2OYIB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
NSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 93
structure length 301
sequence length 301
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiB03
2J5ZA 1FZGA 3HUSA 2OYIC 2A45G 3E1IC 1LTJB 4NYTA 2J3OA 1JY3P 1N73C 2J0GA 3GHGB 1FZAB 1FICA 4R9JA 1FIBA 1FZFC 2A45H 2D39A 2J61B 2Q9IA 3E1IB 2OYIA 3E1IA 2HPCC 2JHKF 1N73B 1JY2N 1FZGB 2Q9IC 1N73A 1LT9C 2GY7A 1FZCA 1FZFB 1JY3N 1N86C 1Z3SA 2XNXC 1FZFA 1FZCC 1FZDA 3H32C 2HPCB 1FZEC 2Q9IB 2HPCA 3BVHC 2J60A 1FIDA 1LT9B 2OYIB 2J0YA 2J3UA 1LT9A 1LWUA 2H43C 2JHLF 1N86B 2XNXB 1FZCB 2HODC 3FIBA 4M7FA 3H32B 1N86A 2XNXA 1RE3C 1LWUC 3H32A 3BVHB 1RF0C 1FZEA 2J64A 3BVHA 1M1JC 1W2EA 2OYHC 2JHMF 4R9TA 2HLOC 2J3FA 1RF1C 2H43A 2HODB 1FZBC 2FIBA 2WNPF 1RE3B 1LWUB 1RE4C 2HODA 1JY2O 1RE3A 1T3UA 2FFDA 4JZCA 1M1JB 1RF0A 2Z4EA 4EPUA 4ZFGA 2JHIF 1LTJA 2OYHB 1M1JA 1FZEB 1FZGC 3HUSC 2FFDC 1JY3O 2HLOB 1RF1B 2OYHA 2J0HA 2J2PA 1FZBB 2Z4EC 1Z3UA 4JYOX 3GHGA 2HLOA 1RF1A 1LTJC 1RE4B 1FZBA 1FZAA 1JC9A 4M7HA 2J3FD 2J3GA 2A45I 1RE4A 2H43B 2J1GA 3GHGC 2J61A 1FZAC 1JY2P 3HUSB 2FFDB 2Z4EB 2JHHC 1RF0B
chains in the Genus database with same CATH superfamily
3RL0g 1SFCC 1KYOE 2J3OA 3N4XA 3CD6P 1FS0E 1SQBE 1KD1Q 4U7JA 1FU1A 1FICA 5DJUB 3V4WA 4Y99B 4I1LA 1SFCD 2K1AA 2Q9IA 1H8AA 4CPGA 3CPWO 3M9HA 1FJKA 5AVSB 3S9OA 2JHKF 1SQBK 2FYUJ 3RL0C 3Q5PA 1S9KD 2IX7C 2E5TA 1IFJA 4BRYB 2ZXXA 2KNCA 2GUSA 1HGVA 2PRRA 1GU4A 1SQBG 3WUTA 3RL0D 2BCCJ 2ZVNB 1NTZK 1PP9E 2I1JA 2QM8A 5CCGA 2Y9ZA 2XNXA 3B4SA 3TGUD 3Q5RA 3CWBE 3CXHE 1KN7A 1N7SC 3L71D 4PD4E 3K5BA 1N2DC 2HODB 2RN0A 2AEMA 3CCQP 1RQUA 1RE3B 1ZR2A 1OW7A 2WPQA 1PFIA 1PP9G 1N7SD 1YIJP 2W6AA 2WSCH 2FFDC 2HLOB 4JYOX 3ZDMA 3KZIH 2XU6A 3CWBG 1AQ5A 1GK6A 1DIPA 3CCSP 1ZLLA 2IFMA 3HUSB 2Z4EB 4NYTA 1AA0A 3Q3DA 3T97B 2WSEH 1K05A 1SQBJ 2A45H 2HG5D 2N1TC 5AVZB 1YHQP 2E74B 3MGNA 3L72D 2RH0A 2WWWA 2BEQD 3VMYA 1X22A 2N1TD 2P10A 1N7LA 1NTZJ 4GKGA 2CK3H 1NU1D 2PFXA 4XE5B 1NH4A 2KI7B 1BSHA 3D6YA 1GL2B 1PP9J 1S3JA 3A0HE 2KLVA 4HYTB 2IYPA 1EZVD 3SWKA 1QVFO 3MUDA 1KZUB 2JHMF 2NPSB 4R9TA 1IK7A 1DD4A 3AECC 4BXLA 2YO3A 1AJYA 5B66H 3PH0A 1VPCA 5KAFH 1WMKA 1FZGC 2XKMA 1BSNA 3CLQA 2AEFA 3P32A 3H1HD 1T3JA 1LP1B 3RK2C 1L4AC 4YPCA 5B5EE 4NPDA 1RF0B 1OFCX 2PGDA 1Q7YQ 4OVNF 2J5ZA 1SQPD 1JMBA 3EFGA 4HH2A 2IPPA 1ZW0A 3AE9C 4EDFA 3S4RA 3RK2D 1L4AD 5AVXB 2C0XA 1FIBA 1HWTC 1NKNA 2AEJA 1BGYE 1FOSE 1IFIA 3HTKA 2FXMA 2Q9IC 4PJ0H 1NU1K 3BCCE 2KNCB 1YJWP 3H32C 1Y9BA 2O1JA 5CHXA 1N8RQ 1AV1A 3LW5J 2J3UA 3L71J 1VF5B 2J5UA 1LT9A 1BGYG 3MZWB 2XNXB 3VYIA 5KKZC 1FZCB 1JTHA 2YIUB 5CCGC 2N9BA 3MP7B 3BCCG 3C8VA 5CCGD 3ITKA 1PZQA 1L0NE 1YBKA 1LTJA 2FY8A 3P8CD 1JY3O 2KIKA 3SFEC 4WY4B 1KILB 1RE4A 2L5GB 3H1LD 2Q3EA 4IL6X 3L72J 1P84D 1BDDA 1L0LE 4EYYQ 4MN4C 1H0TB 2J58A 1L0NG 2A06E 5AW4B 3B5NB 4ZNCA 5CMZA 4H0LB 1KQLA 2QEXP 1L0LK 1NU1J 1T6AA 2QRXA 3CMAP 1MFZA 3CCMP 2Y0EA 2KLUA 2YKQA 4OGQC 4D6TE 2K9YA 1OZHA 3D71A 1L0LG 3CCVP 1FZDA 3IR9A 3RK3B 5BU5A 1HJBA 2A06G 2W90A 3NFQA 3V2NA 2C9NY 4OGQD 1HTLC 2ZYDA 1QLED 2FXPA 5H2FE 4Z1MH 3BATA 2YKOA 2OYHC 4D6TG 3H1HJ 2E75C 4U3FD 1MKMA 3BRTB 2O3JA 1LT1A 2V4HA 1YITP 4W80A 1FZEB 2E75D 2J0HA 2E76C 1N7SA 2IBZI 2RKLA 3MTUE 3PTZA 3L73E 1KILE 2A45I 2KSJA 1GMJA 3C1LA 1LTGC 1HJ0A 3VP9A 3JCUE 2LR2A 3L74E 2E76D 5AW9B 2OYIC 4GT1A 1NTMD 4I6MC 1KFNA 3CXHH 1MFTA 2QJYB 2R5DA 1L0LJ 4PD4H 3M9QA 1FZFC 1RQVA 5KJ7A 3L73G 3N7NA 3M0DC 1QX8A 4O9BA 3HTKB 2D2CB 3CX5E 1J1DB 3H1IE 2M5AA 5E79E 4OH8B 3VP8A 3FXDA 3L74G 5GTHE 1Z3SA 1BCCD 2N1TA 4JYCA 3RBZA 2KP8A 1VL2A 2B87B 1LT9B 2NRGA 4PV1B 1NWQA 2YXRB 3O8ZA 1SP4A 1KV4A 1JTHB 3AE8C 2KS1B 4IFMA 4ASWA 1W5CE 3H1IG 2OTLP 4UB6E 1LTTC 2R3CA 2BCCE 2GA1A 2K88A 1PL5A 2GUVA 1IFMA 4C46A 3H1LJ 1JEKA 5APSA 3OA7A 2JHIF 2H89C 2L91A 2FKWB 1X8YA 4KJMA 2ZYAA 1LTJC 1RE4B 2SPZA 2HFED 2WPVB 1HF9A 3PHLA 1GD2E 3FGAD 4N78D 3A0HH 4I2LC 2CPBA 1FZGA 2ZXEB 5APQA 5BVZA 1KC8Q 1SQVD 3II6A 3EWKA 2E42A 1SFCB 4WB4A 1VQLP 1EC5A 3CCRP 4ZKUA 2ZAEB 1JY2N 5AW6B 4H13D 2QM7A 3H1IJ 1D7MA 1EDKA 4LGDE 3NXSA 1URQC 2ZVOB 3CXHD 1U7MA 2QE7H 3TNUB 5B5EH 1M7LA 3RL0B 2Q3IA 1S5LH 4U3FJ 5TJHA 1URQD 2FYZA 1OXZA 3CCJP 3H32A 3CCEP 1FC2C 3AE4C 1NTZE 1FOSF 1NTKD 3IAOA 3L36A 3H1KD 3VMXA 4Y99C 1G1JA 1SQXD 3P8MC 1KB9H 1E5WA 1NO4A 3PRJA 1X9VA 2YXQB 1PPJE 1NTZG 1BE3D 1ZN5A 2WSFJ 2H43B 2JP3A 1ZP0C 4JF7A 3AEDC 3SFDC 4JBZA 2FFDB 4QMAA 1EDLA 1JY3P 1N73C 4R4MA 1YTZT 3H1JD 1DD3A 1BCCJ 4WWIA 1NYHA 3HD7B 3HE4A 1PPJG 1OWAA 3VN0A 3CC4P 3IN6A 4H44C 5KJ7C 1S9KE 2N1TB 1S72P 1N86C 2ZT9C 3V2PA 1Y47A 4H44D 5KJ7D 1FIDA 3G3ZA 2FYNB 1Q90D 2M8RA 4EOTA 3WMM0 2ZT9D 2Q7CA 2NZ2A 1VQPP 3A0BE 3D6ZA 4DJGA 3L71E 1SQXK 3AEAC 4RESB 3H6PA 2FIBA 4JZCA 2C9LY 2GM4A 2OYOA 1K73Q 3CXHI 2OYHA 4PD4I 3RBXA 3GF7A 3GHGA 2N9YB 1FZAA 3TGUG 2YMYA 2J1GA 2JEEA 2QSIA 2J61A 2WT7A 3L71G 5H2FH 3L70D 3E1IC 4C7NA 1KB9D 1AVYA 2QJPC 3RK2B 1L4AB 3L75D 3TDKA 5GTIH 2OYIA 3L72E 1DEBA 3JC22 1HVVA 3CL3D 5AVQB 1RY3A 1FZFA 1U7JA 3M0DA 1NU1E 2O01H 2Q9IB 4HB1A 2KB7P 2V7QJ 3LIEA 1GW3A 2KXPB 1NTKJ 2G3AA 3S1KA 3WU2E 1JCDA 3FX0A 3H32B 3L72G 3AEFC 1RF0C 1SQXJ 1EZVE 1CI6A 1DX7A 3HRNA 3TGUJ 4UB8E 2IBZD 3CX5H 5KKZB 1SQQD 1BE3J 1NU1G 5E79H 5AW1B 3R4YA 1Q81Q 3OW2O 3SWYA 5GTHH 4RO0A 1SVFA 1CSBA 3BRVB 3U59A 3H1HE 1OX3A 1AVOA 1EZVG 5KLVD 1ZXGA 2JDIH 1IZNB 1LTIC 3AEEC 1SQPE 1YYCA 1ZRTD 4EI2A 4UB6H 1IK9A 5L8RJ 2HYNA 2QG4A 1SQPK 2POHA 3H1HG 2B9BA 2P2UA 2HPCC 5K5GB 1EDIA 3Q1MA 2IZ0A 3CCUP 1K04A 1GW4A 1WRGA 1VQ4P 2IDBA 2QIWA 1SQPG 5APXA 4BWNA 1VQ6P 3TF5A 4N3YB 1MUUA 4I7ZB 1LWUA 3O6QA 5AW8B 3QWOC 1KB9I 1URQA 4JYBA 1SQQK 1EXIA 1M1JC 2YNYA 2J3FA 1RF1C 5AVYB 1JOCA 4DOJA 2QJKC 1KYOH 3TSIA 5AVTB 4H0LC 5AVRB 1IJDB 2MJZA 2OYHB 1YI2P 3IFMA 4IL6E 3P8CE 5APUA 2E75B 1Z3UA 2WPRA 2BEZF 3A2AA 2WT7B 4GODA 4H0LD 3GHGC 3CMEP 1FZAC 3H1LE 3V2QA 1IFNA 1J2JB 2E76B 1FBMA 3E7KA 5AVUB 1P84E 1ZMEC 1GZLA 1IO4A 1HBWA 5B66E 3AE3C 4RKUJ 4XFJA 1QL1A 4BRYA 1MV8A 1SQPJ 3RK3D 4R9JA 4DT0A 3SWFA 2WSCJ 2FYUD 1OVRA 2Z5HA 1OW8A 2WSSH 2OTKE 3H1LG 1N73A 2ZYGA 1FZFB 1A02J 3VOPA 1ZV8A 3C9IA 2BCCD 4L76A 2UWJE 2QA4P 1VQ9P 1FZEC 3PJSK 3BVHC 3KXDA 2HR3A 1HGZA 1BDCA 2OARA 2WSEJ 5CJ0A 1SQQJ 5BU8B 1R8EA 2E5YA 3CC2P 1N86A 1EQ7A 2MKVA 1TU3F 1M56D 3L35A 3I5CA 2QJYC 4TLFA 4U3FE 1J1EC 4A7PA 4WBAA 5TISE 3VTPC 2Z4EA 1NKZB 1LJ2A 3L4FA 3T97A 2IYOA 1T8ZA 1AFOA 2KSEA 2XNDH 3CCLP 1YJ9P 3M06A 5KLIC 1DEEG 1UIIA 4GDOA 4U3FG 1KYOD 3A0BH 1LTJB 1KQGB 1NTME 1EXJA 2J0GA 3CI9A 1SQBD 2JKVA 1KMIZ 2JWAA 3VMAA 3LW5H 4C7RA 1KFMA 2D39A 1XTGB 1NTMK 1NJIQ 1USEA 3E1IA 4W7ZA 3A3YB 4K3AA 2R32A 2J59M 2DW3A 1ZOYC 2Q6QA 1WT6A 1BCCE 1NTMG 4H13C 3CX5I 1W2BO 1GU5A 1L2PA 1PP9D 2Y9YA 1URQB 2QVAA 1KQSO 1OVVA 1LWUC 5AW7B 1S2EA 3CWBD 3GW6A 3SSUA 2FXOA 2BASA 4PD4D 1IFDA 5EFWB 1BCCG 1LP1A 1M1KQ 1FZBC 5APYA 1E79H 1RF0A 3KHUA 4ZFGA 4JPZB 3G71P 2KOGA 3G4SP 4YXDC 2J3FD 3WU2H 4HJGH 2OTJP 4N78E 1FJPA 2P7JA 2JHHC 2O01N 3QH9A 1PGJA 2G8YA 1N7SB 1NVOA 4UB8H 3P7KA 2M3EA 1NTMJ 1SQVE 2YMKA 2JJLA 3PLNA 2C0WA 3FWLA 3AE6C 3AE2C 1N73B 5M1BA 1H89A 3W67A 1FZCA 1SQVK 1OVUA 1JY3N 1X0TA 2WQYC 1CW5A 2W6JH 4H44B 2HPCA 2J0YA 2H8PD 5AW2B 1OW6A 1SQVG 1KYOI 3FXEA 2H43C 2M5AB 1N86B 2ZT9B 2HODC 1S1CX 1M8OB 2XDJA 1RE3C 3OAKA 4L74A 5APTA 2WTYA 4WY4A 1KILA 1NTKE 2HLOC 1Q82Q 3H1KE 2JR8A 2KUBA 1A02F 2CPSA 1GDTA 4EPUA 3HD7C 4AQRD 1SQXE 1VQ5P 1M1JA 1NTKK 3TGUE 3HUSC 3ABVC 2Z4EC 2XZRA 1H0TA 2KYVA 1H88A 1RF1A 1QGKB 4GIFA 1BE3E 1U57A 3HD7D 3B5NA 1X79B 1NTKG 5KAIE 3PP5A 3H1KG 2FYNC 2E74C 2AXTE 3AEBC 2P67A 1SQXG 2KK7A 5CJ4A 2YO2A 2Q1KA 3NMDA 1DH3A 4DCKA 3H1JE 3I55P 1SS1A 1BGYD 3GF3A 2E74D 3E1IB 1SQVJ 1VQKP 1S5LX 2Y0CA 1JM0A 1BE3G 1FZGB 4IL6H 2QJPB 3AEGC 1LTSC 3BCCD 4EIJA 1GL2C 1FDMA 3CWBJ 4LLHA 3EFFK 5C39A 2I1KA 1MZ9A 3H1JG 3TYYA 1PV3A 3W68A 1P84H 2H88C 3U1CA 2NPSC 1GL2D 2R5BA 4M7FA 2WITA 1OMIA 3VMZA 3UIAA 1GTWA 2OGUA 3V4QA 3HE5A 1K9MQ 1FZEA 3BVHA 2NPSD 2JWDA 3JCUH 2LKMA 5APVA 2W8ZA 5AW5B 1JY2O 3H1KJ 1S5LE 1L0ND 4K35A 2FBWC 3CC7P 1PGQA 1YQ3C 2J2PA 3D70A 1Q2NA 3Q5SA 2ZJSE 3USSA 3M0AA 3EQ2A 1FE6A 1R5LA 3L70E 2ZFCA 1L0LD 4AUWA 1KORA 3KPEA 1KB9E 1YJNP 2A06D 3E1RA 1G2CA 3L75E 1Z56A 2OQQA 1YQ4C 1LTAC 3H1JJ 2B87A 5TISH 1HUCA 3M91A 2ITAA 2K9JA 3IF4A 1Q86Q 2IZ1A 2IFNA 4B86A 2KS1A 1VF5C 3L70G 2R3SA 1NAFA 4D6TD 2WPSA 2XNXC 1FZCC 1LGHB 4IFFA 2HPCB 2YIUC 3KZIE 3HE4B 3L75G 1VF5D 5CBNA 1UIXA 2JHLF 3H25A 5AW0B 2W27A 5CBOA 2PAJA 3FIBA 4TT3H 1KQFB 2WSFH 2E43A 3RGUA 5AVWB 2I8DA 1VQOP 2IBZE 1FDIA 1L0NK 1SQQE 2PP6A 3WUVA 3GG2A 4WY4C 1KILC 4OGQB 2H7HA 1M1JB 1EZVI 5CCHA 2Q5UA 1RF1B 4R4LA 4ASVA 1AQTA 3L73D 4YTPC 4WY4D 1FZBA 4M7HA 1KILD 2QJKB 1VQ8P 1SLQA 3GLMA 4N6JA 5KLVE 1SFCA 2RMZA 5AVVB 1BGYJ 3L74D 2IBZG 4AYCA 1KTMA 3JSVC 2B88A 3LIDA 1NOHA 3B5NC 1SQQG 2A45G 1VQNP 2M3BA 3L70J 1ZRTE 4I7ZC 4KT0J 3GHGB 5KLVK 1LNQA 5DJTB 1FZAB 1JUNA 3BCCJ 1VQ7P 2R44A 1PGOA 4HKZH 1XTCC 3B5ND 3MD0A 3TNUA 2J61B 2XV5A 3L75J 2JO1A 3CX5D 3V5BA 4YXWH 1M57D 1IFPA 3H1ID 3RK3C 5KLVG 1FDOA 3U1AA 2P1JA 4C7NB 3R2PA 2GY7A 4GOFA 2KZIA 5KAFE 1IC2A 1QVGO 3MHVA 2Y0DA 1M90Q 2J60A 1PGPA 1OIPA 3MUDC 2OYIB 5GTIE 2W6BA 1S4XA 4Y28J 3A5TA 3HE5B 3BVHB 1L0NJ 1YTZI 1RH5B 1QEXA 2J64A 1GK4A 5KTBA 2VRSA 1FAVA 1T2KC 2WZ7A 3BASA 2H43A 1PIXA 4W7YA 2WNPF 2HODA 3Q2YA 1RE3A 2FFDA 4M3LA 1T2KD 2Z5IA 4PJ0E 1CI6B 2LXCB 1J1EB 5AW3B 1NGMB 2HLOA 1JC9A 3KYQA 4L75A 2J3GA 1R5SA 4XA4A 4KHXA 1JCCA 5APWA 3HD7A 1VDFA 5KLVJ 4LC1A 3HUSA 3L37A 4IOIH 3OJAB 2W83C 3NTNA 2D2CC 2K37A 2WVRA 2V7QH 1J1DC 1G2CB 2P58A 1EDJA 2O1KA 5KLIB 4D6TJ 3RK3E 1RHZB 3KQGA 2K9JB 2D2CD 2FYUE 1P84I 1LT9C 2AXCA 4PV1C 1Y8AA 1VQMP 2YKPA 4ZKPA 3M9BA 2FYUK 3GMAA 4IFDK 4PV1D 5KAIH 4RJTA 1ZR4A 2B89A 1QL2A 3MIWA 3V6IA 2AXTH 3TK1A 4DZOA 3G6EP 3G9RA 2K3RA 3B71A 3AE5C 2FYUG 4L73A 4H13B 3B8EB 4NPEA 1GL2A 3I56P 1NTZD 1NAYA 1G1IA 1W2EA 3KDPB 4NPFX 3F5HA 3FWNA 3L73J 2BCCG 2NPSA 2WMMA 4JQ0D 4OWFA 1LWUB 1RE4C 1USDA 3WUUA 2O01J 3O6QB 1T3UA 2LXBA 3L74J 1JMMA 4WVZA 3AE1C 1CZQA 3AE7C 1NHLA 1FZBB 5CCHC 1PPJD 1L4AA 4ZMDA 2M0BA 3V2RA 1JO5A 1HH0A 2KZJA 3A7OA 4GOEA 1JNMA 3F89A 1LTBC 1JY2P 1JB0J 1K8AQ 5CCHD
chains in the Genus database with same CATH topology
1SFCC 2OYIC 4GT1A 1YYCA 2J3OA 4I6MC 1IK9A 1KFNA 3N4XA 2P67A 2R5DA 5CJ4A 2YO2A 1DH3A 1FU1A 2HYNA 3NMDA 3M9QA 1FICA 3V4WA 4Y99B 1FZFC 4I1LA 1SFCD 2Q9IA 1SQPK 2POHA 5KJ7A 1H8AA 3E1IB 3N7NA 3M0DC 3M9HA 4O9BA 3HTKB 1FJKA 5AVSB 2P2UA 2HPCC 2JHKF 1SQBK 1FZGB 1J1DB 3RL0C 1GW4A 4OH8B 1S9KD 1LTSC 3VP8A 1WRGA 2IX7C 1IFJA 4EIJA 1Z3SA 5APXA 1GL2C 2N1TA 1FDMA 2GUSA 4JYCA 1HGVA 4LLHA 2KP8A 1GU4A 3RL0D 2I1KA 1LT9B 1NWQA 1MZ9A 3TYYA 1NTZK 4N3YB 1MUUA 3O8ZA 1SP4A 1LWUA 3U1CA 2I1JA 1JTHB 2NPSC 1GL2D 2R5BA 2QM8A 5CCGA 4M7FA 5AW8B 2WITA 4IFMA 2XNXA 3VMZA 1URQA 3UIAA 1GTWA 3V4QA 3HE5A 4JYBA 1SQQK 1FZEA 3BVHA 1M1JC 2YNYA 1LTTC 2R3CA 2NPSD 1N7SC 2J3FA 1RF1C 5AVYB 1N2DC 2HODB 2LKMA 1JOCA 5APVA 1RE3B 2GUVA 1ZR2A 1IFMA 5AW5B 4C46A 4DOJA 3TSIA 1JY2O 2WPQA 5AVTB 1PFIA 5APSA 5AVRB 1IJDB 2MJZA 3OA7A 2JHIF 1N7SD 2OYHB 2W6AA 3IFMA 2FKWB 3P8CE 5APUA 2WSCH 1X8YA 2FFDC 2HLOB 2J2PA 1Z3UA 4JYOX 2WPRA 1LTJC 1RE4B 2XU6A 3A2AA 2WT7B 3M0AA 1AQ5A 1GK6A 2HFED 3GHGC 1FZAC 3EQ2A 3V2QA 1GD2E 1ZLLA 4N78D 1IFNA 2IFMA 5CCHD 3HUSB 1J2JB 2Z4EB 2ZFCA 1FBMA 5AVUB 4I2LC 2CPBA 1FZGA 4NYTA 1GZLA 1IO4A 2ZXEB 1HBWA 4AUWA 3KPEA 1QL1A 1MV8A 5APQA 5BVZA 1G2CA 3RK3D 4R9JA 2WSEH 1Z56A 3II6A 2A45H 2HG5D 2N1TC 3SWFA 2E42A 1SFCB 5AVZB 1LTAC 4WB4A 3MGNA 1HUCA 2Z5HA 3M91A 4ZKUA 2WWWA 1JY2N 3VMYA 2IFNA 5AW6B 1N73A 4B86A 2QM7A 2N1TD 1NAFA 1FZFB 1A02J 2WPSA 3VOPA 4LGDE 1ZV8A 3NXSA 2XNXC 1URQC 3C9IA 1N7LA 1FZCC 1LGHB 4IFFA 4GKGA 2HPCB 3TNUB 1FZEC 4XE5B 3BVHC 1NH4A 1M7LA 3HE4B 3RL0B 1HGZA 2Q3IA 2OARA 5CJ0A 5BU8B 2JHLF 1URQD 5AW0B 2FYZA 2W27A 1GL2B 2PAJA 3FIBA 1N86A 1OXZA 2WSFH 2E43A 1EQ7A 2KLVA 3H32A 4HYTB 5AVWB 3MUDA 1FOSF 3L35A 1KZUB 2JHMF 2NPSB 4R9TA 3I5CA 1L0NK 3L36A 1J1EC 2PP6A 2YO3A 3VMXA 4WY4C 4Y99C 1KILC 4WBAA 3VTPC 2H7HA 1VPCA 1M1JB 2Z4EA 1G1JA 1NKZB 5CCHA 3P8MC 1E5WA 1NO4A 1FZGC 3L4FA 2Q5UA 2XKMA 1RF1B 3T97A 1X9VA 3CLQA 3P32A 4WY4D 1FZBA 4M7HA 1KILD 1T8ZA 1T3JA 1ZN5A 1SLQA 1AFOA 2H43B 4N6JA 3M06A 4JF7A 1SFCA 5AVVB 3RK2C 1L4AC 4AYCA 2FFDB 3LIDA 1RF0B 3B5NC 1NOHA 2J5ZA 2A45G 1LTJB 3EFGA 4HH2A 2IPPA 2M3BA 1JY3P 1N73C 2J0GA 3CI9A 3GHGB 5KLVK 3RK2D 3LW5H 4C7RA 1L4AD 1JUNA 1FZAB 1YTZT 5AVXB 2C0XA 1FIBA 1XTCC 1HWTC 3B5ND 1NKNA 1KFMA 3MD0A 2D39A 3TNUA 2J61B 1XTGB 1FOSE 1IFIA 2XV5A 3HD7B 3HE4A 3VN0A 1OWAA 1NTMK 3E1IA 4W7ZA 3V5BA 3RK3C 3HTKA 2FXMA 3A3YB 5KJ7C 2Q9IC 3U1AA 2R32A 2P1JA 1NU1K 4C7NB 2J59M 3R2PA 1S9KE 2GY7A 2N1TB 1IC2A 1WT6A 1N86C 3V2PA 3H32C 2O1JA 5CHXA 5KJ7D 2J60A 1GU5A 1FIDA 3G3ZA 2OYIB 2M8RA 2J3UA 4EOTA 1LT9A 2W6BA 3WMM0 3A5TA 2XNXB 1URQB 3VYIA 2Q7CA 1FZCB 1JTHA 3HE5B 1LWUC 5AW7B 3BVHB 1YTZI 5CCGC 2J64A 1GK4A 2N9BA 5KTBA 2VRSA 2BASA 1FAVA 1T2KC 2WZ7A 1SQXK 1IFDA 3BASA 2H43A 1FZBC 4RESB 3H6PA 4W7YA 2FIBA 2WNPF 2HODA 5CCGD 1RE3A 5APYA 2FFDA 4JZCA 2C9LY 1RF0A 4ZFGA 4M3LA 2GM4A 1T2KD 1LTJA 2Z5IA 3P8CD 1JY3O 2OYHA 1CI6B 1J1EB 2KOGA 5AW3B 3GHGA 2HLOA 1FZAA 1JC9A 4WY4B 3KYQA 2J3FD 1KILB 2J3GA 2YMYA 1RE4A 2L5GB 2J1GA 2JEEA 4XA4A 2J61A 2WT7A 4KHXA 1JCCA 5APWA 3HD7A 4N78E 1FJPA 2P7JA 2JHHC 1VDFA 4LC1A 3HUSA 3L37A 3E1IC 3OJAB 3NTNA 4C7NA 1N7SB 1J1DC 2J58A 1G2CB 3RK2B 3P7KA 1L4AB 2O1KA 5AW4B 2JJLA 3B5NB 5CMZA 3KQGA 1KQLA 1L0LK 2C0WA 2OYIA 1DEBA 1MFZA 1N73B 1H89A 2YKQA 1LT9C 1HVVA 3CL3D 1FZCA 1SQVK 5AVQB 1JY3N 2YKPA 1RY3A 4ZKPA 1FZFA 3M9BA 2FYUK 1FZDA 3IR9A 3M0DA 2O01H 3RK3B 1CW5A 2Q9IB 5BU5A 2HPCA 2KB7P 3LIEA 4IFDK 1GW3A 1HJBA 2J0YA 2H8PD 5AW2B 1ZR4A 3NFQA 3V2NA 2C9NY 1QL2A 1HTLC 3MIWA 2H43C 3TK1A 4DZOA 1N86B 1JCDA 2HODC 3H32B 3B8EB 2XDJA 1RE3C 3OAKA 1GL2A 1RF0C 5APTA 1CI6A 1DX7A 3HRNA 1G1IA 1W2EA 3BATA 3KDPB 2WTYA 2YKOA 2OYHC 4WY4A 1KILA 2HLOC 2NPSA 1A02F 1LWUB 1RE4C 3BRTB 2CPSA 5AW1B 1GDTA 1T3UA 4EPUA 3HD7C 4AQRD 3SWYA 4W80A 1JMMA 1M1JA 1NTKK 1FZEB 1CZQA 1SVFA 1NHLA 3HUSC 2J0HA 1FZBB 1N7SA 2XZRA 1CSBA 2Z4EC 3MTUE 2KYVA 3BRVB 5CCHC 1H88A 3U59A 1RF1A 1L4AA 2A45I 2KSJA 4GIFA 3V2RA 1LTGC 1JO5A 3HD7D 1HH0A 3A7OA 3B5NA 1X79B 3VP9A 1JNMA 1LTBC 1JY2P 3PP5A 5AW9B 1LTIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5Z A;  1FZG A;  3HUS A;  2OYI C;  2A45 G;  3E1I C;  1LTJ B;  4NYT A;  2J3O A;  1JY3 P;  1N73 C;  2J0G A;  3GHG B;  1FZA B;  1FIC A;  4R9J A;  1FIB A;  1FZF C;  2A45 H;  2D39 A;  2J61 B;  2Q9I A;  3E1I B;  2OYI A;  3E1I A;  2HPC C;  2JHK F;  1N73 B;  1JY2 N;  1FZG B;  2Q9I C;  1N73 A;  1LT9 C;  2GY7 A;  1FZC A;  1FZF B;  1JY3 N;  1N86 C;  1Z3S A;  2XNX C;  1FZF A;  1FZC C;  1FZD A;  3H32 C;  2HPC B;  1FZE C;  2Q9I B;  2HPC A;  3BVH C;  2J60 A;  1FID A;  1LT9 B;  2OYI B;  2J0Y A;  2J3U A;  1LT9 A;  1LWU A;  2H43 C;  2JHL F;  1N86 B;  2XNX B;  1FZC B;  2HOD C;  3FIB A;  4M7F A;  3H32 B;  1N86 A;  2XNX A;  1RE3 C;  1LWU C;  3H32 A;  3BVH B;  1RF0 C;  1FZE A;  2J64 A;  3BVH A;  1M1J C;  1W2E A;  2OYH C;  2JHM F;  4R9T A;  2HLO C;  2J3F A;  1RF1 C;  2H43 A;  2HOD B;  1FZB C;  2FIB A;  2WNP F;  1RE3 B;  1LWU B;  1RE4 C;  2HOD A;  1JY2 O;  1RE3 A;  1T3U A;  2FFD A;  4JZC A;  1M1J B;  1RF0 A;  2Z4E A;  4EPU A;  4ZFG A;  2JHI F;  1LTJ A;  2OYH B;  1M1J A;  1FZE B;  1FZG C;  3HUS C;  2FFD C;  1JY3 O;  2HLO B;  1RF1 B;  2OYH A;  2J0H A;  2J2P A;  1FZB B;  2Z4E C;  1Z3U A;  4JYO X;  3GHG A;  2HLO A;  1RF1 A;  1LTJ C;  1RE4 B;  1FZB A;  1FZA A;  1JC9 A;  4M7H A;  2J3F D;  2J3G A;  2A45 I;  1RE4 A;  2H43 B;  2J1G A;  3GHG C;  2J61 A;  1FZA C;  1JY2 P;  3HUS B;  2FFD B;  2Z4E B;  2JHH C;  1RF0 B; 
#chains in the Genus database with same CATH topology
 3RL0 g;  1SFC C;  1KYO E;  2J3O A;  3N4X A;  3CD6 P;  1FS0 E;  1SQB E;  1KD1 Q;  4U7J A;  1FU1 A;  1FIC A;  5DJU B;  3V4W A;  4Y99 B;  4I1L A;  1SFC D;  2K1A A;  2Q9I A;  1H8A A;  4CPG A;  3CPW O;  3M9H A;  1FJK A;  5AVS B;  3S9O A;  2JHK F;  1SQB K;  2FYU J;  3RL0 C;  3Q5P A;  1S9K D;  2IX7 C;  2E5T A;  1IFJ A;  4BRY B;  2ZXX A;  2KNC A;  2GUS A;  1HGV A;  2PRR A;  1GU4 A;  1SQB G;  3WUT A;  3RL0 D;  2BCC J;  2ZVN B;  1NTZ K;  1PP9 E;  2I1J A;  2QM8 A;  5CCG A;  2Y9Z A;  2XNX A;  3B4S A;  3TGU D;  3Q5R A;  3CWB E;  3CXH E;  1KN7 A;  1N7S C;  3L71 D;  4PD4 E;  3K5B A;  1N2D C;  2HOD B;  2RN0 A;  2AEM A;  3CCQ P;  1RQU A;  1RE3 B;  1ZR2 A;  1OW7 A;  2WPQ A;  1PFI A;  1PP9 G;  1N7S D;  1YIJ P;  2W6A A;  2WSC H;  2FFD C;  2HLO B;  4JYO X;  3ZDM A;  3KZI H;  2XU6 A;  3CWB G;  1AQ5 A;  1GK6 A;  1DIP A;  3CCS P;  1ZLL A;  2IFM A;  3HUS B;  2Z4E B;  4NYT A;  1AA0 A;  3Q3D A;  3T97 B;  2WSE H;  1K05 A;  1SQB J;  2A45 H;  2HG5 D;  2N1T C;  5AVZ B;  1YHQ P;  2E74 B;  3MGN A;  3L72 D;  2RH0 A;  2WWW A;  2BEQ D;  3VMY A;  1X22 A;  2N1T D;  2P10 A;  1N7L A;  1NTZ J;  4GKG A;  2CK3 H;  1NU1 D;  2PFX A;  4XE5 B;  1NH4 A;  2KI7 B;  1BSH A;  3D6Y A;  1GL2 B;  1PP9 J;  1S3J A;  3A0H E;  2KLV A;  4HYT B;  2IYP A;  1EZV D;  3SWK A;  1QVF O;  3MUD A;  1KZU B;  2JHM F;  2NPS B;  4R9T A;  1IK7 A;  1DD4 A;  3AEC C;  4BXL A;  2YO3 A;  1AJY A;  5B66 H;  3PH0 A;  1VPC A;  5KAF H;  1WMK A;  1FZG C;  2XKM A;  1BSN A;  3CLQ A;  2AEF A;  3P32 A;  3H1H D;  1T3J A;  1LP1 B;  3RK2 C;  1L4A C;  4YPC A;  5B5E E;  4NPD A;  1RF0 B;  1OFC X;  2PGD A;  1Q7Y Q;  4OVN F;  2J5Z A;  1SQP D;  1JMB A;  3EFG A;  4HH2 A;  2IPP A;  1ZW0 A;  3AE9 C;  4EDF A;  3S4R A;  3RK2 D;  1L4A D;  5AVX B;  2C0X A;  1FIB A;  1HWT C;  1NKN A;  2AEJ A;  1BGY E;  1FOS E;  1IFI A;  3HTK A;  2FXM A;  2Q9I C;  4PJ0 H;  1NU1 K;  3BCC E;  2KNC B;  1YJW P;  3H32 C;  1Y9B A;  2O1J A;  5CHX A;  1N8R Q;  1AV1 A;  3LW5 J;  2J3U A;  3L71 J;  1VF5 B;  2J5U A;  1LT9 A;  1BGY G;  3MZW B;  2XNX B;  3VYI A;  5KKZ C;  1FZC B;  1JTH A;  2YIU B;  5CCG C;  2N9B A;  3MP7 B;  3BCC G;  3C8V A;  5CCG D;  3ITK A;  1PZQ A;  1L0N E;  1YBK A;  1LTJ A;  2FY8 A;  3P8C D;  1JY3 O;  2KIK A;  3SFE C;  4WY4 B;  1KIL B;  1RE4 A;  2L5G B;  3H1L D;  2Q3E A;  4IL6 X;  3L72 J;  1P84 D;  1BDD A;  1L0L E;  4EYY Q;  4MN4 C;  1H0T B;  2J58 A;  1L0N G;  2A06 E;  5AW4 B;  3B5N B;  4ZNC A;  5CMZ A;  4H0L B;  1KQL A;  2QEX P;  1L0L K;  1NU1 J;  1T6A A;  2QRX A;  3CMA P;  1MFZ A;  3CCM P;  2Y0E A;  2KLU A;  2YKQ A;  4OGQ C;  4D6T E;  2K9Y A;  1OZH A;  3D71 A;  1L0L G;  3CCV P;  1FZD A;  3IR9 A;  3RK3 B;  5BU5 A;  1HJB A;  2A06 G;  2W90 A;  3NFQ A;  3V2N A;  2C9N Y;  4OGQ D;  1HTL C;  2ZYD A;  1QLE D;  2FXP A;  5H2F E;  4Z1M H;  3BAT A;  2YKO A;  2OYH C;  4D6T G;  3H1H J;  2E75 C;  4U3F D;  1MKM A;  3BRT B;  2O3J A;  1LT1 A;  2V4H A;  1YIT P;  4W80 A;  1FZE B;  2E75 D;  2J0H A;  2E76 C;  1N7S A;  2IBZ I;  2RKL A;  3MTU E;  3PTZ A;  3L73 E;  1KIL E;  2A45 I;  2KSJ A;  1GMJ A;  3C1L A;  1LTG C;  1HJ0 A;  3VP9 A;  3JCU E;  2LR2 A;  3L74 E;  2E76 D;  5AW9 B;  2OYI C;  4GT1 A;  1NTM D;  4I6M C;  1KFN A;  3CXH H;  1MFT A;  2QJY B;  2R5D A;  1L0L J;  4PD4 H;  3M9Q A;  1FZF C;  1RQV A;  5KJ7 A;  3L73 G;  3N7N A;  3M0D C;  1QX8 A;  4O9B A;  3HTK B;  2D2C B;  3CX5 E;  1J1D B;  3H1I E;  2M5A A;  5E79 E;  4OH8 B;  3VP8 A;  3FXD A;  3L74 G;  5GTH E;  1Z3S A;  1BCC D;  2N1T A;  4JYC A;  3RBZ A;  2KP8 A;  1VL2 A;  2B87 B;  1LT9 B;  2NRG A;  4PV1 B;  1NWQ A;  2YXR B;  3O8Z A;  1SP4 A;  1KV4 A;  1JTH B;  3AE8 C;  2KS1 B;  4IFM A;  4ASW A;  1W5C E;  3H1I G;  2OTL P;  4UB6 E;  1LTT C;  2R3C A;  2BCC E;  2GA1 A;  2K88 A;  1PL5 A;  2GUV A;  1IFM A;  4C46 A;  3H1L J;  1JEK A;  5APS A;  3OA7 A;  2JHI F;  2H89 C;  2L91 A;  2FKW B;  1X8Y A;  4KJM A;  2ZYA A;  1LTJ C;  1RE4 B;  2SPZ A;  2HFE D;  2WPV B;  1HF9 A;  3PHL A;  1GD2 E;  3FGA D;  4N78 D;  3A0H H;  4I2L C;  2CPB A;  1FZG A;  2ZXE B;  5APQ A;  5BVZ A;  1KC8 Q;  1SQV D;  3II6 A;  3EWK A;  2E42 A;  1SFC B;  4WB4 A;  1VQL P;  1EC5 A;  3CCR P;  4ZKU A;  2ZAE B;  1JY2 N;  5AW6 B;  4H13 D;  2QM7 A;  3H1I J;  1D7M A;  1EDK A;  4LGD E;  3NXS A;  1URQ C;  2ZVO B;  3CXH D;  1U7M A;  2QE7 H;  3TNU B;  5B5E H;  1M7L A;  3RL0 B;  2Q3I A;  1S5L H;  4U3F J;  5TJH A;  1URQ D;  2FYZ A;  1OXZ A;  3CCJ P;  3H32 A;  3CCE P;  1FC2 C;  3AE4 C;  1NTZ E;  1FOS F;  1NTK D;  3IAO A;  3L36 A;  3H1K D;  3VMX A;  4Y99 C;  1G1J A;  1SQX D;  3P8M C;  1KB9 H;  1E5W A;  1NO4 A;  3PRJ A;  1X9V A;  2YXQ B;  1PPJ E;  1NTZ G;  1BE3 D;  1ZN5 A;  2WSF J;  2H43 B;  2JP3 A;  1ZP0 C;  4JF7 A;  3AED C;  3SFD C;  4JBZ A;  2FFD B;  4QMA A;  1EDL A;  1JY3 P;  1N73 C;  4R4M A;  1YTZ T;  3H1J D;  1DD3 A;  1BCC J;  4WWI A;  1NYH A;  3HD7 B;  3HE4 A;  1PPJ G;  1OWA A;  3VN0 A;  3CC4 P;  3IN6 A;  4H44 C;  5KJ7 C;  1S9K E;  2N1T B;  1S72 P;  1N86 C;  2ZT9 C;  3V2P A;  1Y47 A;  4H44 D;  5KJ7 D;  1FID A;  3G3Z A;  2FYN B;  1Q90 D;  2M8R A;  4EOT A;  3WMM 0;  2ZT9 D;  2Q7C A;  2NZ2 A;  1VQP P;  3A0B E;  3D6Z A;  4DJG A;  3L71 E;  1SQX K;  3AEA C;  4RES B;  3H6P A;  2FIB A;  4JZC A;  2C9L Y;  2GM4 A;  2OYO A;  1K73 Q;  3CXH I;  2OYH A;  4PD4 I;  3RBX A;  3GF7 A;  3GHG A;  2N9Y B;  1FZA A;  3TGU G;  2YMY A;  2J1G A;  2JEE A;  2QSI A;  2J61 A;  2WT7 A;  3L71 G;  5H2F H;  3L70 D;  3E1I C;  4C7N A;  1KB9 D;  1AVY A;  2QJP C;  3RK2 B;  1L4A B;  3L75 D;  3TDK A;  5GTI H;  2OYI A;  3L72 E;  1DEB A;  3JC2 2;  1HVV A;  3CL3 D;  5AVQ B;  1RY3 A;  1FZF A;  1U7J A;  3M0D A;  1NU1 E;  2O01 H;  2Q9I B;  4HB1 A;  2KB7 P;  2V7Q J;  3LIE A;  1GW3 A;  2KXP B;  1NTK J;  2G3A A;  3S1K A;  3WU2 E;  1JCD A;  3FX0 A;  3H32 B;  3L72 G;  3AEF C;  1RF0 C;  1SQX J;  1EZV E;  1CI6 A;  1DX7 A;  3HRN A;  3TGU J;  4UB8 E;  2IBZ D;  3CX5 H;  5KKZ B;  1SQQ D;  1BE3 J;  1NU1 G;  5E79 H;  5AW1 B;  3R4Y A;  1Q81 Q;  3OW2 O;  3SWY A;  5GTH H;  4RO0 A;  1SVF A;  1CSB A;  3BRV B;  3U59 A;  3H1H E;  1OX3 A;  1AVO A;  1EZV G;  5KLV D;  1ZXG A;  2JDI H;  1IZN B;  1LTI C;  3AEE C;  1SQP E;  1YYC A;  1ZRT D;  4EI2 A;  4UB6 H;  1IK9 A;  5L8R J;  2HYN A;  2QG4 A;  1SQP K;  2POH A;  3H1H G;  2B9B A;  2P2U A;  2HPC C;  5K5G B;  1EDI A;  3Q1M A;  2IZ0 A;  3CCU P;  1K04 A;  1GW4 A;  1WRG A;  1VQ4 P;  2IDB A;  2QIW A;  1SQP G;  5APX A;  4BWN A;  1VQ6 P;  3TF5 A;  4N3Y B;  1MUU A;  4I7Z B;  1LWU A;  3O6Q A;  5AW8 B;  3QWO C;  1KB9 I;  1URQ A;  4JYB A;  1SQQ K;  1EXI A;  1M1J C;  2YNY A;  2J3F A;  1RF1 C;  5AVY B;  1JOC A;  4DOJ A;  2QJK C;  1KYO H;  3TSI A;  5AVT B;  4H0L C;  5AVR B;  1IJD B;  2MJZ A;  2OYH B;  1YI2 P;  3IFM A;  4IL6 E;  3P8C E;  5APU A;  2E75 B;  1Z3U A;  2WPR A;  2BEZ F;  3A2A A;  2WT7 B;  4GOD A;  4H0L D;  3GHG C;  3CME P;  1FZA C;  3H1L E;  3V2Q A;  1IFN A;  1J2J B;  2E76 B;  1FBM A;  3E7K A;  5AVU B;  1P84 E;  1ZME C;  1GZL A;  1IO4 A;  1HBW A;  5B66 E;  3AE3 C;  4RKU J;  4XFJ A;  1QL1 A;  4BRY A;  1MV8 A;  1SQP J;  3RK3 D;  4R9J A;  4DT0 A;  3SWF A;  2WSC J;  2FYU D;  1OVR A;  2Z5H A;  1OW8 A;  2WSS H;  2OTK E;  3H1L G;  1N73 A;  2ZYG A;  1FZF B;  1A02 J;  3VOP A;  1ZV8 A;  3C9I A;  2BCC D;  4L76 A;  2UWJ E;  2QA4 P;  1VQ9 P;  1FZE C;  3PJS K;  3BVH C;  3KXD A;  2HR3 A;  1HGZ A;  1BDC A;  2OAR A;  2WSE J;  5CJ0 A;  1SQQ J;  5BU8 B;  1R8E A;  2E5Y A;  3CC2 P;  1N86 A;  1EQ7 A;  2MKV A;  1TU3 F;  1M56 D;  3L35 A;  3I5C A;  2QJY C;  4TLF A;  4U3F E;  1J1E C;  4A7P A;  4WBA A;  5TIS E;  3VTP C;  2Z4E A;  1NKZ B;  1LJ2 A;  3L4F A;  3T97 A;  2IYO A;  1T8Z A;  1AFO A;  2KSE A;  2XND H;  3CCL P;  1YJ9 P;  3M06 A;  5KLI C;  1DEE G;  1UII A;  4GDO A;  4U3F G;  1KYO D;  3A0B H;  1LTJ B;  1KQG B;  1NTM E;  1EXJ A;  2J0G A;  3CI9 A;  1SQB D;  2JKV A;  1KMI Z;  2JWA A;  3VMA A;  3LW5 H;  4C7R A;  1KFM A;  2D39 A;  1XTG B;  1NTM K;  1NJI Q;  1USE A;  3E1I A;  4W7Z A;  3A3Y B;  4K3A A;  2R32 A;  2J59 M;  2DW3 A;  1ZOY C;  2Q6Q A;  1WT6 A;  1BCC E;  1NTM G;  4H13 C;  3CX5 I;  1W2B O;  1GU5 A;  1L2P A;  1PP9 D;  2Y9Y A;  1URQ B;  2QVA A;  1KQS O;  1OVV A;  1LWU C;  5AW7 B;  1S2E A;  3CWB D;  3GW6 A;  3SSU A;  2FXO A;  2BAS A;  4PD4 D;  1IFD A;  5EFW B;  1BCC G;  1LP1 A;  1M1K Q;  1FZB C;  5APY A;  1E79 H;  1RF0 A;  3KHU A;  4ZFG A;  4JPZ B;  3G71 P;  2KOG A;  3G4S P;  4YXD C;  2J3F D;  3WU2 H;  4HJG H;  2OTJ P;  4N78 E;  1FJP A;  2P7J A;  2JHH C;  2O01 N;  3QH9 A;  1PGJ A;  2G8Y A;  1N7S B;  1NVO A;  4UB8 H;  3P7K A;  2M3E A;  1NTM J;  1SQV E;  2YMK A;  2JJL A;  3PLN A;  2C0W A;  3FWL A;  3AE6 C;  3AE2 C;  1N73 B;  5M1B A;  1H89 A;  3W67 A;  1FZC A;  1SQV K;  1OVU A;  1JY3 N;  1X0T A;  2WQY C;  1CW5 A;  2W6J H;  4H44 B;  2HPC A;  2J0Y A;  2H8P D;  5AW2 B;  1OW6 A;  1SQV G;  1KYO I;  3FXE A;  2H43 C;  2M5A B;  1N86 B;  2ZT9 B;  2HOD C;  1S1C X;  1M8O B;  2XDJ A;  1RE3 C;  3OAK A;  4L74 A;  5APT A;  2WTY A;  4WY4 A;  1KIL A;  1NTK E;  2HLO C;  1Q82 Q;  3H1K E;  2JR8 A;  2KUB A;  1A02 F;  2CPS A;  1GDT A;  4EPU A;  3HD7 C;  4AQR D;  1SQX E;  1VQ5 P;  1M1J A;  1NTK K;  3TGU E;  3HUS C;  3ABV C;  2Z4E C;  2XZR A;  1H0T A;  2KYV A;  1H88 A;  1RF1 A;  1QGK B;  4GIF A;  1BE3 E;  1U57 A;  3HD7 D;  3B5N A;  1X79 B;  1NTK G;  5KAI E;  3PP5 A;  3H1K G;  2FYN C;  2E74 C;  2AXT E;  3AEB C;  2P67 A;  1SQX G;  2KK7 A;  5CJ4 A;  2YO2 A;  2Q1K A;  3NMD A;  1DH3 A;  4DCK A;  3H1J E;  3I55 P;  1SS1 A;  1BGY D;  3GF3 A;  2E74 D;  3E1I B;  1SQV J;  1VQK P;  1S5L X;  2Y0C A;  1JM0 A;  1BE3 G;  1FZG B;  4IL6 H;  2QJP B;  3AEG C;  1LTS C;  3BCC D;  4EIJ A;  1GL2 C;  1FDM A;  3CWB J;  4LLH A;  3EFF K;  5C39 A;  2I1K A;  1MZ9 A;  3H1J G;  3TYY A;  1PV3 A;  3W68 A;  1P84 H;  2H88 C;  3U1C A;  2NPS C;  1GL2 D;  2R5B A;  4M7F A;  2WIT A;  1OMI A;  3VMZ A;  3UIA A;  1GTW A;  2OGU A;  3V4Q A;  3HE5 A;  1K9M Q;  1FZE A;  3BVH A;  2NPS D;  2JWD A;  3JCU H;  2LKM A;  5APV A;  2W8Z A;  5AW5 B;  1JY2 O;  3H1K J;  1S5L E;  1L0N D;  4K35 A;  2FBW C;  3CC7 P;  1PGQ A;  1YQ3 C;  2J2P A;  3D70 A;  1Q2N A;  3Q5S A;  2ZJS E;  3USS A;  3M0A A;  3EQ2 A;  1FE6 A;  1R5L A;  3L70 E;  2ZFC A;  1L0L D;  4AUW A;  1KOR A;  3KPE A;  1KB9 E;  1YJN P;  2A06 D;  3E1R A;  1G2C A;  3L75 E;  1Z56 A;  2OQQ A;  1YQ4 C;  1LTA C;  3H1J J;  2B87 A;  5TIS H;  1HUC A;  3M91 A;  2ITA A;  2K9J A;  3IF4 A;  1Q86 Q;  2IZ1 A;  2IFN A;  4B86 A;  2KS1 A;  1VF5 C;  3L70 G;  2R3S A;  1NAF A;  4D6T D;  2WPS A;  2XNX C;  1FZC C;  1LGH B;  4IFF A;  2HPC B;  2YIU C;  3KZI E;  3HE4 B;  3L75 G;  1VF5 D;  5CBN A;  1UIX A;  2JHL F;  3H25 A;  5AW0 B;  2W27 A;  5CBO A;  2PAJ A;  3FIB A;  4TT3 H;  1KQF B;  2WSF H;  2E43 A;  3RGU A;  5AVW B;  2I8D A;  1VQO P;  2IBZ E;  1FDI A;  1L0N K;  1SQQ E;  2PP6 A;  3WUV A;  3GG2 A;  4WY4 C;  1KIL C;  4OGQ B;  2H7H A;  1M1J B;  1EZV I;  5CCH A;  2Q5U A;  1RF1 B;  4R4L A;  4ASV A;  1AQT A;  3L73 D;  4YTP C;  4WY4 D;  1FZB A;  4M7H A;  1KIL D;  2QJK B;  1VQ8 P;  1SLQ A;  3GLM A;  4N6J A;  5KLV E;  1SFC A;  2RMZ A;  5AVV B;  1BGY J;  3L74 D;  2IBZ G;  4AYC A;  1KTM A;  3JSV C;  2B88 A;  3LID A;  1NOH A;  3B5N C;  1SQQ G;  2A45 G;  1VQN P;  2M3B A;  3L70 J;  1ZRT E;  4I7Z C;  4KT0 J;  3GHG B;  5KLV K;  1LNQ A;  5DJT B;  1FZA B;  1JUN A;  3BCC J;  1VQ7 P;  2R44 A;  1PGO A;  4HKZ H;  1XTC C;  3B5N D;  3MD0 A;  3TNU A;  2J61 B;  2XV5 A;  3L75 J;  2JO1 A;  3CX5 D;  3V5B A;  4YXW H;  1M57 D;  1IFP A;  3H1I D;  3RK3 C;  5KLV G;  1FDO A;  3U1A A;  2P1J A;  4C7N B;  3R2P A;  2GY7 A;  4GOF A;  2KZI A;  5KAF E;  1IC2 A;  1QVG O;  3MHV A;  2Y0D A;  1M90 Q;  2J60 A;  1PGP A;  1OIP A;  3MUD C;  2OYI B;  5GTI E;  2W6B A;  1S4X A;  4Y28 J;  3A5T A;  3HE5 B;  3BVH B;  1L0N J;  1YTZ I;  1RH5 B;  1QEX A;  2J64 A;  1GK4 A;  5KTB A;  2VRS A;  1FAV A;  1T2K C;  2WZ7 A;  3BAS A;  2H43 A;  1PIX A;  4W7Y A;  2WNP F;  2HOD A;  3Q2Y A;  1RE3 A;  2FFD A;  4M3L A;  1T2K D;  2Z5I A;  4PJ0 E;  1CI6 B;  2LXC B;  1J1E B;  5AW3 B;  1NGM B;  2HLO A;  1JC9 A;  3KYQ A;  4L75 A;  2J3G A;  1R5S A;  4XA4 A;  4KHX A;  1JCC A;  5APW A;  3HD7 A;  1VDF A;  5KLV J;  4LC1 A;  3HUS A;  3L37 A;  4IOI H;  3OJA B;  2W83 C;  3NTN A;  2D2C C;  2K37 A;  2WVR A;  2V7Q H;  1J1D C;  1G2C B;  2P58 A;  1EDJ A;  2O1K A;  5KLI B;  4D6T J;  3RK3 E;  1RHZ B;  3KQG A;  2K9J B;  2D2C D;  2FYU E;  1P84 I;  1LT9 C;  2AXC A;  4PV1 C;  1Y8A A;  1VQM P;  2YKP A;  4ZKP A;  3M9B A;  2FYU K;  3GMA A;  4IFD K;  4PV1 D;  5KAI H;  4RJT A;  1ZR4 A;  2B89 A;  1QL2 A;  3MIW A;  3V6I A;  2AXT H;  3TK1 A;  4DZO A;  3G6E P;  3G9R A;  2K3R A;  3B71 A;  3AE5 C;  2FYU G;  4L73 A;  4H13 B;  3B8E B;  4NPE A;  1GL2 A;  3I56 P;  1NTZ D;  1NAY A;  1G1I A;  1W2E A;  3KDP B;  4NPF X;  3F5H A;  3FWN A;  3L73 J;  2BCC G;  2NPS A;  2WMM A;  4JQ0 D;  4OWF A;  1LWU B;  1RE4 C;  1USD A;  3WUU A;  2O01 J;  3O6Q B;  1T3U A;  2LXB A;  3L74 J;  1JMM A;  4WVZ A;  3AE1 C;  1CZQ A;  3AE7 C;  1NHL A;  1FZB B;  5CCH C;  1PPJ D;  1L4A A;  4ZMD A;  2M0B A;  3V2R A;  1JO5 A;  1HH0 A;  2KZJ A;  3A7O A;  4GOE A;  1JNM A;  3F89 A;  1LTB C;  1JY2 P;  1JB0 J;  1K8A Q;  5CCH D; 
#chains in the Genus database with same CATH homology
 1SFC C;  2OYI C;  4GT1 A;  1YYC A;  2J3O A;  4I6M C;  1IK9 A;  1KFN A;  3N4X A;  2P67 A;  2R5D A;  5CJ4 A;  2YO2 A;  1DH3 A;  1FU1 A;  2HYN A;  3NMD A;  3M9Q A;  1FIC A;  3V4W A;  4Y99 B;  1FZF C;  4I1L A;  1SFC D;  2Q9I A;  1SQP K;  2POH A;  5KJ7 A;  1H8A A;  3E1I B;  3N7N A;  3M0D C;  3M9H A;  4O9B A;  3HTK B;  1FJK A;  5AVS B;  2P2U A;  2HPC C;  2JHK F;  1SQB K;  1FZG B;  1J1D B;  3RL0 C;  1GW4 A;  4OH8 B;  1S9K D;  1LTS C;  3VP8 A;  1WRG A;  2IX7 C;  1IFJ A;  4EIJ A;  1Z3S A;  5APX A;  1GL2 C;  2N1T A;  1FDM A;  2GUS A;  4JYC A;  1HGV A;  4LLH A;  2KP8 A;  1GU4 A;  3RL0 D;  2I1K A;  1LT9 B;  1NWQ A;  1MZ9 A;  3TYY A;  1NTZ K;  4N3Y B;  1MUU A;  3O8Z A;  1SP4 A;  1LWU A;  3U1C A;  2I1J A;  1JTH B;  2NPS C;  1GL2 D;  2R5B A;  2QM8 A;  5CCG A;  4M7F A;  5AW8 B;  2WIT A;  4IFM A;  2XNX A;  3VMZ A;  1URQ A;  3UIA A;  1GTW A;  3V4Q A;  3HE5 A;  4JYB A;  1SQQ K;  1FZE A;  3BVH A;  1M1J C;  2YNY A;  1LTT C;  2R3C A;  2NPS D;  1N7S C;  2J3F A;  1RF1 C;  5AVY B;  1N2D C;  2HOD B;  2LKM A;  1JOC A;  5APV A;  1RE3 B;  2GUV A;  1ZR2 A;  1IFM A;  5AW5 B;  4C46 A;  4DOJ A;  3TSI A;  1JY2 O;  2WPQ A;  5AVT B;  1PFI A;  5APS A;  5AVR B;  1IJD B;  2MJZ A;  3OA7 A;  2JHI F;  1N7S D;  2OYH B;  2W6A A;  3IFM A;  2FKW B;  3P8C E;  5APU A;  2WSC H;  1X8Y A;  2FFD C;  2HLO B;  2J2P A;  1Z3U A;  4JYO X;  2WPR A;  1LTJ C;  1RE4 B;  2XU6 A;  3A2A A;  2WT7 B;  3M0A A;  1AQ5 A;  1GK6 A;  2HFE D;  3GHG C;  1FZA C;  3EQ2 A;  3V2Q A;  1GD2 E;  1ZLL A;  4N78 D;  1IFN A;  2IFM A;  5CCH D;  3HUS B;  1J2J B;  2Z4E B;  2ZFC A;  1FBM A;  5AVU B;  4I2L C;  2CPB A;  1FZG A;  4NYT A;  1GZL A;  1IO4 A;  2ZXE B;  1HBW A;  4AUW A;  3KPE A;  1QL1 A;  1MV8 A;  5APQ A;  5BVZ A;  1G2C A;  3RK3 D;  4R9J A;  2WSE H;  1Z56 A;  3II6 A;  2A45 H;  2HG5 D;  2N1T C;  3SWF A;  2E42 A;  1SFC B;  5AVZ B;  1LTA C;  4WB4 A;  3MGN A;  1HUC A;  2Z5H A;  3M91 A;  4ZKU A;  2WWW A;  1JY2 N;  3VMY A;  2IFN A;  5AW6 B;  1N73 A;  4B86 A;  2QM7 A;  2N1T D;  1NAF A;  1FZF B;  1A02 J;  2WPS A;  3VOP A;  4LGD E;  1ZV8 A;  3NXS A;  2XNX C;  1URQ C;  3C9I A;  1N7L A;  1FZC C;  1LGH B;  4IFF A;  4GKG A;  2HPC B;  3TNU B;  1FZE C;  4XE5 B;  3BVH C;  1NH4 A;  1M7L A;  3HE4 B;  3RL0 B;  1HGZ A;  2Q3I A;  2OAR A;  5CJ0 A;  5BU8 B;  2JHL F;  1URQ D;  5AW0 B;  2FYZ A;  2W27 A;  1GL2 B;  2PAJ A;  3FIB A;  1N86 A;  1OXZ A;  2WSF H;  2E43 A;  1EQ7 A;  2KLV A;  3H32 A;  4HYT B;  5AVW B;  3MUD A;  1FOS F;  3L35 A;  1KZU B;  2JHM F;  2NPS B;  4R9T A;  3I5C A;  1L0N K;  3L36 A;  1J1E C;  2PP6 A;  2YO3 A;  3VMX A;  4WY4 C;  4Y99 C;  1KIL C;  4WBA A;  3VTP C;  2H7H A;  1VPC A;  1M1J B;  2Z4E A;  1G1J A;  1NKZ B;  5CCH A;  3P8M C;  1E5W A;  1NO4 A;  1FZG C;  3L4F A;  2Q5U A;  2XKM A;  1RF1 B;  3T97 A;  1X9V A;  3CLQ A;  3P32 A;  4WY4 D;  1FZB A;  4M7H A;  1KIL D;  1T8Z A;  1T3J A;  1ZN5 A;  1SLQ A;  1AFO A;  2H43 B;  4N6J A;  3M06 A;  4JF7 A;  1SFC A;  5AVV B;  3RK2 C;  1L4A C;  4AYC A;  2FFD B;  3LID A;  1RF0 B;  3B5N C;  1NOH A;  2J5Z A;  2A45 G;  1LTJ B;  3EFG A;  4HH2 A;  2IPP A;  2M3B A;  1JY3 P;  1N73 C;  2J0G A;  3CI9 A;  3GHG B;  5KLV K;  3RK2 D;  3LW5 H;  4C7R A;  1L4A D;  1JUN A;  1FZA B;  1YTZ T;  5AVX B;  2C0X A;  1FIB A;  1XTC C;  1HWT C;  3B5N D;  1NKN A;  1KFM A;  3MD0 A;  2D39 A;  3TNU A;  2J61 B;  1XTG B;  1FOS E;  1IFI A;  2XV5 A;  3HD7 B;  3HE4 A;  3VN0 A;  1OWA A;  1NTM K;  3E1I A;  4W7Z A;  3V5B A;  3RK3 C;  3HTK A;  2FXM A;  3A3Y B;  5KJ7 C;  2Q9I C;  3U1A A;  2R32 A;  2P1J A;  1NU1 K;  4C7N B;  2J59 M;  3R2P A;  1S9K E;  2GY7 A;  2N1T B;  1IC2 A;  1WT6 A;  1N86 C;  3V2P A;  3H32 C;  2O1J A;  5CHX A;  5KJ7 D;  2J60 A;  1GU5 A;  1FID A;  3G3Z A;  2OYI B;  2M8R A;  2J3U A;  4EOT A;  1LT9 A;  2W6B A;  3WMM 0;  3A5T A;  2XNX B;  1URQ B;  3VYI A;  2Q7C A;  1FZC B;  1JTH A;  3HE5 B;  1LWU C;  5AW7 B;  3BVH B;  1YTZ I;  5CCG C;  2J64 A;  1GK4 A;  2N9B A;  5KTB A;  2VRS A;  2BAS A;  1FAV A;  1T2K C;  2WZ7 A;  1SQX K;  1IFD A;  3BAS A;  2H43 A;  1FZB C;  4RES B;  3H6P A;  4W7Y A;  2FIB A;  2WNP F;  2HOD A;  5CCG D;  1RE3 A;  5APY A;  2FFD A;  4JZC A;  2C9L Y;  1RF0 A;  4ZFG A;  4M3L A;  2GM4 A;  1T2K D;  1LTJ A;  2Z5I A;  3P8C D;  1JY3 O;  2OYH A;  1CI6 B;  1J1E B;  2KOG A;  5AW3 B;  3GHG A;  2HLO A;  1FZA A;  1JC9 A;  4WY4 B;  3KYQ A;  2J3F D;  1KIL B;  2J3G A;  2YMY A;  1RE4 A;  2L5G B;  2J1G A;  2JEE A;  4XA4 A;  2J61 A;  2WT7 A;  4KHX A;  1JCC A;  5APW A;  3HD7 A;  4N78 E;  1FJP A;  2P7J A;  2JHH C;  1VDF A;  4LC1 A;  3HUS A;  3L37 A;  3E1I C;  3OJA B;  3NTN A;  4C7N A;  1N7S B;  1J1D C;  2J58 A;  1G2C B;  3RK2 B;  3P7K A;  1L4A B;  2O1K A;  5AW4 B;  2JJL A;  3B5N B;  5CMZ A;  3KQG A;  1KQL A;  1L0L K;  2C0W A;  2OYI A;  1DEB A;  1MFZ A;  1N73 B;  1H89 A;  2YKQ A;  1LT9 C;  1HVV A;  3CL3 D;  1FZC A;  1SQV K;  5AVQ B;  1JY3 N;  2YKP A;  1RY3 A;  4ZKP A;  1FZF A;  3M9B A;  2FYU K;  1FZD A;  3IR9 A;  3M0D A;  2O01 H;  3RK3 B;  1CW5 A;  2Q9I B;  5BU5 A;  2HPC A;  2KB7 P;  3LIE A;  4IFD K;  1GW3 A;  1HJB A;  2J0Y A;  2H8P D;  5AW2 B;  1ZR4 A;  3NFQ A;  3V2N A;  2C9N Y;  1QL2 A;  1HTL C;  3MIW A;  2H43 C;  3TK1 A;  4DZO A;  1N86 B;  1JCD A;  2HOD C;  3H32 B;  3B8E B;  2XDJ A;  1RE3 C;  3OAK A;  1GL2 A;  1RF0 C;  5APT A;  1CI6 A;  1DX7 A;  3HRN A;  1G1I A;  1W2E A;  3BAT A;  3KDP B;  2WTY A;  2YKO A;  2OYH C;  4WY4 A;  1KIL A;  2HLO C;  2NPS A;  1A02 F;  1LWU B;  1RE4 C;  3BRT B;  2CPS A;  5AW1 B;  1GDT A;  1T3U A;  4EPU A;  3HD7 C;  4AQR D;  3SWY A;  4W80 A;  1JMM A;  1M1J A;  1NTK K;  1FZE B;  1CZQ A;  1SVF A;  1NHL A;  3HUS C;  2J0H A;  1FZB B;  1N7S A;  2XZR A;  1CSB A;  2Z4E C;  3MTU E;  2KYV A;  3BRV B;  5CCH C;  1H88 A;  3U59 A;  1RF1 A;  1L4A A;  2A45 I;  2KSJ A;  4GIF A;  3V2R A;  1LTG C;  1JO5 A;  3HD7 D;  1HH0 A;  3A7O A;  3B5N A;  1X79 B;  3VP9 A;  1JNM A;  1LTB C;  1JY2 P;  3PP5 A;  5AW9 B;  1LTI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...