A;  2JJL A;  1N7S C;  1BSH A;  4NPE A;  3O6Q A;  2QA4 P;  3B4S A;  2AXC A;  5GTH E;  2J61 A;  1ZLL A;  5CMZ A;  3CXH E;  5APS A;  2BCC E;  1RHZ B;  1ZME C;  1Y8A A;  5CCG D;  4U3F G;  2JDI H;  3M91 A;  3V2P A;  2WWW A;  1N8R Q;  3PTZ A;  2FFD C;  2WVR A;  1M1K Q;  1E79 H;  1JOC A;  2LXC B;  2P58 A;  5E79 H;  2UWJ E;  1SFC D;  1BE3 G;  4UB6 H;  1KQF B;  2QE7 H;  2WNP F;  4LGD E;  4EIJ A;  3A0B H;  3TGU E;  2O1K A;  1LP1 B;  2E42 A;  1OZH A;  1URQ A;  1M1J B;  4GKG A;  1X0T A;  3PP5 A;  2WPR A;  4JZC A;  1FOS E;  1L0N E;  5AVV B;  2R32 A;  2J0G A;  3L37 A;  4H0L C;  3U1A A;  3L35 A;  4Y99 C;  3MP7 B;  3A5T A;  4MN4 C;  3U1C A;  3H1J G;  1ZR4 A;  2WSE J;  2Q9I B;  1P84 I;  2KYV A;  1P84 H;  3B8E B;  1S9K E;  1T6A A;  3C8V A;  3NXS A;  3P8C E;  3HE4 B;  5AW7 B;  3BCC E;  1GL2 B;  1PZQ A;  5KAI H;  3GF7 A;  1M56 D;  2Z5I A;  2ZVN B;  3RL0 g;  3RBX A;  2QM8 A;  1IO4 A;  3WUV A;  2WSC H;  4BRY B;  5CCH A;  2J3F D;  1OWA A;  4TLF A;  2E74 B;  2I1J A;  1JM0 A;  5AVW B;  3RK2 D;  1KIL A;  2OYI C;  1YQ4 C;  1LGH B;  2WT7 B;  2ITA A;  5KAF E;  2NZ2 A;  2YO2 A;  3CWB G;  5AVR B;  1JY3 P;  3H1I G;  5CBN A;  2A06 D;  2IBZ D;  5AVQ B;  3V2Q A;  3CPW O;  5AVS B;  3PH0 A;  1RH5 B;  2JHL F;  3HUS C;  2GA1 A;  2WSF H;  2OQQ A;  2J0H A;  1M1J C;  4BXL A;  3KYQ A;  1MUU A;  2J60 A;  1BCC G;  1UII A;  1BCC J;  2E75 D;  1RE3 B;  5BVZ A;  3L72 D;  2M5A A;  1NTZ K;  3KZI E;  2FY8 A;  3USS A;  1HUC A;  4B86 A;  3GG2 A;  2NPS C;  2WIT A;  3LW5 H;  1YIJ P;  3L70 G;  1LTB C;  1GL2 C;  5B66 H;  4M3L A;  1SLQ A;  1JY3 O;  3B5N D;  3L4F A;  2RN0 A;  4N3Y B;  2WSC J;  3RGU A;  2E74 C;  4YTP C;  3RK3 C;  1YHQ P;  1FZC A;  1ZRT E;  2A45 I;  1LJ2 A;  1NTK D;  2A45 H;  3CX5 H;  3AEF C;  3AEA C;  5AW5 B;  2FXM A;  1Z3S A;  3HD7 C;  5AVY B;  2B87 A;  2WSS H;  3L71 G;  2R44 A;  1OW6 A;  1YJ9 P;  2C0X A;  2IBZ I;  1YJN P;  2M3B A;  1SQX D;  3HRN A;  2QG4 A;  1L0L D;  2WPQ A;  1VQK P;  4H13 C;  3CCS P;  1SQV J;  3CWB E;  2XNX A;  3VMX A;  2Z5H A;  4EI2 A;  2KUB A;  3CLQ A;  2O01 H;  2J5Z A;  1Z56 A;  2WSF J;  5E79 E;  4I7Z B;  2P67 A;  4WY4 B;  1GK4 A;  3G9R A;  3BVH A;  2WQY C;  2W6B A;  2NRG A;  1WMK A;  3CC2 P;  1FZB A;  2RMZ A;  2J1G A;  1RQU A;  1RE4 B;  3HTK A;  2H43 B;  4R4M A;  3LW5 J;  4GOF A;  2Q7C A;  1A02 J;  4JPZ B;  1BCC E;  1MKM A;  1NKN A;  2N9Y B;  1KFM A;  1Q2N A;  2PFX A;  1PL5 A;  4ZKP A;  1GL2 D;  3D70 A;  1P84 E;  3Q5P A;  2HPC A;  1PP9 J;  3L70 E;  4JYB A;  3AEG C;  4LLH A;  3OW2 O;  5AW1 B;  3SWY A;  3H32 C;  1OXZ A;  3MD0 A;  3GLM A;  2HR3 A;  2E74 D;  1NHL A;  1PGQ A;  3F89 A;  1FZG A;  2A06 G;  4C7R A;  3S4R A;  3M9H A;  1M90 Q;  1AFO A;  1NH4 A;  2HLO C;  3GHG C;  4UB8 H;  3CMA P;  3AE3 C;  2KS1 B;  2W6J H;  1KB9 H;  4L73 A;  3BAT A;  3T97 B;  1K04 A;  4JBZ A;  4RKU J;  2O01 J;  2O3J A;  4H44 C;  3MIW A;  5AVT B;  4I7Z C;  1LTJ B;  1L4A A;  2JHM F;  5TIS H;  1S4X A;  3L72 G;  1KD1 Q;  2K9J B;  1QL2 A;  4PJ0 E;  3V2R A;  1G1J A;  4L76 A;  4R9T A;  3CCJ P;  1RE4 C;  5AW9 B;  2H43 C;  1OVU A;  1GU5 A;  3E1I B;  1FZF A;  1RF1 A;  3M0D A;  1VQ7 P;  1EQ7 A;  1S2E A;  3AE4 C;  1H0T A;  1FDI A;  1JY2 P;  3GMA A;  3A0H E;  1NTK G;  5KKZ C;  4KT0 J;  3CCQ P;  2J0Y A;  1FU1 A;  1N7S B;  1OW8 A;  2AXT E;  4OWF A;  5KJ7 A;  3V5B A;  4Z1M H;  2L91 A;  4IL6 E;  1SQX G;  2N9B A;  3JCU E;  2XKM A;  1L0L G;  1NU1 K;  1R8E A;  1N86 A;  4Y28 J;  5L8R J;  1DEB A;  1L0L J;  5H2F H;  2K9Y A;  1EZV D;  1NTZ D;  2QJP B;  1JMM A;  2MKV A;  1DEE G;  1HVV A;  2HYN A;  1J2J B;  1OVV A;  2A06 E;  2IBZ E;  3U59 A;  2RKL A;  4M7H A;  2ZAE B;  4OGQ C;  1LTJ C;  1FJK A;  1SQP J;  2E5Y A;  4XA4 A;  2BEQ D;  3V2N A;  1T3J A;  2KB7 P;  1JY2 O;  2HG5 D;  3BCC G;  4WY4 D;  3MUD C;  1Z3U A;  1NKZ B;  1MV8 A;  4I2L C;  2GY7 A;  4Y99 B;  2N1T B;  2XND H;  2OGU A;  3VP8 A;  3E1I C;  3L72 E;  4R9J A;  3D6Y A;  1JY3 N;  1VQP P;  2ZYG A;  1FIC A;  1PPJ D;  1OVR A;  4WWI A;  4U7J A;  1SQP K;  5AW6 B;  3WUU A;  1GK6 A;  1NAY A;  3VTP C;  1M7L A;  2OYI B;  2G3A A;  3TF5 A;  1KN7 A;  4XFJ A;  4TT3 H;  1NTK E;  4R4L A;  1L0N K;  5APV A;  4DZO A;  1QL1 A;  1S5L H;  4HJG H;  1FC2 C;  4A7P A;  3CCM P;  1EZV I;  3QWO C;  2Y0D A;  2C9N Y;  1QEX A;  2V7Q H;  3FGA D;  2QJP C;  1LT9 A;  1E5W A;  2B89 A;  2FXP A;  1VL2 A;  2QJK C;  1SQX E;  3W67 A;  2K88 A;  2YMY A;  2W83 C;  1SVF A;  1NWQ A;  1SQB J;  1IFM A;  3O8Z A;  1L0L E;  1FZC C;  3HUS B;  1SQV D;  3P8M C;  3AEB C;  2KNC B;  1VQ8 P;  3AEE C;  2YKP A;  5AW4 B;  1LTT C;  2IX7 C;  5EFW B;  3WUT A;  1AVO A;  2N1T C;  5TIS E;  3AEC C;  1HTL C;  4EPU A;  2NPS B;  3IR9 A;  1N73 B;  1S5L X;  1YJW P;  3NFQ A;  2XNX C;  1GU4 A;  2OYH A;  1NJI Q;  3FXD A;  1YQ3 C;  1CI6 A;  2HOD A;  1SP4 A;  1SQB K;  2P1J A;  3I55 P;  2CK3 H;  3H25 A;  3AE8 C;  1BGY D;  4ZMD A;  2ZXE B;  5CCG A;  1AJY A;  3A3Y B;  4PV1 B;  1T3U A;  2D2C C;  2Y0C A;  3BVH C;  2YNY A;  1BDC A;  1PP9 D;  2YKO A;  2GUS A;  3RK3 B;  2Y9Z A;  2M0B A;  4GT1 A;  3RBZ A;  1ZV8 A;  1K05 A;  2K1A A;  1FZB C;  1SFC A;  1N7S D;  2FYU J;  3HD7 B;  1FZE A;  3CX5 D;  1DD4 A;  4HB1 A;  4WB4 A;  1X22 A;  3TYY A;  2J64 A;  4M7F A;  1NTZ J;  1NAF A;  4GOE A;  4HH2 A;  3WU2 H;  2ZVO B;  4WBA A;  3E7K A;  2YIU B;  1IFN A;  1HH0 A;  3LIE A;  3D71 A;  3V6I A;  4H13 B;  2J2P A;  5APT A;  3P32 A;  1KV4 A;  4BWN A;  1FZA A;  1AA0 A;  1RF0 A;  2DW3 A;  3L73 J;  1NTM J;  2FYU K;  3JSV C;  3K5B A;  1HGV A;  1RQV A;  1VQO P;  1GZL A;  1UIX A;  4RJT A;  2CPS A;  4H0L D;  1S72 P;  3RL0 B;  1N73 C;  2J3F A;  2O01 N;  2N1T D;  4C7N A;  1NU1 D;  4YXD C;  3AE7 C;  1PPJ G;  1Y47 A;  2BEZ F;  1M8O B;  2W6A A;  2XDJ A;  1ZN5 A;  1L4A C;  4GDO A;  3TNU A;  4PV1 C;  1IK9 A;  4C46 A;  3EFG A;  2I8D A;  4YPC A;  3VMZ A;  3EQ2 A;  4N6J A;  4IOI H;  3CL3 D;  3H32 B;  1NTM K;  3CX5 I;  5KTB A;  2I1K A;  3Q5S A;  1G2C B;  1VF5 B;  2QEX P;  2FFD A;  5APW A;  1HJB A;  1JC9 A;  1IFI A;  1J1D B;  1YYC A;  3GW6 A;  3HE5 B;  1EDL A;  2XU6 A;  1VPC A;  1IFP A;  2YIU C;  4KHX A;  2R3S A;  1K73 Q;  2KLV A;  3SFD C;  1LTI C;  1SQV G;  3H1H D;  1S5L E;  5DJU B;  2J58 A;  3WMM 0;  2HLO B;  2E76 B;  3GHG B;  2W27 A;  1EZV E;  3BAS A;  2P2U A;  1NTZ E;  2KSJ A;  2ZFC A;  1LWU A;  3L74 J;  1NOH A;  1VQM P;  1GW3 A;  2XV5 A;  1DX7 A;  3O6Q B;  1KB9 D;  2Q3E A;  4H44 B;  2KP8 A;  2J61 B;  3ABV C;  3H1L J;  2IZ0 A;  2Y0E A;  4UB6 E;  1YTZ I;  4PD4 D;  2E43 A;  1IC2 A;  1SQP D;  1N86 C;  1FE6 A;  1T8Z A;  3TK1 A;  1VQ6 P;  1DH3 A;  3A0B E;  1Y9B A;  5APX A;  2FYN C;  3MGN A;  1VQ9 P;  3B5N A;  1CZQ A;  1JB0 J;  3I5C A;  2AEF A;  3RL0 C;  1L0N D;  1IFJ A;  1OFC X;  1JTH A;  2VRS A;  2NPS D;  4ZNC A;  1BGY G;  1NVO A;  1OIP A;  3M06 A;  1MFZ A;  3QH9 A;  1IFD A;  1BGY J;  2K3R A;  2IZ1 A;  1PP9 G;  1URQ B;  5KKZ B;  5KLV K;  2KSE A;  1PPJ E;  3EWK A;  4PV1 D;  2A45 G;  1FZD A;  5KAI E;  3AE6 C;  3M9Q A;  1ZR2 A;  4DT0 A;  2YXQ B;  3TDK A;  1VF5 C;  2C0W A;  3RK3 D;  1QVF O;  3IN6 A;  3G6E P;  1U7M A;  1J1D C;  2QM7 A;  3HD7 D;  3CXH H;  2IBZ G;  2Q6Q A;  2W8Z A;  4K35 A;  2J3O A;  1A02 F;  1IK7 A;  4RES B;  1SQQ J;  4YXW H;  2FBW C;  1GDT A;  1LP1 A;  2AEM A;  3CCU P;  3E1R A;  2E76 C;  1M1J A;  1FDM A;  2Q5U A;  2KZI A;  1KB9 I;  3WU2 E;  5KLI C;  2G8Y A;  2JWA A;  1SQB D;  2CPB A;  1OMI A;  4H13 D;  3M0A A;  1KIL B;  4PD4 I;  2ZT9 B;  1SFC B;  4JYC A;  2IFM A;  4OGQ B;  4PD4 H;  4U3F D;  2QJY C;  2H7H A;  3NTN A;  3KPE A;  1SQV E;  2Q9I A;  3VOP A;  3AE5 C;  4GOD A;  2P7J A;  3Q1M A;  1JCD A;  3KDP B;  3HE4 A;  1GL2 A;  1FS0 E;  1NU1 G;  3L36 A;  1BE3 D;  1NU1 J;  3Q2Y A;  3JC2 2;  2JHI F;  1SQQ K;  4BRY A;  3RL0 D;  3FIB A;  1L2P A;  2R5D A;  4L74 A;  3PLN A;  1CSB A;  2GUV A;  2WT7 A;  1BSN A;  1URQ C;  1Q90 D;  2J3G A;  2IFN A;  2WMM A;  3AED C;  3FWN A;  3OAK A;  1N2D C;  3H1J D;  5B66 E;  1BGY E;  4N78 D;  1JEK A;  2M5A B;  3CME P;  2JHH C;  1PP9 E;  5CBO A;  2B88 A;  3ZDM A;  1VF5 D;  5AVZ B;  1TU3 F;  5KAF H;  2FYU D;  5AW3 B;  2OYH C;  3RK2 B;  2BCC J;  3IFM A;  3H1H G;  2HOD C;  3CX5 E;  3H1H J;  1Q81 Q;  3CC7 P;  1KZU B;  5CCG C;  2QJK B;  3R4Y A;  2ZXX A;  5AW0 B;  1YTZ T;  2K37 A;  5CCH C;  4D6T D;  5GTI H;  1FZC B;  2E76 D;  4OH8 B;  1KIL C;  1RE3 A;  1PV3 A;  1SQP G;  2ZT9 C;  1SFC C;  3FWL A;  4JQ0 D;  3TGU J;  2B87 B;  1FZE C;  3H1I D;  5DJT B;  2J5U A;  3BRT B;  1QGK B;  4H44 D;  1AVY A;  3V4Q A;  2J3U A;  2JEE A;  3L73 D;  1QVG O;  1VQ4 P;  3SSU A;  2R3C A;  2PP6 A;  1NTM D;  1RY3 A;  1WRG A;  1L0N J;  1FAV A;  1MFT A;  1N7L A;  1EXI A;  3KZI H;  3VP9 A;  4L75 A;  2E75 B;  2XNX B;  3UIA A;  1K9M Q;  3AE2 C;  1RF0 C;  2Z4E A;  1NU1 E;  3D6Z A;  4KJM A;  2JP3 A;  3N4X A;  3KQG A;  2D2C B;  3BVH B;  1QX8 A;  4I6M C;  1URQ D;  1PIX A;  3KHU A;  2PRR A;  5B5E H;  3B5N B;  3H6P A;  1FZB B;  2QSI A;  3F5H A;  1R5S A;  1FIB A;  2QRX A;  4WVZ A;  1PFI A;  3HTK B;  3LID A;  2WPS A;  3RK2 C;  2B9B A;  4W80 A;  2PAJ A;  3C9I A;  4EYY Q;  1FJP A;  3CD6 P;  4ZKU A;  3G71 P;  2W90 A;  2YXR B;  1USE A;  5AVX B;  1SQB G;  1GMJ A;  1U7J A;  2HPC B;  2JWD A;  4WY4 A;  4CPG A;  1HGZ A;  2L5G B;  3H1H E;  5CHX A;  4U3F J;  3CCR P;  2Q3I A;  3L74 D;  5CCH D;  3L71 D;  2WTY A;  3EFF K;  4DCK A;  4DJG A;  3W68 A;  1KIL D;  1NO4 A;  1KQG B;  1FZG B;  1RE4 A;  4UB8 E;  2H43 A;  2ZT9 D;  3GF3 A;  5KLV D;  4O9B A;  4OGQ D;  3Q5R A;  1KB9 E;  1M57 D;  3H1L D;  1BE3 J;  1PGP A;  2H89 C;  1LTG C;  3TSI A;  3C1L A;  2KIK A;  4PD4 E;  1SQP E;  4I1L A;  1HBW A;  2RH0 A;  4JF7 A;  1ZOY C;  1Q7Y Q;  1USD A;  2E75 C;  1LWU C;  1FDO A;  1X9V A;  3MZW B;  5C39 A;  5APQ A;  1L4A B;  2V4H A;  3PRJ A;  3MTU E;  2POH A;  3H1J J;  4NPF X;  1LTA C;  1JNM A;  1X79 B;  1YBK A;  2WZ7 A;  3CCL P;  1NGM B;  2FYU G;  3B5N C;  1EZV G;  1NTZ G;  3AE9 C;  1FZF B;  1AQ5 A;  2KS1 A;  3RK3 E;  1KYO D;  1RF1 B;  3T97 A;  5K5G B;  1S1C X;  3Q3D A;  2V7Q J;  3OJA B;  1H0T B;  1PGO A;  4D6T G;  3L75 D;  1LTJ A;  4D6T J;  2HPC C;  3A2A A;  1SQQ D;  1GD2 E;  4W7Z A;  3B71 A;  2K9J A;  2PGD A;  3I56 P;  5H2F E;  3CWB J;  1GW4 A;  1WT6 A;  3G3Z A;  3MUD A;  1EDI A;  3H1I J;  5CJ0 A;  3L73 G;  2LKM A;  1NTM G;  1FZG C;  1SQB E;  5AW2 B;  3M9B A;  2QVA A;  3E1I A;  5GTI E;  3FXE A;  4U3F E;  1N86 B;  1CW5 A;  1ZXG A;  2FYN B;  2BAS A;  4PJ0 H;  1KOR A;  1H89 A;  4NYT A;  2YKQ A;  3IF4 A;  4OVN F;  1BE3 E;  2FXO A;  3S1K A;  1Q82 Q;  1N7S A;  2OAR A;  2OTL P;  1U57 A;  2E5T A;  5APY A;  3ITK A;  1MZ9 A;  2SPZ A;  3VYI A;  4AUW A;  2Q9I C;  1W2E A;  3A0H H;  3S9O A;  3H1K D;  4IFF A;  3L70 J;  2D2C D;  2KI7 B;  2AXT H;  3VMA A;  3H1J E;  1T2K C;  1KYO I;  1KYO H;  1K8A Q;  4IL6 H;  4N78 E;  3R2P A;  1FZF C;  1RF1 C;  3M0D C;  3JCU H;  5B5E E;  3CXH D;  3CCE P;  2BCC D;  4ZFG A;  2FYU E;  4HYT B;  2Z4E B;  2KLU A;  2OYO A;  4ASW A;  1KTM A;  1SS1 A;  3L74 G;  2R5B A;  4HKZ H;  5APU A;  3L71 J;  5KLI B;  4ASV A;  5KLV G;  4K3A A;  5KJ7 C;  5KLV J;  3H1L G;  2N1T A;  4D6T E;  2AEJ A;  1LT1 A;  1JY2 N;  2QJY B;  2WPV B;  3MHV A;  3VN0 A;  3TGU D;  3H1I E;  1DIP A; 
#chains in the Genus database with same CATH homology
 1M7L A;  4AQR D;  1JCC A;  2OYI B;  1CSB A;  4IFD K;  2GUV A;  1LT9 B;  5BU8 B;  2KOG A;  5AVQ B;  2WT7 A;  1X8Y A;  3V2Q A;  1URQ C;  1L0N K;  5APV A;  5AVS B;  4DZO A;  1QL1 A;  2J3G A;  2JHL F;  2IFN A;  3OAK A;  1N2D C;  3HUS C;  2C9N Y;  1RE3 C;  4N78 D;  2IPP A;  2OYI A;  1S9K D;  1LT9 A;  1E5W A;  2JHH C;  2WSF H;  4IFM A;  3P8C D;  1JO5 A;  2J0H A;  2YMY A;  1M1J C;  1SVF A;  1NWQ A;  3BRV B;  3KYQ A;  5AVZ B;  4DOJ A;  1IFM A;  1MUU A;  2OYH C;  5AW3 B;  3RK2 B;  1L4A D;  3IFM A;  3VMY A;  2J60 A;  3O8Z A;  1FZC C;  2HOD C;  3HUS B;  1J1E B;  5BU5 A;  1RE3 B;  1SQV K;  3P8M C;  5BVZ A;  3OA7 A;  1KZU B;  1KQL A;  1NTZ K;  1HUC A;  4B86 A;  5CCG C;  2NPS C;  2WIT A;  3P7K A;  4W7Y A;  3LW5 H;  2OYH B;  1LTB C;  5AW0 B;  1YTZ T;  5CCH C;  1T2K D;  2JHK F;  2YKP A;  1CI6 B;  1GL2 C;  3HUS A;  5AW4 B;  1FZC B;  2HOD B;  4OH8 B;  1KIL C;  1LTT C;  2IX7 C;  1RE3 A;  2Z4E C;  1SFC C;  2N1T C;  2MJZ A;  1IJD B;  4M3L A;  1SLQ A;  1FZE C;  1JY3 O;  1HTL C;  4EPU A;  2NPS B;  3IR9 A;  3B5N D;  3BRT B;  3SWF A;  1N73 B;  3L4F A;  5AW8 B;  3NFQ A;  3V4Q A;  2J3U A;  2XNX C;  2JEE A;  1GU4 A;  4N3Y B;  2OYH A;  2R3C A;  2PP6 A;  1CI6 A;  3RK3 C;  1FZC A;  2HOD A;  1SP4 A;  2A45 I;  1RY3 A;  2FKW B;  1SQB K;  2A45 H;  1WRG A;  2P1J A;  5AW5 B;  2H8P D;  2FXM A;  1Z3S A;  3HD7 C;  5AVY B;  1FAV A;  1N7L A;  1FZE B;  4LC1 A;  5CCG A;  2ZXE B;  2NPS A;  3A3Y B;  5KJ7 D;  1N73 A;  1T3U A;  3VP9 A;  3BVH C;  2C9L Y;  2YNY A;  2XNX B;  2C0X A;  3UIA A;  2M3B A;  2YKO A;  2GUS A;  3RK3 B;  3HRN A;  4GT1 A;  1GTW A;  1ZV8 A;  1G1I A;  1LT9 C;  1RF0 C;  2Z4E A;  2FIB A;  1FZB C;  1SFC A;  1N7S D;  3HD7 B;  1FZE A;  2WPQ A;  1VDF A;  4WY4 C;  4WB4 A;  1H88 A;  3N4X A;  2HFE D;  3KQG A;  2XNX A;  3TYY A;  4I6M C;  3VMX A;  3BVH B;  2J64 A;  1URQ D;  4M7F A;  1NAF A;  2Z5H A;  4HH2 A;  4XE5 B;  1JUN A;  4WBA A;  1FZA B;  2XZR A;  2O01 H;  3CLQ A;  2J5Z A;  1RF0 B;  1Z56 A;  2J59 M;  3B5N B;  3H6P A;  3HD7 A;  1FZB B;  1IFN A;  1HH0 A;  1FIB A;  1PFI A;  3HTK B;  3LIE A;  3LID A;  2P67 A;  1H8A A;  4WY4 B;  1GK4 A;  2WPS A;  2J2P A;  3RK2 C;  4AYC A;  5APT A;  4W80 A;  3BVH A;  3P32 A;  2PAJ A;  3C9I A;  4JYO X;  1FJP A;  2W6B A;  1J1E C;  4ZKU A;  1FZA A;  1RF0 A;  5AVX B;  1FZB A;  2J1G A;  3NMD A;  3A7O A;  1RE4 B;  3HTK A;  2H43 B;  2HPC B;  4GIF A;  1A02 J;  2Q7C A;  4WY4 A;  4C7N B;  1XTG B;  2FYU K;  1HGZ A;  2L5G B;  1HGV A;  1NKN A;  1KFM A;  5CHX A;  1GZL A;  2Q3I A;  1LTS C;  1KFN A;  2O1J A;  1FID A;  2WTY A;  5CCH D;  3N7N A;  4ZKP A;  1GL2 D;  1KIL D;  2CPS A;  1NO4 A;  3TNU B;  1FZG B;  1RE4 A;  3RL0 B;  1N73 C;  2H43 A;  2J3F A;  2HPC A;  2N1T D;  4O9B A;  4C7N A;  4JYB A;  4LLH A;  5AVU B;  5AW1 B;  3SWY A;  3H32 C;  1LTG C;  1OXZ A;  3TSI A;  3CI9 A;  2W6A A;  2XDJ A;  1ZN5 A;  3MD0 A;  4I1L A;  1NHL A;  1HBW A;  1L4A C;  1FBM A;  2FFD B;  4JF7 A;  3TNU A;  4EOT A;  1FZG A;  2D39 A;  1HWT C;  1IK9 A;  4C46 A;  3EFG A;  1LWU C;  1XTC C;  3VMZ A;  3EQ2 A;  4C7R A;  4N6J A;  3CL3 D;  3H32 B;  1NTM K;  5KTB A;  2YO3 A;  2I1K A;  1NTK K;  1X9V A;  2FYZ A;  1G2C B;  5APQ A;  3M9H A;  3V4W A;  1L4A B;  2FFD A;  5APW A;  1HJB A;  1AFO A;  1JC9 A;  1NH4 A;  3MTU E;  2HLO C;  2POH A;  3GHG C;  1IFI A;  1J1D B;  1YYC A;  1LTA C;  1LWU B;  1JNM A;  1X79 B;  3HE5 B;  2WZ7 A;  3BAT A;  3H32 A;  2GM4 A;  1SQX K;  2XU6 A;  1FZA C;  1VPC A;  2M8R A;  4KHX A;  3B5N C;  1G2C A;  3MIW A;  5AVT B;  1LTJ B;  2KLV A;  1L4A A;  1LTI C;  1L0L K;  2WSE H;  2JHM F;  2J58 A;  3WMM 0;  2HLO B;  3GHG B;  2W27 A;  3BAS A;  2P2U A;  2KSJ A;  2ZFC A;  1AQ5 A;  1LWU A;  1FZF B;  1NOH A;  1QL2 A;  3HE5 A;  5CJ4 A;  1GW3 A;  1RF1 B;  3II6 A;  3T97 A;  2XV5 A;  3V2R A;  1G1J A;  3OJA B;  1DX7 A;  4R9T A;  2KP8 A;  2J61 B;  1LTJ A;  1RE4 C;  5AW9 B;  2H43 C;  2HPC C;  1GU5 A;  3A2A A;  2HLO A;  1FOS F;  1GD2 E;  1JTH B;  3GHG A;  1YTZ I;  4W7Z A;  3E1I B;  2E43 A;  1IC2 A;  1FZF A;  1N86 C;  1T8Z A;  3TK1 A;  1RF1 A;  2JJL A;  1N7S C;  1GW4 A;  1WT6 A;  3M0D A;  1DH3 A;  3G3Z A;  1EQ7 A;  5APX A;  3MGN A;  3MUD A;  5CJ0 A;  2LKM A;  1JY2 P;  3B5N A;  1CZQ A;  2J61 A;  1ZLL A;  3I5C A;  1FZG C;  5CMZ A;  3RL0 C;  5AW2 B;  1IFJ A;  3M9B A;  5APS A;  1JTH A;  3E1I A;  2VRS A;  5CCG D;  2NPS D;  1N86 B;  2J0Y A;  1FU1 A;  3M91 A;  1CW5 A;  3V2P A;  1N7S B;  3M06 A;  1MFZ A;  1IFD A;  2WWW A;  2BAS A;  5KJ7 A;  3V5B A;  1H89 A;  2FFD C;  1JOC A;  2N9B A;  1URQ B;  4NYT A;  2YKQ A;  1SFC D;  5KLV K;  2XKM A;  1NU1 K;  1N86 A;  2A45 G;  1FZD A;  2WNP F;  4LGD E;  1N7S A;  1DEB A;  2OAR A;  4EIJ A;  1ZR2 A;  3M9Q A;  5APY A;  1JMM A;  2C0W A;  3RK3 D;  1HVV A;  1MZ9 A;  3VYI A;  4AUW A;  2O1K A;  2Q9I C;  2E42 A;  1URQ A;  2HYN A;  1W2E A;  1J1D C;  2QM7 A;  1J2J B;  1M1J B;  3HD7 D;  4GKG A;  3PP5 A;  2WPR A;  4JZC A;  4IFF A;  1FOS E;  3U59 A;  5AVV B;  2R32 A;  2J0G A;  3L37 A;  3U1A A;  4M7H A;  2J3O A;  1A02 F;  4RES B;  3L35 A;  4Y99 C;  3A5T A;  1LTJ C;  1FJK A;  3U1C A;  1GDT A;  1T2K C;  1ZR4 A;  2Q9I B;  2KYV A;  4XA4 A;  4N78 E;  3B8E B;  1M1J A;  1S9K E;  3R2P A;  1FDM A;  1FZF C;  2Q5U A;  3V2N A;  1T3J A;  2KB7 P;  1JY2 O;  1RF1 C;  3NXS A;  3M0D C;  2HG5 D;  3P8C E;  3HE4 B;  5AW7 B;  4WY4 D;  1Z3U A;  2CPB A;  1GL2 B;  3M0A A;  1KIL B;  1NKZ B;  1MV8 A;  4ZFG A;  4I2L C;  4HYT B;  2GY7 A;  2Z4E B;  2Z5I A;  4Y99 B;  1SFC B;  2N1T B;  4JYC A;  2IFM A;  2H7H A;  3NTN A;  3KPE A;  2Q9I A;  3VOP A;  2QM8 A;  3VP8 A;  1IO4 A;  2P7J A;  3E1I C;  1JCD A;  2WSC H;  2R5B A;  5APU A;  3KDP B;  5CCH A;  2J3F D;  4R9J A;  3HE4 A;  1OWA A;  5AVW B;  2I1J A;  1GL2 A;  3RK2 D;  1KIL A;  2OYI C;  1JY3 N;  5KJ7 C;  3L36 A;  1LGH B;  2N1T A;  1FIC A;  2WT7 B;  1JY2 N;  2YO2 A;  2JHI F;  1SQQ K;  3VN0 A;  5AVR B;  1SQP K;  3RL0 D;  3FIB A;  5AW6 B;  1JY3 P;  1GK6 A;  2R5D A;  3VTP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...