2OYIB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
NSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 93
structure length 301
sequence length 301
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiB03
4R9JA 1FZGA 1N73C 2J60A 4JZCA 1JY2N 1FZAC 1LT9C 2J3FD 2J5ZA 2FIBA 1N73A 2A45H 2JHKF 2HLOB 1FZBB 2H43B 2OYHB 2Q9IB 2HLOC 1FZBC 2GY7A 2H43C 2J61B 2XNXB 1FZCB 1RE3B 2HLOA 1FZBA 1FZCC 2H43A 2OYHA 1LWUB 1RE3C 2Q9IA 1FZEB 1JY3O 1LTJB 2HODA 2HPCB 1FICA 1FZEC 2J61A 2XNXA 1LTJC 1FZCA 2J3GA 2HPCC 2J0GA 1W2EA 3GHGB 1FZAB 1LWUA 1LT9B 3GHGC 1LTJA 4EPUA 1FIDA 2HPCA 3GHGA 1T3UA 1FZAA 3HUSB 1LT9A 2J0HA 2JHMF 2JHLF 4M7HA 2J0YA 1FIBA 3HUSC 1N86C 2J1GA 1Z3UA 1JY3N 1RE4B 1Z3SA 4NYTA 2J3OA 1RE4C 1JY2P 1RF1B 3BVHB 2FFDC 1RE3A 1RF1C 4ZFGA 2JHIF 3BVHC 2WNPF 1FZEA 2OYIB 3E1IC 2OYIC 4M7FA 1RF1A 2Z4EC 4JYOX 2JHHC 1N86B 2OYIA 3FIBA 1M1JC 3H32C 2A45I 2J2PA 2J3UA 3HUSA 1N86A 2FFDB 1JY2O 2D39A 3E1IB 1FZFB 4R9TA 1RE4A 1RF0B 1FZFC 2FFDA 2Z4EB 1RF0C 3BVHA 2HODB 2OYHC 2J3FA 2Q9IC 3H32B 1M1JB 1JC9A 3E1IA 1FZFA 2HODC 1RF0A 2J64A 2XNXC 1FZGB 2Z4EA 2A45G 1JY3P 1FZGC 1LWUC 3H32A 1M1JA 1N73B 1FZDA
chains in the Genus database with same CATH superfamily
1N7SD 5KLVJ 5AW4B 1K73Q 3JC22 2C0WA 4W7YA 3O6QB 5CCHD 1AA0A 4GIFA 1IFPA 1L2PA 3C8VA 3H25A 2FBWC 2ZXXA 3PH0A 4Z1MH 4DOJA 1W5CE 4EYYQ 4UB8E 1L4AB 2I1KA 2H43C 1PGJA 1TU3F 1EXIA 2ZT9C 2P7JA 1LTJB 1KB9H 4WBAA 1FZCA 3AE9C 1S1CX 1KMIZ 2O01N 4YXWH 3HUSC 5AVUB 5APQA 1VQOP 1Z3UA 1Z3SA 4YTPC 1RF1B 2WSSH 1KILC 3EWKA 3CCVP 2BCCD 3ABVC 3E1IC 1SQQK 1H0TB 3HE4B 3R2PA 4WY4C 3PHLA 1NTME 4K3AA 1SLQA 3RGUA 5C39A 3A2AA 2O3JA 2FXOA 2BCCJ 2Q6QA 1NTMG 4NPEA 4H0LB 1SFCB 2WSEH 3CWBD 2WT7A 1R5SA 2E76B 3B5NC 5TISE 2K1AA 2WSCH 2IFNA 1CZQA 2M0BA 3Q5SA 2H43B 1AQ5A 1HGZA 1KILE 4YPCA 2ZT9B 2PFXA 3WU2E 5AVVB 3CWBJ 1MKMA 2ZVNB 3TDKA 4HB1A 3RK2C 4AUWA 5CCGC 3P7KA 3HUSB 3CX5E 1L4AD 3U1CA 3GMAA 2E74C 2QG4A 3JSVC 2JDIH 1S3JA 1KILB 2Q3EA 1NHLA 1GW4A 3BCCD 1PP9E 3CX5I 3RK3D 2JHHC 1N86B 2L91A 1QL2A 2HFED 2JP3A 2K9YA 4W80A 2J2PA 2OGUA 1OIPA 3V2NA 3Q1MA 1PP9G 3GF7A 2MJZA 1Z56A 2Z4EB 1URQA 4R4MA 3BCCJ 3L72E 3AE5C 2NRGA 2RN0A 2XNXC 2JWDA 3HD7A 5KLVK 1YITP 1AJYA 3CCQP 2KYVA 3VMZA 1FU1A 1SQQE 5KKZB 1P84I 3H1KG 2Q5UA 3HRNA 3GF3A 2KI7B 3USSA 2XNDH 1SFCD 3I5CA 5CBNA 4PD4H 3F89A 1GTWA 3GG2A 2QEXP 2J3GA 3H1HE 3S9OA 1NTMD 1IK7A 3RK2B 2KLUA 4EIJA 3GHGA 1J2JB 4L75A 2E74B 3AE3C 1NU1K 2ZT9D 2JJLA 3CC2P 5AW3B 2WITA 5AVYB 3Q2YA 1OMIA 1SQVK 1K05A 1NTMJ 4KHXA 3AE7C 2YKPA 3AE8C 3N4XA 2L5GB 2PAJA 5AVRB 5DJTB 2KS1B 2HYNA 2JEEA 1PL5A 2J3UA 2NZ2A 1KILD 3SFEC 1Q90D 2OYOA 1N2DC 2B87B 4RJTA 1T6AA 3U1AA 2UWJE 1H89A 1N7SA 1Y9BA 1QX8A 1S9KE 3H1JG 4WY4D 1JC9A 4OGQB 2P2UA 3CX5D 1M1JA 5AVZB 5AW1B 2R5DA 3MGNA 1NO4A 2HG5D 2JR8A 1QVFO 4N78E 1LT9C 1N73A 1PGOA 1G2CB 1GU5A 3JCUH 1JCDA 4N3YB 3BRVB 2R3CA 1SVFA 1BDCA 1LWUB 1LTGC 4Y28J 3B5ND 3VYIA 3NXSA 2HPCC 3AE2C 2J0GA 1FZAB 1HVVA 3A5TA 2QJPC 1X0TA 5KLVE 1VF5B 1FIBA 5APTA 1S72P 3AEEC 3IFMA 1PIXA 1NWQA 4LLHA 2QA4P 1P84D 3VMYA 1YQ3C 3L72D 2D2CC 1IFDA 3P8CE 1VQLP 1QGKB 2QIWA 2YIUC 1FZEA 1DEBA 3RK2D 5KJ7A 2OYIC 5KLVG 5CCGD 2VRSA 3G4SP 4JYOX 4OVNF 4LC1A 4N6JA 1PGQA 1SQQD 2K3RA 2V7QJ 3CMEP 2IX7C 2E74D 3A3YB 1PZQA 2V4HA 5E79H 1KTMA 3L72J 1KQSO 2FYZA 1NU1E 1KB9I 2N9YB 2Y9ZA 2NPSA 1RF0C 2P67A 3H1HD 4K35A 2Y9YA 1SQQJ 1HBWA 2A45G 3P8MC 2N1TC 1SQVE 1AFOA 1FZGA 3HTKA 3SWYA 3UIAA 1LTIC 5DJUB 5AW9B 2GY7A 2QE7H 3O6QA 3A0HH 2KUBA 3FWLA 3H1HJ 2WPRA 1FE6A 1SQVG 1BCCD 1HUCA 2ZYDA 1RE3C 2BCCE 3CXHH 2HPCB 3AEFC 4NPFX 1NKZB 1LTJA 2O1JA 2OQQA 2M8RA 5KAFE 2W6BA 2K9JB 1ZP0C 4M7HA 2BCCG 5AW8B 4IL6H 1S9KD 3CCMP 1BCCJ 2J3OA 2ZYAA 1JOCA 2JHIF 3BVHC 2OYIB 2O1KA 3M9HA 1JTHB 1RF1A 2IFMA 4N78D 1QEXA 4IL6X 1Y8AA 3HE4A 5KLIB 4D6TE 1NH4A 5APWA 1GK6A 1LJ2A 1RF0B 5CJ4A 1IJDB 2PGDA 3S1KA 1KYOH 2LKMA 2N1TB 2YNYA 1KD1Q 1NVOA 2QJKC 2KP8A 4D6TG 4BWNA 2YO2A 4UB6H 1E79H 3KZIH 1ZOYC 2POHA 1FS0E 4HJGH 2FIBA 1AVYA 3M0AA 2JHKF 3P8CD 2R44A 2Q9IB 3CL3D 3ZDMA 3II6A 1DD3A 2N9BA 1VQMP 1RE3B 3WUVA 2H43A 2P1JA 1KB9D 3PLNA 3KHUA 3M0DA 1EC5A 4EPUA 3G71P 3L36A 1LTTC 2AXCA 3NMDA 3L71D 5AW6B 1NU1D 3BCCG 2GA1A 1Q86Q 3TGUE 1PPJE 1RE4C 4EI2A 3BVHB 2FFDC 4C7NA 2WNPF 1ZMEC 1SQVD 1KILA 2P58A 5APVA 1SS1A 3CCRP 3TNUB 3RK3B 3QWOC 2QVAA 3H32C 3L37A 3L71J 3H1IE 1K04A 2D2CD 1PPJG 4YXDC 1HF9A 1NU1J 3M91A 1N86A 3CC4P 1YJNP 4JF7A 2ITAA 2IZ0A 3Q5PA 3BATA 1SQVJ 5KTBA 2WQYC 2Z4EA 1JY3P 1SQPK 1LNQA 1KV4A 2OARA 4GODA 3D71A 2W27A 3CC7P 1GL2A 2J3FD 3M9BA 2KNCB 1IFJA 2OYHB 2C0XA 3KQGA 3CLQA 4JYBA 2N1TD 3V4QA 4ASWA 3V6IA 3MIWA 2ZJSE 2W90A 1FIDA 2C9LY 2WSCJ 4RO0A 1UIXA 4D6TD 2J0YA 1EZVE 1YTZI 5BU5A 4RKUJ 1RE4B 5L8RJ 3JCUE 1OZHA 1JY2P 4ZFGA 1VQ7P 1FDMA 1MUUA 1EZVG 2QRXA 1EZVI 3CCSP 2HR3A 3I56P 4D6TJ 1N7LA 3RL0C 1VQKP 1VQ9P 1SP4A 2KS1A 2AEJA 1IZNB 1MV8A 3E1IB 2IPPA 5GTHE 4PJ0H 3EQ2A 4PV1C 2B87A 3RL0g 4GT1A 4WY4B 2H89C 1YQ4C 5B5EH 1FZDA 4IOIH 2G8YA 4HKZH 3M06A 4WWIA 3TGUD 3IF4A 1PPJD 1P84E 5E79E 2W8ZA 3L75E 1G2CA 3NTNA 1Q2NA 3B5NB 4IFFA 1LWUA 3H1ID 2AEMA 3L72G 1SQPE 3TGUJ 3VP8A 1FZAA 3L75G 1EXJA 2Y0CA 4JBZA 4LGDE 4UB8H 1LGHB 1SQQG 2QM8A 3A0HE 1NTZK 1URQC 1YIJP 1KQLA 1BDDA 1SQPG 1VQ6P 2Y0EA 2E42A 1JO5A 3H1IJ 3CXHE 4I2LC 1GZLA 3HD7C 1IFNA 3H1LE 1T8ZA 1NGMB 4ZNCA 3H1HG 1JNMA 1ZLLA 4XA4A 2ZYGA 4C46A 2H7HA 3CXHI 1FDIA 3NFQA 1BCCE 4IL6E 4PV1B 3H1LG 1KFNA 4QMAA 5APUA 2FKWB 2YMKA 1Q81Q 4C7RA 3L73E 1DD4A 1EZVD 1X9VA 2LR2A 4JZCA 4O9BA 1BCCG 3WUUA 5APXA 4EOTA 1RHZB 3L35A 3L74E 3L70E 5CCHA 2E5TA 2XNXB 1HH0A 3F5HA 1G1IA 4GOEA 1KYOE 1NYHA 3AEBC 1K9MQ 2PP6A 2HPCA 5AVWB 2CPSA 3L74G 2J58A 4R4LA 5TISH 4UB6E 2K9JA 5APSA 1ZW0A 1KYOI 4DJGA 3HE5B 1IFIA 1URQB 5AVXB 3CD6P 1X79B 2WPQA 3HD7B 1U7JA 1NTKK 1OW8A 3WUTA 2C9NY 2OYIA 1M1JC 5GTIH 2LXBA 1YBKA 1LP1B 2BEQD 1A02F 3L75D 3MP7B 3V2RA 1L0LK 2J5UA 1JMBA 3AECC 1FZFC 2I1JA 1KB9E 5AVTB 2J3FA 4WVZA 1RF0A 3SWKA 2YXQB 5AW7B 3RL0D 1DX7A 1SQPD 1OXZA 3V2QA 2A06D 2H8PD 3V5BA 2DW3A 3L71E 3AEDC 3L75J 4PV1D 2HLOC 2P10A 2JWAA 2XKMA 2J61B 5M1BA 3CXHD 3LW5J 2Q9IA 1W2BO 2HODA 1FZEC 3Q5RA 5KJ7C 1SQPJ 3L71G 5CMZA 3H1LD 2WMMA 1CI6A 2H88C 4HH2A 1LT9B 4JYCA 1NU1G 2YKOA 1IO4A 4L74A 1VL2A 2KSEA 4KJMA 2JHLF 2OTKE 2KXPB 5TJHA 1L4AA 1JY3N 1EDKA 1H88A 1NAFA 1S2EA 2QJYC 2NPSC 2WVRA 2QJPB 3L73D 1LTBC 2WSFH 3H1LJ 2IBZI 2WPSA 1BGYE 4M7FA 3MUDA 3FIBA 2MKVA 2YO3A 1FBMA 3TNUA 1IC2A 3GW6A 1LT1A 4BXLA 2D2CB 3L70D 3L74D 2W6AA 1OVVA 1URQD 3I55P 1PV3A 2YIUB 4JQ0D 2RKLA 3SSUA 1T3JA 1FZFB 4R9TA 1Q7YQ 1KYOD 1BE3E 2O01H 3L73J 3HD7D 5H2FH 1OVUA 4XE5B 1GW3A 4HYTB 1H0TA 4IFMA 3PRJA 2B89A 4U7JA 3L70J 3L74J 1JY2N 1NTKE 3K5BA 3O8ZA 1ZR4A 4A7PA 2YKQA 3SWFA 2HLOB 1BSHA 1M56D 1FZBC 5BU8B 1RH5B 1E5WA 3TK1A 3AE1C 2OYHA 4CPGA 1OVRA 1JY3O 1FZEB 1L0LE 3B71A 3LIDA 1FICA 4PJ0E 1JUNA 1NTKG 1SFCA 2Q1KA 1ZXGA 2WPVB 4BRYB 1JMMA 1L0NK 1MFTA 5B5EE 1AVOA 1RQUA 3MZWB 4GKGA 3EFGA 3R4YA 1L0LG 1R5LA 1JB0J 3T97B 3TF5A 1WMKA 1NTZD 4H44C 3LIEA 2M5AB 5KAIH 4H13D 1AQTA 4ZKPA 1XTCC 2ZVOB 4H0LC 2FYUK 3TSIA 1VQNP 2E76C 3HUSA 1HWTC 1BSNA 1JY2O 1FJPA 1S5LH 2R32A 1J1EC 3PJSK 4PD4E 1NTZJ 1EQ7A 1GDTA 3E1IA 2AXTH 3TGUG 3M0DC 1M90Q 2IBZD 4WY4A 2QSIA 4ZMDA 1S5LX 2XU6A 1WT6A 2CK3H 1A02J 4PD4I 2A45H 1FZBB 2KLVA 1JEKA 3MHVA 4RESB 3H1IG 4I7ZC 1FZCC 1BGYD 1FOSF 2QJKB 2E75C 1KFMA 1GU4A 2ZXEB 2I8DA 1SQXD 3B5NA 3CI9A 3OA7A 2KSJA 1N86C 3AEGC 2LXCB 2XV5A 1BE3D 5KJ7D 2WSEJ 1BGYJ 2R3SA 1EDJA 4H44B 1DIPA 3BRTB 1M7LA 3AEAC 3U59A 3CPWO 1HGVA 1FOSE 4DCKA 1SQXJ 2Z4EC 5AVQB 1QL1A 3CCEP 1NTKD 1KQFB 3CCUP 4OH8B 5CCGA 3IN6A 5KAFH 1FJKA 3P32A 1GL2C 2KZJA 1BE3J 1L0NE 2NPSD 3RBZA 2FFDB 1J1EB 3AE6C 4B86A 1FC2C 1T2KC 5KKZC 2BASA 1VQ4P 1L0LD 1YI2P 1SQBK 3H32B 1VDFA 2KB7P 4DZOA 1K8AQ 3FWNA 3KPEA 2GUVA 5B66H 1NTKJ 3G6EP 1L0NG 4TLFA 1AV1A 1KC8Q 5AW2B 1YHQP 5GTIE 3TYYA 1ZRTE 2FYUE 3C1LA 2XZRA 3N7NA 1L0LJ 2BEZF 3KYQA 3VOPA 4I7ZB 1FDOA 3A0BH 4TT3H 3ITKA 1YYCA 1FZCB 3D70A 4C7NB 3G3ZA 2E75B 2QM7A 2K88A 2XNXA 3W68A 4ASVA 3FX0A 4KT0J 2FYUG 4JPZB 1DH3A 4ZKUA 2W6JH 1NJIQ 2RH0A 1JCCA 1T3UA 4IFDK 1M57D 2E5YA 3B4SA 3KDPB 4PD4D 3PTZA 4NYTA 5CJ0A 1X22A 3H6PA 1OX3A 1YTZT 2JKVA 3HE5A 2GM4A 3H1KE 1RQVA 2PRRA 3OJAB 5CHXA 1YJ9P 2KOGA 2A06E 3V4WA 3B8EB 4OGQC 2W83C 1GL2B 2YMYA 2FYNC 3EFFK 4H44D 2Z5IA 1LP1A 1MZ9A 4MN4C 1LTSC 2J59M 2A06G 2WT7B 1ZN5A 4H0LD 5AW0B 2J64A 2FY8A 4U3FE 2E76D 3RL0B 2Z5HA 1LWUC 2B9BA 1U7MA 2J60A 1FZAC 1PFIA 5AW5B 1X8YA 1HJ0A 1QLED 3W67A 4L76A 1VF5C 4U3FG 2R5BA 2JO1A 2KK7A 1S4XA 2J61A 5H2FE 3VMAA 1W2EA 2M3BA 3GHGC 1SQBE 3BASA 1L0ND 2Y0DA 3SFDC 2JHMF 1LT9A 4I6MC 3H1JE 3L73G 2Q7CA 4W7ZA 3E1RA 2E75D 2J1GA 1R8EA 4GOFA 1OFCX 3KXDA 1SQBG 1KZUB 1VQPP 1UIIA 1SQXK 2AEFA 3D6ZA 3L70G 2SPZA 3D6YA 4H13C 2WWWA 1L0NJ 3Q3DA 1NAYA 3KZIE 1ZRTD 2FYUD 1OW7A 2FYNB 1NOHA 1N7SC 2Q3IA 2IYOA 3WU2H 1ZV8A 1VPCA 5CCHC 4AQRD 1IFMA 1FZFA 1PP9D 1JTHA 5KAIE 1GL2D 1RY3A 2FYUJ 3CX5H 4R9JA 1N73C 1T2KD 3S4RA 5BVZA 5K5GB 1VQ8P 2J5ZA 3MTUE 2FXMA 3CCLP 1IK9A 1KORA 3VMXA 1S5LE 2HLOA 3H1KD 5GTHH 1NTZE 3VP9A 1PP9J 1VQ5P 3V2PA 2G3AA 2XDJA 2ZAEB 3GHGB 2N1TA 2AXTE 1M8OB 1D7MA 4L73A 3C9IA 2V7QH 1PGPA 3MD0A 4NPDA 4BRYA 2M3EA 2B88A 1NTZG 1HTLC 2KZIA 1P84H 2WTYA 1M1KQ 1CW5A 1MFZA 3H1KJ 5KLIC 1ZR2A 1RE3A 1H8AA 4U3FD 4I1LA 1Y47A 4Y99C 3T97A 3WMM0 4H13B 3VN0A 2IBZE 2M5AA 3LW5H 1U57A 4AYCA 2A45I 1EDIA 1KN7A 5APYA 2CPBA 2OTJP 1N7SB 4WB4A 1CSBA 2IBZG 4U3FJ 2WSFJ 4OWFA 3BVHA 1G1JA 2Q9IC 2E43A 1M1JB 1SQBD 2HODC 4OGQD 1FZGC 1SQXE 1OW6A 1J1DC 4GDOA 1N73B 1USDA 3H1JD 3M9QA 3E7KA 3PP5A 2IYPA 1BGYG 2WZ7A 1HJBA 2FXPA 2RMZA 2O01J 1L4AC 1GMJA 1SQXG 1FZBA 1SQBJ 3IR9A 5AVSB 2KIKA 1LTJC 3QH9A 1N8RQ 1NTMK 3AE4C 1WRGA 5EFWB 1OWAA 5B66E 1BE3G 3H1JJ 3MUDC 2IZ1A 3CWBE 1GK4A 3A7OA 3RK3C 1VF5D 3CCJP 2J0HA 3OAKA 3CMAP 1Q82Q 2KNCA 3IAOA 1EDLA 4EDFA 3A0BE 1LTAC 3FGAD 1RF1C 3L4FA 4Y99B 3CWBG 1XTGB 2GUSA 1GD2E 1YJWP 2K37A 1DEEG 1USEA 3G9RA 5KLVD 3OW2O 2QJYB 2IDBA 5CBOA 2NPSB 3GLMA 2ZFCA 4M3LA 4XFJA 2D39A 1RE4A 2OTLP 2FFDA 1NKNA 1KQGB 1QVGO 2HODB 2OYHC 3RBXA 2YXRB 3FXDA 1JM0A 1FZGB 3HTKB 1CI6B 1SFCC 3VTPC 4DT0A 3BCCE 1J1DB 3H32A 1FAVA 3FXEA 3RK3E
chains in the Genus database with same CATH topology
1FZGA 1N7SD 3HTKA 3SWYA 1X9VA 5AW4B 4JZCA 4O9BA 2C0WA 4W7YA 5CCHD 3UIAA 3TYYA 4GIFA 5APXA 1LTIC 4EOTA 4DOJA 3L35A 2XZRA 3N7NA 1L4AB 5AW9B 3KYQA 2GY7A 2I1KA 3VOPA 2H43C 5CCHA 2XNXB 1YYCA 1FZCB 2WPRA 1HH0A 1G1IA 1HUCA 4C7NB 3G3ZA 2P7JA 1RE3C 2QM7A 1LTJB 2HPCB 4WBAA 2XNXA 1FZCA 1NKZB 1DH3A 4ZKUA 1LTJA 2O1JA 2PP6A 2HPCA 5AVWB 2M8RA 2CPSA 2W6BA 1JCCA 1T3UA 2J58A 4IFDK 4M7HA 3HUSC 5AW8B 5APSA 3KDPB 5AVUB 5APQA 1Z3UA 1S9KD 1Z3SA 4NYTA 2J3OA 3HE5B 1IFIA 1URQB 5CJ0A 1RF1B 1KILC 1JOCA 2JHIF 3BVHC 3H6PA 2OYIB 2O1KA 3M9HA 1YTZT 5AVXB 3E1IC 3HE5A 1X79B 2GM4A 2WPQA 1JTHB 5CHXA 3OJAB 1RF1A 2IFMA 3HD7B 1SQQK 3HE4B 1NTKK 2KOGA 2C9NY 4N78D 2OYIA 1M1JC 3R2PA 4WY4C 3V4WA 3B8EB 1GL2B 3HE4A 1SLQA 2YMYA 3A2AA 1A02F 1NH4A 5APWA 3V2RA 2Z5IA 1GK6A 1MZ9A 1L0LK 1LTSC 1RF0B 2J59M 5CJ4A 1FZFC 1IJDB 2WT7B 1ZN5A 2I1JA 2LKMA 5AVTB 2J3FA 5AW0B 1RF0A 2J64A 1SFCB 2N1TB 2YNYA 2WSEH 5AW7B 3RL0D 2WT7A 1DX7A 3RL0B 2Z5HA 1LWUC 2KP8A 1OXZA 3V2QA 2H8PD 3V5BA 3B5NC 2YO2A 2J60A 1FZAC 2POHA 5AW5B 2WSCH 1PFIA 2FIBA 1X8YA 1CZQA 2IFNA 3M0AA 2JHKF 3P8CD 2H43B 2Q9IB 2HLOC 1AQ5A 3CL3D 1HGZA 2XKMA 2J61B 3II6A 2R5BA 2N9BA 1RE3B 2H43A 2P1JA 5AVVB 2Q9IA 2HODA 1FZEC 2J61A 5KJ7C 5CMZA 1W2EA 2M3BA 3M0DA 1CI6A 4HH2A 3GHGC 1LT9B 4JYCA 4EPUA 2YKOA 3L36A 1IO4A 1LTTC 3RK2C 3BASA 4AUWA 3NMDA 5CCGC 3P7KA 3HUSB 2JHMF 1LT9A 1L4AD 3U1CA 2JHLF 5AW6B 4I6MC 2Q7CA 4W7ZA 2J1GA 1L4AA 1JY3N 1H88A 1NAFA 1KILB 1RE4C 3BVHB 1KZUB 2NPSC 2FFDC 4C7NA 1NHLA 1SQXK 1GW4A 2WNPF 1LTBC 2WSFH 1KILA 2WPSA 5APVA 4M7FA 3RK3D 3TNUB 3RK3B 2JHHC 2WWWA 1N86B 3MUDA 3FIBA 3H32C 2YO3A 3L37A 1FBMA 1QL2A 2HFED 3TNUA 4W80A 1IC2A 2J2PA 3M91A 1N86A 2W6AA 1NOHA 1URQD 1N7SC 3V2NA 4JF7A 2Q3IA 1T3JA 1FZFB 1ZV8A 1VPCA 5CCHC 2MJZA 4AQRD 4R9TA 1Z56A 2Z4EB 2O01H 1URQA 3HD7D 3BATA 5KTBA 1IFMA 1FZFA 2XNXC 4XE5B 2Z4EA 1JY3P 1GW3A 1JTHA 1SQPK 4HYTB 1GL2D 3HD7A 2OARA 5KLVK 1RY3A 4IFMA 2KYVA 4R9JA 1N73C 3VMZA 1FU1A 1T2KD 2W27A 1GL2A 1JY2N 5BVZA 2J3FD 3O8ZA 1ZR4A 3MTUE 2FXMA 2J5ZA 2YKQA 3SWFA 3M9BA 2Q5UA 3HRNA 2HLOB 1IFJA 2OYHB 1FZBC 1IK9A 2C0XA 5BU8B 3KQGA 3CLQA 3VMXA 1E5WA 1SFCD 3I5CA 2HLOA 2N1TD 4JYBA 3V4QA 3TK1A 2OYHA 3VP9A 1JY3O 1FZEB 1GTWA 3LIDA 3V2PA 1FICA 2XDJA 2J3GA 1JUNA 3GHGB 1SFCA 3MIWA 2N1TA 1FIDA 3RK2B 1JMMA 3C9IA 1L0NK 2C9LY 4EIJA 3GHGA 3MD0A 1J2JB 2J0YA 1NU1K 1YTZI 4GKGA 2JJLA 3EFGA 5BU5A 1HTLC 2WTYA 1RE4B 1CW5A 1MFZA 5AW3B 2WITA 1JY2P 1ZR2A 5AVYB 1RE3A 1H8AA 4ZFGA 1FDMA 4I1LA 1MUUA 3LIEA 1SQVK 4Y99C 3T97A 3WMM0 4KHXA 2YKPA 3N4XA 2L5GB 2PAJA 5AVRB 3VN0A 4ZKPA 1XTCC 3LW5H 2HYNA 4AYCA 2FYUK 2JEEA 2A45I 1N7LA 3TSIA 2J3UA 3RL0C 3HUSA 5APYA 2CPBA 1SP4A 1KILD 1HWTC 1N7SB 1JY2O 4WB4A 1FJPA 1N2DC 1MV8A 2R32A 3E1IB 1CSBA 1J1EC 2IPPA 3U1AA 1H89A 1N7SA 3EQ2A 3BVHA 1EQ7A 1G1JA 1S9KE 2Q9IC 2E43A 1M1JB 1GDTA 4WY4D 3E1IA 1JC9A 2HODC 4GT1A 4WY4B 3M0DC 1FZGC 2P2UA 1M1JA 4WY4A 1J1DC 1N73B 1FZDA 5AVZB 5AW1B 2R5DA 2XU6A 3MGNA 3M9QA 3PP5A 1NO4A 1WT6A 2HG5D 1A02J 4N78E 1LT9C 3M06A 2WZ7A 1N73A 2A45H 1G2CB 1HJBA 1FZBB 1GU5A 2KLVA 1JCDA 4N3YB 4RESB 1L4AC 3BRVB 1G2CA 2R3CA 1FZBA 1FZCC 1SVFA 1FOSF 3NTNA 1LWUB 1LTGC 3IR9A 5AVSB 3B5ND 3VYIA 3B5NB 1LTJC 1KFMA 3NXSA 4IFFA 1GU4A 2ZXEB 2HPCC 2J0GA 1NTMK 1FZAB 1LWUA 1HVVA 1WRGA 3A5TA 1OWAA 3B5NA 3CI9A 1GK4A 3A7OA 3VP8A 3RK3C 3OA7A 2KSJA 1FZAA 2J0HA 3OAKA 1FIBA 1N86C 5APTA 3IFMA 2XV5A 1NWQA 4LLHA 3VMYA 4LGDE 5KJ7D 1IFDA 1LGHB 3P8CE 2QM8A 1NTZK 1URQC 1LTAC 3BRTB 1RF1C 3L4FA 1M7LA 4Y99B 3U59A 1FZEA 1KQLA 1XTGB 1HGVA 1DEBA 2GUSA 3RK2D 5KJ7A 1FOSE 2E42A 2OYIC 1GD2E 1JO5A 5CCGD 2VRSA 4I2LC 2Z4EC 4JYOX 5AVQB 1GZLA 4LC1A 1QL1A 3HD7C 4N6JA 1IFNA 2IX7C 3A3YB 4OH8B 5CCGA 1T8ZA 1FJKA 3P32A 1GL2C 2NPSD 1JNMA 1ZLLA 2NPSB 4XA4A 2FFDB 2ZFCA 1J1EB 4M3LA 4C46A 4B86A 1T2KC 2H7HA 2D39A 2BASA 2FYZA 1RE4A 3NFQA 2NPSA 2FFDA 1RF0C 1NKNA 2P67A 2HODB 2OYHC 1KFNA 1SQBK 5APUA 3H32B 1VDFA 2FKWB 2KB7P 4DZOA 3KPEA 1FZGB 1HBWA 2GUVA 3HTKB 2A45G 1CI6B 4C7RA 1SFCC 3P8MC 3VTPC 2N1TC 1J1DB 3H32A 5AW2B 1FAVA 1AFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9J A;  1FZG A;  1N73 C;  2J60 A;  4JZC A;  1JY2 N;  1FZA C;  1LT9 C;  2J3F D;  2J5Z A;  2FIB A;  1N73 A;  2A45 H;  2JHK F;  2HLO B;  1FZB B;  2H43 B;  2OYH B;  2Q9I B;  2HLO C;  1FZB C;  2GY7 A;  2H43 C;  2J61 B;  2XNX B;  1FZC B;  1RE3 B;  2HLO A;  1FZB A;  1FZC C;  2H43 A;  2OYH A;  1LWU B;  1RE3 C;  2Q9I A;  1FZE B;  1JY3 O;  1LTJ B;  2HOD A;  2HPC B;  1FIC A;  1FZE C;  2J61 A;  2XNX A;  1LTJ C;  1FZC A;  2J3G A;  2HPC C;  2J0G A;  1W2E A;  3GHG B;  1FZA B;  1LWU A;  1LT9 B;  3GHG C;  1LTJ A;  4EPU A;  1FID A;  2HPC A;  3GHG A;  1T3U A;  1FZA A;  3HUS B;  1LT9 A;  2J0H A;  2JHM F;  2JHL F;  4M7H A;  2J0Y A;  1FIB A;  3HUS C;  1N86 C;  2J1G A;  1Z3U A;  1JY3 N;  1RE4 B;  1Z3S A;  4NYT A;  2J3O A;  1RE4 C;  1JY2 P;  1RF1 B;  3BVH B;  2FFD C;  1RE3 A;  1RF1 C;  4ZFG A;  2JHI F;  3BVH C;  2WNP F;  1FZE A;  2OYI B;  3E1I C;  2OYI C;  4M7F A;  1RF1 A;  2Z4E C;  4JYO X;  2JHH C;  1N86 B;  2OYI A;  3FIB A;  1M1J C;  3H32 C;  2A45 I;  2J2P A;  2J3U A;  3HUS A;  1N86 A;  2FFD B;  1JY2 O;  2D39 A;  3E1I B;  1FZF B;  4R9T A;  1RE4 A;  1RF0 B;  1FZF C;  2FFD A;  2Z4E B;  1RF0 C;  3BVH A;  2HOD B;  2OYH C;  2J3F A;  2Q9I C;  3H32 B;  1M1J B;  1JC9 A;  3E1I A;  1FZF A;  2HOD C;  1RF0 A;  2J64 A;  2XNX C;  1FZG B;  2Z4E A;  2A45 G;  1JY3 P;  1FZG C;  1LWU C;  3H32 A;  1M1J A;  1N73 B;  1FZD A; 
#chains in the Genus database with same CATH topology
 1N7S D;  5KLV J;  5AW4 B;  1K73 Q;  3JC2 2;  2C0W A;  4W7Y A;  3O6Q B;  5CCH D;  1AA0 A;  4GIF A;  1IFP A;  1L2P A;  3C8V A;  3H25 A;  2FBW C;  2ZXX A;  3PH0 A;  4Z1M H;  4DOJ A;  1W5C E;  4EYY Q;  4UB8 E;  1L4A B;  2I1K A;  2H43 C;  1PGJ A;  1TU3 F;  1EXI A;  2ZT9 C;  2P7J A;  1LTJ B;  1KB9 H;  4WBA A;  1FZC A;  3AE9 C;  1S1C X;  1KMI Z;  2O01 N;  4YXW H;  3HUS C;  5AVU B;  5APQ A;  1VQO P;  1Z3U A;  1Z3S A;  4YTP C;  1RF1 B;  2WSS H;  1KIL C;  3EWK A;  3CCV P;  2BCC D;  3ABV C;  3E1I C;  1SQQ K;  1H0T B;  3HE4 B;  3R2P A;  4WY4 C;  3PHL A;  1NTM E;  4K3A A;  1SLQ A;  3RGU A;  5C39 A;  3A2A A;  2O3J A;  2FXO A;  2BCC J;  2Q6Q A;  1NTM G;  4NPE A;  4H0L B;  1SFC B;  2WSE H;  3CWB D;  2WT7 A;  1R5S A;  2E76 B;  3B5N C;  5TIS E;  2K1A A;  2WSC H;  2IFN A;  1CZQ A;  2M0B A;  3Q5S A;  2H43 B;  1AQ5 A;  1HGZ A;  1KIL E;  4YPC A;  2ZT9 B;  2PFX A;  3WU2 E;  5AVV B;  3CWB J;  1MKM A;  2ZVN B;  3TDK A;  4HB1 A;  3RK2 C;  4AUW A;  5CCG C;  3P7K A;  3HUS B;  3CX5 E;  1L4A D;  3U1C A;  3GMA A;  2E74 C;  2QG4 A;  3JSV C;  2JDI H;  1S3J A;  1KIL B;  2Q3E A;  1NHL A;  1GW4 A;  3BCC D;  1PP9 E;  3CX5 I;  3RK3 D;  2JHH C;  1N86 B;  2L91 A;  1QL2 A;  2HFE D;  2JP3 A;  2K9Y A;  4W80 A;  2J2P A;  2OGU A;  1OIP A;  3V2N A;  3Q1M A;  1PP9 G;  3GF7 A;  2MJZ A;  1Z56 A;  2Z4E B;  1URQ A;  4R4M A;  3BCC J;  3L72 E;  3AE5 C;  2NRG A;  2RN0 A;  2XNX C;  2JWD A;  3HD7 A;  5KLV K;  1YIT P;  1AJY A;  3CCQ P;  2KYV A;  3VMZ A;  1FU1 A;  1SQQ E;  5KKZ B;  1P84 I;  3H1K G;  2Q5U A;  3HRN A;  3GF3 A;  2KI7 B;  3USS A;  2XND H;  1SFC D;  3I5C A;  5CBN A;  4PD4 H;  3F89 A;  1GTW A;  3GG2 A;  2QEX P;  2J3G A;  3H1H E;  3S9O A;  1NTM D;  1IK7 A;  3RK2 B;  2KLU A;  4EIJ A;  3GHG A;  1J2J B;  4L75 A;  2E74 B;  3AE3 C;  1NU1 K;  2ZT9 D;  2JJL A;  3CC2 P;  5AW3 B;  2WIT A;  5AVY B;  3Q2Y A;  1OMI A;  1SQV K;  1K05 A;  1NTM J;  4KHX A;  3AE7 C;  2YKP A;  3AE8 C;  3N4X A;  2L5G B;  2PAJ A;  5AVR B;  5DJT B;  2KS1 B;  2HYN A;  2JEE A;  1PL5 A;  2J3U A;  2NZ2 A;  1KIL D;  3SFE C;  1Q90 D;  2OYO A;  1N2D C;  2B87 B;  4RJT A;  1T6A A;  3U1A A;  2UWJ E;  1H89 A;  1N7S A;  1Y9B A;  1QX8 A;  1S9K E;  3H1J G;  4WY4 D;  1JC9 A;  4OGQ B;  2P2U A;  3CX5 D;  1M1J A;  5AVZ B;  5AW1 B;  2R5D A;  3MGN A;  1NO4 A;  2HG5 D;  2JR8 A;  1QVF O;  4N78 E;  1LT9 C;  1N73 A;  1PGO A;  1G2C B;  1GU5 A;  3JCU H;  1JCD A;  4N3Y B;  3BRV B;  2R3C A;  1SVF A;  1BDC A;  1LWU B;  1LTG C;  4Y28 J;  3B5N D;  3VYI A;  3NXS A;  2HPC C;  3AE2 C;  2J0G A;  1FZA B;  1HVV A;  3A5T A;  2QJP C;  1X0T A;  5KLV E;  1VF5 B;  1FIB A;  5APT A;  1S72 P;  3AEE C;  3IFM A;  1PIX A;  1NWQ A;  4LLH A;  2QA4 P;  1P84 D;  3VMY A;  1YQ3 C;  3L72 D;  2D2C C;  1IFD A;  3P8C E;  1VQL P;  1QGK B;  2QIW A;  2YIU C;  1FZE A;  1DEB A;  3RK2 D;  5KJ7 A;  2OYI C;  5KLV G;  5CCG D;  2VRS A;  3G4S P;  4JYO X;  4OVN F;  4LC1 A;  4N6J A;  1PGQ A;  1SQQ D;  2K3R A;  2V7Q J;  3CME P;  2IX7 C;  2E74 D;  3A3Y B;  1PZQ A;  2V4H A;  5E79 H;  1KTM A;  3L72 J;  1KQS O;  2FYZ A;  1NU1 E;  1KB9 I;  2N9Y B;  2Y9Z A;  2NPS A;  1RF0 C;  2P67 A;  3H1H D;  4K35 A;  2Y9Y A;  1SQQ J;  1HBW A;  2A45 G;  3P8M C;  2N1T C;  1SQV E;  1AFO A;  1FZG A;  3HTK A;  3SWY A;  3UIA A;  1LTI C;  5DJU B;  5AW9 B;  2GY7 A;  2QE7 H;  3O6Q A;  3A0H H;  2KUB A;  3FWL A;  3H1H J;  2WPR A;  1FE6 A;  1SQV G;  1BCC D;  1HUC A;  2ZYD A;  1RE3 C;  2BCC E;  3CXH H;  2HPC B;  3AEF C;  4NPF X;  1NKZ B;  1LTJ A;  2O1J A;  2OQQ A;  2M8R A;  5KAF E;  2W6B A;  2K9J B;  1ZP0 C;  4M7H A;  2BCC G;  5AW8 B;  4IL6 H;  1S9K D;  3CCM P;  1BCC J;  2J3O A;  2ZYA A;  1JOC A;  2JHI F;  3BVH C;  2OYI B;  2O1K A;  3M9H A;  1JTH B;  1RF1 A;  2IFM A;  4N78 D;  1QEX A;  4IL6 X;  1Y8A A;  3HE4 A;  5KLI B;  4D6T E;  1NH4 A;  5APW A;  1GK6 A;  1LJ2 A;  1RF0 B;  5CJ4 A;  1IJD B;  2PGD A;  3S1K A;  1KYO H;  2LKM A;  2N1T B;  2YNY A;  1KD1 Q;  1NVO A;  2QJK C;  2KP8 A;  4D6T G;  4BWN A;  2YO2 A;  4UB6 H;  1E79 H;  3KZI H;  1ZOY C;  2POH A;  1FS0 E;  4HJG H;  2FIB A;  1AVY A;  3M0A A;  2JHK F;  3P8C D;  2R44 A;  2Q9I B;  3CL3 D;  3ZDM A;  3II6 A;  1DD3 A;  2N9B A;  1VQM P;  1RE3 B;  3WUV A;  2H43 A;  2P1J A;  1KB9 D;  3PLN A;  3KHU A;  3M0D A;  1EC5 A;  4EPU A;  3G71 P;  3L36 A;  1LTT C;  2AXC A;  3NMD A;  3L71 D;  5AW6 B;  1NU1 D;  3BCC G;  2GA1 A;  1Q86 Q;  3TGU E;  1PPJ E;  1RE4 C;  4EI2 A;  3BVH B;  2FFD C;  4C7N A;  2WNP F;  1ZME C;  1SQV D;  1KIL A;  2P58 A;  5APV A;  1SS1 A;  3CCR P;  3TNU B;  3RK3 B;  3QWO C;  2QVA A;  3H32 C;  3L37 A;  3L71 J;  3H1I E;  1K04 A;  2D2C D;  1PPJ G;  4YXD C;  1HF9 A;  1NU1 J;  3M91 A;  1N86 A;  3CC4 P;  1YJN P;  4JF7 A;  2ITA A;  2IZ0 A;  3Q5P A;  3BAT A;  1SQV J;  5KTB A;  2WQY C;  2Z4E A;  1JY3 P;  1SQP K;  1LNQ A;  1KV4 A;  2OAR A;  4GOD A;  3D71 A;  2W27 A;  3CC7 P;  1GL2 A;  2J3F D;  3M9B A;  2KNC B;  1IFJ A;  2OYH B;  2C0X A;  3KQG A;  3CLQ A;  4JYB A;  2N1T D;  3V4Q A;  4ASW A;  3V6I A;  3MIW A;  2ZJS E;  2W90 A;  1FID A;  2C9L Y;  2WSC J;  4RO0 A;  1UIX A;  4D6T D;  2J0Y A;  1EZV E;  1YTZ I;  5BU5 A;  4RKU J;  1RE4 B;  5L8R J;  3JCU E;  1OZH A;  1JY2 P;  4ZFG A;  1VQ7 P;  1FDM A;  1MUU A;  1EZV G;  2QRX A;  1EZV I;  3CCS P;  2HR3 A;  3I56 P;  4D6T J;  1N7L A;  3RL0 C;  1VQK P;  1VQ9 P;  1SP4 A;  2KS1 A;  2AEJ A;  1IZN B;  1MV8 A;  3E1I B;  2IPP A;  5GTH E;  4PJ0 H;  3EQ2 A;  4PV1 C;  2B87 A;  3RL0 g;  4GT1 A;  4WY4 B;  2H89 C;  1YQ4 C;  5B5E H;  1FZD A;  4IOI H;  2G8Y A;  4HKZ H;  3M06 A;  4WWI A;  3TGU D;  3IF4 A;  1PPJ D;  1P84 E;  5E79 E;  2W8Z A;  3L75 E;  1G2C A;  3NTN A;  1Q2N A;  3B5N B;  4IFF A;  1LWU A;  3H1I D;  2AEM A;  3L72 G;  1SQP E;  3TGU J;  3VP8 A;  1FZA A;  3L75 G;  1EXJ A;  2Y0C A;  4JBZ A;  4LGD E;  4UB8 H;  1LGH B;  1SQQ G;  2QM8 A;  3A0H E;  1NTZ K;  1URQ C;  1YIJ P;  1KQL A;  1BDD A;  1SQP G;  1VQ6 P;  2Y0E A;  2E42 A;  1JO5 A;  3H1I J;  3CXH E;  4I2L C;  1GZL A;  3HD7 C;  1IFN A;  3H1L E;  1T8Z A;  1NGM B;  4ZNC A;  3H1H G;  1JNM A;  1ZLL A;  4XA4 A;  2ZYG A;  4C46 A;  2H7H A;  3CXH I;  1FDI A;  3NFQ A;  1BCC E;  4IL6 E;  4PV1 B;  3H1L G;  1KFN A;  4QMA A;  5APU A;  2FKW B;  2YMK A;  1Q81 Q;  4C7R A;  3L73 E;  1DD4 A;  1EZV D;  1X9V A;  2LR2 A;  4JZC A;  4O9B A;  1BCC G;  3WUU A;  5APX A;  4EOT A;  1RHZ B;  3L35 A;  3L74 E;  3L70 E;  5CCH A;  2E5T A;  2XNX B;  1HH0 A;  3F5H A;  1G1I A;  4GOE A;  1KYO E;  1NYH A;  3AEB C;  1K9M Q;  2PP6 A;  2HPC A;  5AVW B;  2CPS A;  3L74 G;  2J58 A;  4R4L A;  5TIS H;  4UB6 E;  2K9J A;  5APS A;  1ZW0 A;  1KYO I;  4DJG A;  3HE5 B;  1IFI A;  1URQ B;  5AVX B;  3CD6 P;  1X79 B;  2WPQ A;  3HD7 B;  1U7J A;  1NTK K;  1OW8 A;  3WUT A;  2C9N Y;  2OYI A;  1M1J C;  5GTI H;  2LXB A;  1YBK A;  1LP1 B;  2BEQ D;  1A02 F;  3L75 D;  3MP7 B;  3V2R A;  1L0L K;  2J5U A;  1JMB A;  3AEC C;  1FZF C;  2I1J A;  1KB9 E;  5AVT B;  2J3F A;  4WVZ A;  1RF0 A;  3SWK A;  2YXQ B;  5AW7 B;  3RL0 D;  1DX7 A;  1SQP D;  1OXZ A;  3V2Q A;  2A06 D;  2H8P D;  3V5B A;  2DW3 A;  3L71 E;  3AED C;  3L75 J;  4PV1 D;  2HLO C;  2P10 A;  2JWA A;  2XKM A;  2J61 B;  5M1B A;  3CXH D;  3LW5 J;  2Q9I A;  1W2B O;  2HOD A;  1FZE C;  3Q5R A;  5KJ7 C;  1SQP J;  3L71 G;  5CMZ A;  3H1L D;  2WMM A;  1CI6 A;  2H88 C;  4HH2 A;  1LT9 B;  4JYC A;  1NU1 G;  2YKO A;  1IO4 A;  4L74 A;  1VL2 A;  2KSE A;  4KJM A;  2JHL F;  2OTK E;  2KXP B;  5TJH A;  1L4A A;  1JY3 N;  1EDK A;  1H88 A;  1NAF A;  1S2E A;  2QJY C;  2NPS C;  2WVR A;  2QJP B;  3L73 D;  1LTB C;  2WSF H;  3H1L J;  2IBZ I;  2WPS A;  1BGY E;  4M7F A;  3MUD A;  3FIB A;  2MKV A;  2YO3 A;  1FBM A;  3TNU A;  1IC2 A;  3GW6 A;  1LT1 A;  4BXL A;  2D2C B;  3L70 D;  3L74 D;  2W6A A;  1OVV A;  1URQ D;  3I55 P;  1PV3 A;  2YIU B;  4JQ0 D;  2RKL A;  3SSU A;  1T3J A;  1FZF B;  4R9T A;  1Q7Y Q;  1KYO D;  1BE3 E;  2O01 H;  3L73 J;  3HD7 D;  5H2F H;  1OVU A;  4XE5 B;  1GW3 A;  4HYT B;  1H0T A;  4IFM A;  3PRJ A;  2B89 A;  4U7J A;  3L70 J;  3L74 J;  1JY2 N;  1NTK E;  3K5B A;  3O8Z A;  1ZR4 A;  4A7P A;  2YKQ A;  3SWF A;  2HLO B;  1BSH A;  1M56 D;  1FZB C;  5BU8 B;  1RH5 B;  1E5W A;  3TK1 A;  3AE1 C;  2OYH A;  4CPG A;  1OVR A;  1JY3 O;  1FZE B;  1L0L E;  3B71 A;  3LID A;  1FIC A;  4PJ0 E;  1JUN A;  1NTK G;  1SFC A;  2Q1K A;  1ZXG A;  2WPV B;  4BRY B;  1JMM A;  1L0N K;  1MFT A;  5B5E E;  1AVO A;  1RQU A;  3MZW B;  4GKG A;  3EFG A;  3R4Y A;  1L0L G;  1R5L A;  1JB0 J;  3T97 B;  3TF5 A;  1WMK A;  1NTZ D;  4H44 C;  3LIE A;  2M5A B;  5KAI H;  4H13 D;  1AQT A;  4ZKP A;  1XTC C;  2ZVO B;  4H0L C;  2FYU K;  3TSI A;  1VQN P;  2E76 C;  3HUS A;  1HWT C;  1BSN A;  1JY2 O;  1FJP A;  1S5L H;  2R32 A;  1J1E C;  3PJS K;  4PD4 E;  1NTZ J;  1EQ7 A;  1GDT A;  3E1I A;  2AXT H;  3TGU G;  3M0D C;  1M90 Q;  2IBZ D;  4WY4 A;  2QSI A;  4ZMD A;  1S5L X;  2XU6 A;  1WT6 A;  2CK3 H;  1A02 J;  4PD4 I;  2A45 H;  1FZB B;  2KLV A;  1JEK A;  3MHV A;  4RES B;  3H1I G;  4I7Z C;  1FZC C;  1BGY D;  1FOS F;  2QJK B;  2E75 C;  1KFM A;  1GU4 A;  2ZXE B;  2I8D A;  1SQX D;  3B5N A;  3CI9 A;  3OA7 A;  2KSJ A;  1N86 C;  3AEG C;  2LXC B;  2XV5 A;  1BE3 D;  5KJ7 D;  2WSE J;  1BGY J;  2R3S A;  1EDJ A;  4H44 B;  1DIP A;  3BRT B;  1M7L A;  3AEA C;  3U59 A;  3CPW O;  1HGV A;  1FOS E;  4DCK A;  1SQX J;  2Z4E C;  5AVQ B;  1QL1 A;  3CCE P;  1NTK D;  1KQF B;  3CCU P;  4OH8 B;  5CCG A;  3IN6 A;  5KAF H;  1FJK A;  3P32 A;  1GL2 C;  2KZJ A;  1BE3 J;  1L0N E;  2NPS D;  3RBZ A;  2FFD B;  1J1E B;  3AE6 C;  4B86 A;  1FC2 C;  1T2K C;  5KKZ C;  2BAS A;  1VQ4 P;  1L0L D;  1YI2 P;  1SQB K;  3H32 B;  1VDF A;  2KB7 P;  4DZO A;  1K8A Q;  3FWN A;  3KPE A;  2GUV A;  5B66 H;  1NTK J;  3G6E P;  1L0N G;  4TLF A;  1AV1 A;  1KC8 Q;  5AW2 B;  1YHQ P;  5GTI E;  3TYY A;  1ZRT E;  2FYU E;  3C1L A;  2XZR A;  3N7N A;  1L0L J;  2BEZ F;  3KYQ A;  3VOP A;  4I7Z B;  1FDO A;  3A0B H;  4TT3 H;  3ITK A;  1YYC A;  1FZC B;  3D70 A;  4C7N B;  3G3Z A;  2E75 B;  2QM7 A;  2K88 A;  2XNX A;  3W68 A;  4ASV A;  3FX0 A;  4KT0 J;  2FYU G;  4JPZ B;  1DH3 A;  4ZKU A;  2W6J H;  1NJI Q;  2RH0 A;  1JCC A;  1T3U A;  4IFD K;  1M57 D;  2E5Y A;  3B4S A;  3KDP B;  4PD4 D;  3PTZ A;  4NYT A;  5CJ0 A;  1X22 A;  3H6P A;  1OX3 A;  1YTZ T;  2JKV A;  3HE5 A;  2GM4 A;  3H1K E;  1RQV A;  2PRR A;  3OJA B;  5CHX A;  1YJ9 P;  2KOG A;  2A06 E;  3V4W A;  3B8E B;  4OGQ C;  2W83 C;  1GL2 B;  2YMY A;  2FYN C;  3EFF K;  4H44 D;  2Z5I A;  1LP1 A;  1MZ9 A;  4MN4 C;  1LTS C;  2J59 M;  2A06 G;  2WT7 B;  1ZN5 A;  4H0L D;  5AW0 B;  2J64 A;  2FY8 A;  4U3F E;  2E76 D;  3RL0 B;  2Z5H A;  1LWU C;  2B9B A;  1U7M A;  2J60 A;  1FZA C;  1PFI A;  5AW5 B;  1X8Y A;  1HJ0 A;  1QLE D;  3W67 A;  4L76 A;  1VF5 C;  4U3F G;  2R5B A;  2JO1 A;  2KK7 A;  1S4X A;  2J61 A;  5H2F E;  3VMA A;  1W2E A;  2M3B A;  3GHG C;  1SQB E;  3BAS A;  1L0N D;  2Y0D A;  3SFD C;  2JHM F;  1LT9 A;  4I6M C;  3H1J E;  3L73 G;  2Q7C A;  4W7Z A;  3E1R A;  2E75 D;  2J1G A;  1R8E A;  4GOF A;  1OFC X;  3KXD A;  1SQB G;  1KZU B;  1VQP P;  1UII A;  1SQX K;  2AEF A;  3D6Z A;  3L70 G;  2SPZ A;  3D6Y A;  4H13 C;  2WWW A;  1L0N J;  3Q3D A;  1NAY A;  3KZI E;  1ZRT D;  2FYU D;  1OW7 A;  2FYN B;  1NOH A;  1N7S C;  2Q3I A;  2IYO A;  3WU2 H;  1ZV8 A;  1VPC A;  5CCH C;  4AQR D;  1IFM A;  1FZF A;  1PP9 D;  1JTH A;  5KAI E;  1GL2 D;  1RY3 A;  2FYU J;  3CX5 H;  4R9J A;  1N73 C;  1T2K D;  3S4R A;  5BVZ A;  5K5G B;  1VQ8 P;  2J5Z A;  3MTU E;  2FXM A;  3CCL P;  1IK9 A;  1KOR A;  3VMX A;  1S5L E;  2HLO A;  3H1K D;  5GTH H;  1NTZ E;  3VP9 A;  1PP9 J;  1VQ5 P;  3V2P A;  2G3A A;  2XDJ A;  2ZAE B;  3GHG B;  2N1T A;  2AXT E;  1M8O B;  1D7M A;  4L73 A;  3C9I A;  2V7Q H;  1PGP A;  3MD0 A;  4NPD A;  4BRY A;  2M3E A;  2B88 A;  1NTZ G;  1HTL C;  2KZI A;  1P84 H;  2WTY A;  1M1K Q;  1CW5 A;  1MFZ A;  3H1K J;  5KLI C;  1ZR2 A;  1RE3 A;  1H8A A;  4U3F D;  4I1L A;  1Y47 A;  4Y99 C;  3T97 A;  3WMM 0;  4H13 B;  3VN0 A;  2IBZ E;  2M5A A;  3LW5 H;  1U57 A;  4AYC A;  2A45 I;  1EDI A;  1KN7 A;  5APY A;  2CPB A;  2OTJ P;  1N7S B;  4WB4 A;  1CSB A;  2IBZ G;  4U3F J;  2WSF J;  4OWF A;  3BVH A;  1G1J A;  2Q9I C;  2E43 A;  1M1J B;  1SQB D;  2HOD C;  4OGQ D;  1FZG C;  1SQX E;  1OW6 A;  1J1D C;  4GDO A;  1N73 B;  1USD A;  3H1J D;  3M9Q A;  3E7K A;  3PP5 A;  2IYP A;  1BGY G;  2WZ7 A;  1HJB A;  2FXP A;  2RMZ A;  2O01 J;  1L4A C;  1GMJ A;  1SQX G;  1FZB A;  1SQB J;  3IR9 A;  5AVS B;  2KIK A;  1LTJ C;  3QH9 A;  1N8R Q;  1NTM K;  3AE4 C;  1WRG A;  5EFW B;  1OWA A;  5B66 E;  1BE3 G;  3H1J J;  3MUD C;  2IZ1 A;  3CWB E;  1GK4 A;  3A7O A;  3RK3 C;  1VF5 D;  3CCJ P;  2J0H A;  3OAK A;  3CMA P;  1Q82 Q;  2KNC A;  3IAO A;  1EDL A;  4EDF A;  3A0B E;  1LTA C;  3FGA D;  1RF1 C;  3L4F A;  4Y99 B;  3CWB G;  1XTG B;  2GUS A;  1GD2 E;  1YJW P;  2K37 A;  1DEE G;  1USE A;  3G9R A;  5KLV D;  3OW2 O;  2QJY B;  2IDB A;  5CBO A;  2NPS B;  3GLM A;  2ZFC A;  4M3L A;  4XFJ A;  2D39 A;  1RE4 A;  2OTL P;  2FFD A;  1NKN A;  1KQG B;  1QVG O;  2HOD B;  2OYH C;  3RBX A;  2YXR B;  3FXD A;  1JM0 A;  1FZG B;  3HTK B;  1CI6 B;  1SFC C;  3VTP C;  4DT0 A;  3BCC E;  1J1D B;  3H32 A;  1FAV A;  3FXE A;  3RK3 E; 
#chains in the Genus database with same CATH homology
 1FZG A;  1N7S D;  3HTK A;  3SWY A;  1X9V A;  5AW4 B;  4JZC A;  4O9B A;  2C0W A;  4W7Y A;  5CCH D;  3UIA A;  3TYY A;  4GIF A;  5APX A;  1LTI C;  4EOT A;  4DOJ A;  3L35 A;  2XZR A;  3N7N A;  1L4A B;  5AW9 B;  3KYQ A;  2GY7 A;  2I1K A;  3VOP A;  2H43 C;  5CCH A;  2XNX B;  1YYC A;  1FZC B;  2WPR A;  1HH0 A;  1G1I A;  1HUC A;  4C7N B;  3G3Z A;  2P7J A;  1RE3 C;  2QM7 A;  1LTJ B;  2HPC B;  4WBA A;  2XNX A;  1FZC A;  1NKZ B;  1DH3 A;  4ZKU A;  1LTJ A;  2O1J A;  2PP6 A;  2HPC A;  5AVW B;  2M8R A;  2CPS A;  2W6B A;  1JCC A;  1T3U A;  2J58 A;  4IFD K;  4M7H A;  3HUS C;  5AW8 B;  5APS A;  3KDP B;  5AVU B;  5APQ A;  1Z3U A;  1S9K D;  1Z3S A;  4NYT A;  2J3O A;  3HE5 B;  1IFI A;  1URQ B;  5CJ0 A;  1RF1 B;  1KIL C;  1JOC A;  2JHI F;  3BVH C;  3H6P A;  2OYI B;  2O1K A;  3M9H A;  1YTZ T;  5AVX B;  3E1I C;  3HE5 A;  1X79 B;  2GM4 A;  2WPQ A;  1JTH B;  5CHX A;  3OJA B;  1RF1 A;  2IFM A;  3HD7 B;  1SQQ K;  3HE4 B;  1NTK K;  2KOG A;  2C9N Y;  4N78 D;  2OYI A;  1M1J C;  3R2P A;  4WY4 C;  3V4W A;  3B8E B;  1GL2 B;  3HE4 A;  1SLQ A;  2YMY A;  3A2A A;  1A02 F;  1NH4 A;  5APW A;  3V2R A;  2Z5I A;  1GK6 A;  1MZ9 A;  1L0L K;  1LTS C;  1RF0 B;  2J59 M;  5CJ4 A;  1FZF C;  1IJD B;  2WT7 B;  1ZN5 A;  2I1J A;  2LKM A;  5AVT B;  2J3F A;  5AW0 B;  1RF0 A;  2J64 A;  1SFC B;  2N1T B;  2YNY A;  2WSE H;  5AW7 B;  3RL0 D;  2WT7 A;  1DX7 A;  3RL0 B;  2Z5H A;  1LWU C;  2KP8 A;  1OXZ A;  3V2Q A;  2H8P D;  3V5B A;  3B5N C;  2YO2 A;  2J60 A;  1FZA C;  2POH A;  5AW5 B;  2WSC H;  1PFI A;  2FIB A;  1X8Y A;  1CZQ A;  2IFN A;  3M0A A;  2JHK F;  3P8C D;  2H43 B;  2Q9I B;  2HLO C;  1AQ5 A;  3CL3 D;  1HGZ A;  2XKM A;  2J61 B;  3II6 A;  2R5B A;  2N9B A;  1RE3 B;  2H43 A;  2P1J A;  5AVV B;  2Q9I A;  2HOD A;  1FZE C;  2J61 A;  5KJ7 C;  5CMZ A;  1W2E A;  2M3B A;  3M0D A;  1CI6 A;  4HH2 A;  3GHG C;  1LT9 B;  4JYC A;  4EPU A;  2YKO A;  3L36 A;  1IO4 A;  1LTT C;  3RK2 C;  3BAS A;  4AUW A;  3NMD A;  5CCG C;  3P7K A;  3HUS B;  2JHM F;  1LT9 A;  1L4A D;  3U1C A;  2JHL F;  5AW6 B;  4I6M C;  2Q7C A;  4W7Z A;  2J1G A;  1L4A A;  1JY3 N;  1H88 A;  1NAF A;  1KIL B;  1RE4 C;  3BVH B;  1KZU B;  2NPS C;  2FFD C;  4C7N A;  1NHL A;  1SQX K;  1GW4 A;  2WNP F;  1LTB C;  2WSF H;  1KIL A;  2WPS A;  5APV A;  4M7F A;  3RK3 D;  3TNU B;  3RK3 B;  2JHH C;  2WWW A;  1N86 B;  3MUD A;  3FIB A;  3H32 C;  2YO3 A;  3L37 A;  1FBM A;  1QL2 A;  2HFE D;  3TNU A;  4W80 A;  1IC2 A;  2J2P A;  3M91 A;  1N86 A;  2W6A A;  1NOH A;  1URQ D;  1N7S C;  3V2N A;  4JF7 A;  2Q3I A;  1T3J A;  1FZF B;  1ZV8 A;  1VPC A;  5CCH C;  2MJZ A;  4AQR D;  4R9T A;  1Z56 A;  2Z4E B;  2O01 H;  1URQ A;  3HD7 D;  3BAT A;  5KTB A;  1IFM A;  1FZF A;  2XNX C;  4XE5 B;  2Z4E A;  1JY3 P;  1GW3 A;  1JTH A;  1SQP K;  4HYT B;  1GL2 D;  3HD7 A;  2OAR A;  5KLV K;  1RY3 A;  4IFM A;  2KYV A;  4R9J A;  1N73 C;  3VMZ A;  1FU1 A;  1T2K D;  2W27 A;  1GL2 A;  1JY2 N;  5BVZ A;  2J3F D;  3O8Z A;  1ZR4 A;  3MTU E;  2FXM A;  2J5Z A;  2YKQ A;  3SWF A;  3M9B A;  2Q5U A;  3HRN A;  2HLO B;  1IFJ A;  2OYH B;  1FZB C;  1IK9 A;  2C0X A;  5BU8 B;  3KQG A;  3CLQ A;  3VMX A;  1E5W A;  1SFC D;  3I5C A;  2HLO A;  2N1T D;  4JYB A;  3V4Q A;  3TK1 A;  2OYH A;  3VP9 A;  1JY3 O;  1FZE B;  1GTW A;  3LID A;  3V2P A;  1FIC A;  2XDJ A;  2J3G A;  1JUN A;  3GHG B;  1SFC A;  3MIW A;  2N1T A;  1FID A;  3RK2 B;  1JMM A;  3C9I A;  1L0N K;  2C9L Y;  4EIJ A;  3GHG A;  3MD0 A;  1J2J B;  2J0Y A;  1NU1 K;  1YTZ I;  4GKG A;  2JJL A;  3EFG A;  5BU5 A;  1HTL C;  2WTY A;  1RE4 B;  1CW5 A;  1MFZ A;  5AW3 B;  2WIT A;  1JY2 P;  1ZR2 A;  5AVY B;  1RE3 A;  1H8A A;  4ZFG A;  1FDM A;  4I1L A;  1MUU A;  3LIE A;  1SQV K;  4Y99 C;  3T97 A;  3WMM 0;  4KHX A;  2YKP A;  3N4X A;  2L5G B;  2PAJ A;  5AVR B;  3VN0 A;  4ZKP A;  1XTC C;  3LW5 H;  2HYN A;  4AYC A;  2FYU K;  2JEE A;  2A45 I;  1N7L A;  3TSI A;  2J3U A;  3RL0 C;  3HUS A;  5APY A;  2CPB A;  1SP4 A;  1KIL D;  1HWT C;  1N7S B;  1JY2 O;  4WB4 A;  1FJP A;  1N2D C;  1MV8 A;  2R32 A;  3E1I B;  1CSB A;  1J1E C;  2IPP A;  3U1A A;  1H89 A;  1N7S A;  3EQ2 A;  3BVH A;  1EQ7 A;  1G1J A;  1S9K E;  2Q9I C;  2E43 A;  1M1J B;  1GDT A;  4WY4 D;  3E1I A;  1JC9 A;  2HOD C;  4GT1 A;  4WY4 B;  3M0D C;  1FZG C;  2P2U A;  1M1J A;  4WY4 A;  1J1D C;  1N73 B;  1FZD A;  5AVZ B;  5AW1 B;  2R5D A;  2XU6 A;  3MGN A;  3M9Q A;  3PP5 A;  1NO4 A;  1WT6 A;  2HG5 D;  1A02 J;  4N78 E;  1LT9 C;  3M06 A;  2WZ7 A;  1N73 A;  2A45 H;  1G2C B;  1HJB A;  1FZB B;  1GU5 A;  2KLV A;  1JCD A;  4N3Y B;  4RES B;  1L4A C;  3BRV B;  1G2C A;  2R3C A;  1FZB A;  1FZC C;  1SVF A;  1FOS F;  3NTN A;  1LWU B;  1LTG C;  3IR9 A;  5AVS B;  3B5N D;  3VYI A;  3B5N B;  1LTJ C;  1KFM A;  3NXS A;  4IFF A;  1GU4 A;  2ZXE B;  2HPC C;  2J0G A;  1NTM K;  1FZA B;  1LWU A;  1HVV A;  1WRG A;  3A5T A;  1OWA A;  3B5N A;  3CI9 A;  1GK4 A;  3A7O A;  3VP8 A;  3RK3 C;  3OA7 A;  2KSJ A;  1FZA A;  2J0H A;  3OAK A;  1FIB A;  1N86 C;  5APT A;  3IFM A;  2XV5 A;  1NWQ A;  4LLH A;  3VMY A;  4LGD E;  5KJ7 D;  1IFD A;  1LGH B;  3P8C E;  2QM8 A;  1NTZ K;  1URQ C;  1LTA C;  3BRT B;  1RF1 C;  3L4F A;  1M7L A;  4Y99 B;  3U59 A;  1FZE A;  1KQL A;  1XTG B;  1HGV A;  1DEB A;  2GUS A;  3RK2 D;  5KJ7 A;  1FOS E;  2E42 A;  2OYI C;  1GD2 E;  1JO5 A;  5CCG D;  2VRS A;  4I2L C;  2Z4E C;  4JYO X;  5AVQ B;  1GZL A;  4LC1 A;  1QL1 A;  3HD7 C;  4N6J A;  1IFN A;  2IX7 C;  3A3Y B;  4OH8 B;  5CCG A;  1T8Z A;  1FJK A;  3P32 A;  1GL2 C;  2NPS D;  1JNM A;  1ZLL A;  2NPS B;  4XA4 A;  2FFD B;  2ZFC A;  1J1E B;  4M3L A;  4C46 A;  4B86 A;  1T2K C;  2H7H A;  2D39 A;  2BAS A;  2FYZ A;  1RE4 A;  3NFQ A;  2NPS A;  2FFD A;  1RF0 C;  1NKN A;  2P67 A;  2HOD B;  2OYH C;  1KFN A;  1SQB K;  5APU A;  3H32 B;  1VDF A;  2FKW B;  2KB7 P;  4DZO A;  3KPE A;  1FZG B;  1HBW A;  2GUV A;  3HTK B;  2A45 G;  1CI6 B;  4C7R A;  1SFC C;  3P8M C;  3VTP C;  2N1T C;  1J1D B;  3H32 A;  5AW2 B;  1FAV A;  1AFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...