2OYIB

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
b'NSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 93
structure length 301
sequence length 301
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiB03
1FIDA 2A45G 1FZFA 2D39A 1RE4A 2J2PA 1N73C 1FZAB 1FZFC 1Z3UA 1M1JB 1RE4C 4M7FA 2FIBA 1RF1A 2HODB 2J3UA 1FZEB 1JY3O 2XNXB 1RF1C 2HLOB 1N86C 1JY3P 2H43C 1JC9A 3BVHB 1FZCA 3H32A 2FFDA 1RE3B 2OYHC 3GHGA 1FZBB 2JHHC 1JY3N 1W2EA 3HUSA 3H32C 1RF0B 4JYOX 2J64A 3HUSC 1N73A 3E1IB 2JHKF 4R9TA 1LWUB 1Z3SA 1LT9B 1FZDA 2J5ZA 1LTJB 4JZCA 1N86A 1FZGB 1FZAC 2H43A 2XNXA 2HODC 2OYHA 2XNXC 2Q9IB 4EPUA 2HLOC 2J0GA 2J1GA 2J61A 2J0YA 1RE3C 1FZBC 1RF0A 2J3FD 2Z4EB 2OYIB 1RF0C 2JHIF 1FZAA 3E1IC 1M1JA 2GY7A 1LWUC 2JHLF 2JHMF 2J0HA 1T3UA 2HODA 3H32B 2FFDB 2A45H 1FZCB 3GHGB 1FZEA 1M1JC 2J60A 1LTJC 2HPCB 1JY2O 2HLOA 1FZEC 1FZGC 1JY2P 3BVHA 1N73B 2Q9IA 2J3FA 1RE3A 1FZFB 1FICA 1FZBA 1RE4B 2J3OA 1JY2N 3BVHC 2Q9IC 2J3GA 2WNPF 1RF1B 2Z4EA 1N86B 3E1IA 2OYIA 4ZFGA 2H43B 4M7HA 1LWUA 2Z4EC 1LT9A 2OYHB 2OYIC 3FIBA 4R9JA 1LTJA 4NYTA 1LT9C 2J61B 1FZGA 3HUSB 1FIBA 2HPCA 2FFDC 1FZCC 3GHGC 2A45I 2HPCC
chains in the Genus database with same CATH superfamily
3TGUE 3CWBE 3L74D 3VMAA 2E75B 2QIWA 2YMKA 1FZAB 1BGYG 4K35A 1DIPA 1NTMG 3H1IE 2R32A 1NTKJ 2YO3A 2W6BA 5C39A 1S1CX 1S9KD 3AE3C 4LGDE 1EQ7A 1MZ9A 2LXCB 3V4QA 2PP6A 5APWA 1ZR4A 3L35A 1LTIC 2MJZA 2O01H 1YJNP 2R5DA 3HE5A 3MUDC 5CBNA 2HODC 1WMKA 2WTYA 1PP9J 3HE4A 4M3LA 5B66H 2J1GA 1YYCA 1NTKG 5TISE 1AV1A 3A0HE 3CX5E 4IL6H 1KFMA 1YI2P 1K9MQ 2E74C 2QVAA 3JCUE 2C9LY 1FZAA 1SQXK 5TJHA 5KLVE 4IFFA 1LWUC 1L2PA 1FZCB 2K9YA 1IFJA 2AXTE 3RK2D 1NAYA 3AEAC 2RH0A 4R4LA 2KYVA 1PP9G 4KHXA 2KUBA 3VP9A 1TU3F 3VTPC 3GMAA 1SQPD 5M1BA 2OGUA 3M06A 1QL1A 1G2CA 3V5BA 1JTHB 1HWTC 3P7KA 2LKMA 4B86A 1YTZI 1LGHB 2FYUD 1BE3J 2A45G 1DEEG 1RE4A 2WSEJ 2FIBA 2POHA 1J1EB 3RK2B 3II6A 3W68A 2FYNC 3L70J 1DX7A 4EIJA 5APXA 1JC9A 2K9JB 1FZCA 1T8ZA 5AW1B 3L75E 1VQ7P 2E76D 4DJGA 3TGUJ 4O9BA 1OVUA 2JHKF 4Z1MH 3AEFC 1BE3G 1FC2C 4Y99C 3SSUA 3ITKA 1GD2E 5AW3B 1MFTA 2QM7A 3CL3D 1GDTA 2WZ7A 1H8AA 1NTZD 2J0GA 4R4MA 2J5UA 1JTHA 3L70G 3G71P 3KZIE 3RL0D 1RE3C 2W6AA 3M0DC 2Z4EB 4WB4A 3H1HD 3TGUG 3BASA 2JHLF 3H1KD 3L74E 1N7LA 1J2JB 2HPCB 1J1DB 2YKPA 2P10A 1USDA 5CBOA 2K9JA 2H7HA 2GA1A 3LW5J 1M7LA 2R5BA 1SQBJ 1S9KE 3AE7C 2ZJSE 2XNDH 4R9JA 1QEXA 2YKOA 3RL0B 3MTUE 2JDIH 1KD1Q 2AEMA 1OX3A 2M3BA 3H25A 4BWNA 2KNCB 1ZMEC 2YIUB 3KPEA 3H1LE 3L72E 5AW2B 4I2LC 1EXJA 3ZDMA 2V7QH 1FDMA 5AVVB 1SQBG 1BGYD 1N86C 1EDKA 2OYOA 1NTMD 3BVHB 2WVRA 2O3JA 2Q5UA 2E42A 1HUCA 4H44B 3SWYA 2WSCJ 1OVVA 5AW6B 4KT0J 4HJGH 3C9IA 5AW0B 2I1KA 1ZRTE 3L75J 1SFCD 1SQPE 1SLQA 2KNCA 4UB8E 3TK1A 1NTKD 4GOFA 4HKZH 4XE5B 3A5TA 2D2CD 1FU1A 2A06E 4GIFA 3VMXA 5AW9B 4I7ZC 3RBXA 3VOPA 1IK7A 3BVHA 1NKZB 4YXDC 2FBWC 3L75G 1IK9A 5AVRB 1PP9D 1OW7A 1IFMA 4OGQC 2E74D 4RKUJ 5E79E 1HGZA 4NPDA 3N7NA 1M8OB 1UIIA 2FFDC 3NFQA 2WWWA 2D2CB 1VF5D 1FIDA 5AW7B 3AEDC 1N73C 1RE4C 1NTZE 2HODB 2WT7B 1UIXA 3W67A 4D6TJ 3HRNA 1IJDB 1JY3N 1KQGB 4JYBA 1R5LA 5AVXB 2E74B 3H1LJ 3L72J 3H1KE 3L73J 4R9TA 1LWUB 1Z3SA 4N6JA 4XA4A 1JCCA 2JEEA 2QRXA 1VF5B 1SFCA 1BE3D 1EC5A 5K5GB 5APSA 2ZVOB 2O1JA 2KLUA 5TISH 2BEZF 3CX5H 2GUSA 1CW5A 1VQPP 4D6TG 3B71A 4H13D 3JCUH 1Q81Q 3L70D 3Q5SA 3CC4P 3H1LG 3L72G 3L73G 1U7MA 1RQVA 3MUDA 2HODA 3TGUD 1HGVA 1VQMP 1YTZT 2M8RA 1FZGC 2CPBA 2Q7CA 1NTME 3V6IA 1NH4A 2FYNB 2YKQA 1LWUA 3I5CA 1H0TB 1LTSC 2QSIA 4PD4D 3C1LA 3G9RA 2H89C 2KSJA 4GT1A 2A45I 1G1JA 1FOSF 3SWFA 1NWQA 2WQYC 4Y99B 2D39A 3CI9A 1N7SD 4EDFA 1JY3O 2ITAA 5GTHE 2H43C 1NTKE 2A06G 1VQ9P 1PL5A 1RE3B 1SQBD 1ZP0C 2E76C 3HUSA 1SP4A 3CCUP 5B5EE 3EFGA 3BCCJ 2ZXXA 1VQKP 1NU1K 1URQD 3B4SA 4L73A 2YMYA 1FOSE 3P8CD 4L74A 1BDCA 2E43A 1H0TA 3WMM0 1KILE 2B87A 3KZIH 1PP9E 3PRJA 2KB7P 1IO4A 1FAVA 1NKNA 5CCGD 3GW6A 1KZUB 4BXLA 2CK3H 2OTKE 3AEBC 3BCCG 1CI6B 3ABVC 1LTTC 1HBWA 2J60A 4GODA 1RQUA 2KSEA 3JSVC 1Q7YQ 2SPZA 2ZT9C 5CHXA 1RE3A 2J3OA 1MKMA 3M0DA 3BVHC 3KDPB 2QM8A 1PGPA 1RHZB 2P2UA 1N86B 4PD4I 1SQQE 3L75D 2OYIA 1ZLLA 2C0WA 2W90A 4HYTB 4QMAA 2C9NY 4Y28J 1P84D 2AXCA 2Y0EA 1PPJE 3AE2C 1N7SA 4WBAA 3L37A 2IBZI 1AQTA 2WPRA 2JO1A 4OGQD 3HE4B 3U1AA 3L70E 1OZHA 3C8VA 1KQSO 3AECC 3SFEC 2J64A 2CPSA 1URQA 5KLVK 4I7ZB 4YPCA 1N86A 1VDFA 2N9BA 3Q3DA 2IYPA 2NZ2A 3HD7D 1SFCC 2Z5IA 2WPQA 2IDBA 1FJKA 5CCGA 4UB8H 2XZRA 4PD4E 4OGQB 3USSA 4WVZA 3D70A 2D2CC 4D6TD 1G2CB 1T3UA 2FFDB 3M9HA 3H1LD 3L72D 2E5TA 3L73D 3KHUA 3RK3D 4C7NB 5KKZC 1N73B 2Q9IA 1AVOA 3MIWA 1RE4B 1XTGB 4DZOA 1JY2N 2K3RA 4HH2A 2YNYA 1FDIA 2IBZE 2QE7H 1KILC 2XKMA 3V2NA 1SQBE 5E79H 1JOCA 1K73Q 1P84I 1MV8A 1BCCE 3K5BA 2B88A 2J61B 1VF5C 3CCVP 3L71E 3P8CE 1IC2A 1ZRTD 1SQQJ 1JY3P 2FFDA 1OVRA 3F5HA 1X79B 4C7NA 2A06D 1OIPA 1ZOYC 3HUSC 1NHLA 1N73A 5DJUB 1H89A 1LT9B 2J59M 5AW4B 3I56P 3H1JJ 3HD7A 1FZGB 3A3YB 1CZQA 2ZFCA 3KYQA 4H0LC 1SQQG 1DH3A 1PFIA 2J61A 3VYIA 1BSHA 3QH9A 5KAFH 4H13C 1RF0A 1X8YA 2P7JA 3WU2H 3Q5RA 3TNUA 1PPJG 2JWDA 1P84E 1SQXE 2B89A 3BCCD 2IZ0A 1JY2O 3EQ2A 3H1JG 1S5LX 5APYA 4AYCA 1SQVJ 4PJ0E 2VRSA 2JR8A 1FICA 1S3JA 4U7JA 4JF7A 1VQLP 2IYOA 2H43B 4DT0A 1YJWP 1LT9A 2OYIC 3M0AA 2E76B 2OTJP 3AEGC 1U57A 1FZGA 3BATA 4IFDK 3A0BE 2ZT9D 1Z56A 3HTKA 3FXEA 1M1JB 1SQVG 3L4FA 1N7SC 2PAJA 1ZN5A 5GTHH 2I1JA 1BCCJ 1Q82Q 2IFNA 1SQPK 3OAKA 5B5EH 4D6TE 3L71J 2LXBA 3OJAB 5H2FE 4GOEA 2WSSH 3L73E 2FYUK 3RK3E 1URQC 3AE9C 1OFCX 2BCCJ 5DJTB 5KLIC 3U59A 2IBZG 5KTBA 2H43A 2XNXA 2ZT9B 4W80A 1BCCG 4XFJA 5CCGC 2C0XA 1KMIZ 2OTLP 1HF9A 1AJYA 2Y9YA 3L71G 3PLNA 2YXRB 1M1JA 2GY7A 3CXHD 1VQNP 2A45H 1EZVG 2BCCG 1LT1A 3S9OA 5BU8B 1JCDA 3E1RA 4JPZB 2Q9IC 2J3GA 2OQQA 2E5YA 4EYYQ 5AVTB 3VP8A 4N78E 2O01N 2WPVB 1KQLA 1SQXJ 4NPEA 5CCHD 1GZLA 2IZ1A 1DD4A 3JC22 2WSEH 1JEKA 1LTBC 3WUTA 1KILD 2Y0CA 3I55P 1SFCB 2XDJA 3B5ND 1QVFO 4C46A 3AE5C 1SQXG 1XTCC 2Z5HA 4YXWH 1S5LE 3BCCE 2J58A 4HB1A 2KZJA 3O8ZA 2Q3IA 4GKGA 3HD7C 5KKZB 5AVZB 1L0NK 5KJ7D 1W5CE 1Q90D 3Q1MA 1SQQD 1LP1A 1KILB 1X9VA 4PD4H 1NTMK 3V2PA 3CXHI 1RF0C 2ZYDA 4PV1D 3B5NB 5CJ0A 4EI2A 1PPJD 3G6EP 4I1LA 3EWKA 3MHVA 1Q86Q 3RK3C 3VMZA 4H0LD 1L0LK 1JY2P 3O6QA 1Y9BA 3A0HH 3LW5H 3H1JD 1R8EA 2JWAA 4JYCA 1OXZA 2OARA 4ZKPA 1BSNA 4OVNF 5CCHA 2QJPC 1T2KD 1M57D 2AXTH 4NYTA 1LT9C 1K05A 3HUSB 1IZNB 1JB0J 2YO2A 2KZIA 1FZFA 1VQ4P 1KILA 3GLMA 1H88A 4H0LB 1SQVD 4ASWA 3CD6P 3R4YA 3B5NA 2B87B 2G8YA 2RN0A 2GM4A 1HVVA 2OYHC 1Y47A 2M5AA 4H13B 2ZYGA 1GK6A 3CXHE 2WSCH 3S4RA 4IOIH 4ZKUA 3N4XA 1FDOA 2MKVA 3AE8C 3KQGA 2WSFJ 3M9BA 5KJ7A 2O01J 3D6YA 2BEQD 1NOHA 2IBZD 3WUVA 2XNXC 2QJYC 4AQRD 1GK4A 1L4AC 2J3FD 1BCCD 3LIEA 1P84H 3CMEP 3L36A 2OYIB 1EDJA 1W2BO 1GU5A 1S72P 3L71D 3CCQP 2JHMF 1M1JC 1KORA 1PGOA 4PJ0H 3TSIA 1EZVD 2BCCD 1N7SB 5BVZA 2NPSD 1ZW0A 2KS1B 3P32A 1DEBA 5AW5B 2HYNA 3MZWB 3VN0A 3A0BH 1U7JA 1URQB 3D71A 5KLIB 1PIXA 5APVA 4C7RA 1SS1A 4M7FA 2P58A 1RF1A 4LLHA 3CC7P 2Q3EA 1E5WA 2WITA 4YTPC 1NYHA 2PRRA 3CCSP 1ZV8A 4JYOX 2HFED 3PJSK 1SQXD 2M0BA 2RKLA 1KYOD 1EDLA 3IR9A 2KS1A 4A7PA 1PGQA 3H1JE 4WY4D 3CCJP 1WRGA 2KOGA 2Q9IB 1L0NJ 3IF4A 1NAFA 2HLOC 2XU6A 1ZXGA 2J0YA 2QEXP 1SQBK 1FZBC 4UB6E 1FJPA 1DD3A 2GUVA 3BRVB 3E1IC 3MP7B 1M90Q 1EZVI 3GG2A 3S1KA 2IFMA 1HTLC 1L0LJ 3QWOC 1VQ6P 3V2RA 2NPSA 1HJ0A 1SQVE 4WY4B 1L0NG 3G3ZA 3A2AA 3UIAA 4M7HA 4OWFA 5CCHC 4U3FJ 4JQ0D 1GMJA 4W7ZA 4RO0A 2UWJE 2ZVNB 1KB9D 1G1IA 3FXDA 2AEFA 1FZFC 1L0LG 3HD7B 2WSFH 3MGNA 3CCLP 2V7QJ 3BRTB 3B5NC 2NRGA 2Q6QA 1KC8Q 1MFZA 2G3AA 1S5LH 1RF0B 1KYOI 1MUUA 1OW6A 4U3FG 2K1AA 4ASVA 3TNUB 1T6AA 3F89A 4WY4A 4CPGA 1EZVE 3RK3B 2BCCE 1JO5A 2JP3A 2W83C 3SWKA 5APQA 1GL2C 5KJ7C 2PGDA 3OW2O 1QLED 4KJMA 1OW8A 3AE6C 4N78D 4DCKA 1M1KQ 4WWIA 5GTIE 1JM0A 5AVSB 2QJPB 5APUA 4PV1C 2AEJA 2HR3A 3GF3A 1NU1J 4EOTA 3H32B 2IPPA 1USEA 3Q5PA 3FWLA 3HTKB 1GU4A 4OH8B 3Q2YA 1L4AD 4K3AA 3SFDC 1NGMB 1T2KC 2R44A 2OYHB 3WUUA 2BASA 5AVWB 1KB9I 4AUWA 1KYOE 1NU1G 1FS0E 2QJKC 3GHGC 1VQ5P 1YHQP 3CWBJ 5APTA 4IL6X 4TT3H 2J2PA 3IAOA 3OA7A 2R3SA 2YXQB 2XV5A 3H1IJ 2XNXB 1RF1C 2QJYB 1KN7A 1KFNA 1L4AB 3H32A 4LC1A 3AE4C 3CXHH 2QA4P 3B8EB 1N2DC 1YQ3C 1AFOA 2JJLA 1KTMA 3AE1C 2FXPA 1NJIQ 3CWBG 4BRYB 2J5ZA 3VMYA 1FE6A 2H88C 2L5GB 2JKVA 2KXPB 2OYHA 3H1IG 3NTNA 1X0TA 1IFDA 1GTWA 1JMBA 5KLVJ 4H44D 1JNMA 1QX8A 2Q1KA 1YIJP 1KB9E 1LTJC 5KAIE 2PFXA 3IFMA 1PZQA 2WPSA 3P8MC 1L4AA 1HH0A 1JMMA 4W7YA 2HG5D 2NPSC 2WNPF 1KV4A 1AQ5A 2RMZA 2KLVA 2Z4EA 3M9QA 4ZFGA 2B9BA 1L0ND 3FIBA 4BRYA 2O1KA 1IFIA 3EFFK 5KLVG 4L76A 2HPCA 1LTGC 2N1TD 2IX7C 4ZMDA 5EFWB 1NTZK 3TDKA 3E7KA 4NPFX 1FZEB 2I8DA 3FX0A 1L0LD 1LJ2A 2HLOB 1VPCA 2FKWB 2W27A 1SVFA 3FGAD 1LP1B 1FZBB 2JHHC 4DOJA 2DW3A 1W2EA 3E1IB 2Y0DA 4U3FD 1GW3A 3G4SP 3D6ZA 1T3JA 2FYUE 4WY4C 2E75C 5L8RJ 1FZAC 2N1TB 2FY8A 3O6QB 4ZNCA 4UB6H 3PHLA 5B66E 2ZXEB 1Q2NA 1WT6A 2LR2A 2JHIF 3CLQA 1A02F 1QVGO 1IFPA 4IL6E 3R2PA 3CMAP 3L74J 1D7MA 1IFNA 1FZEA 3FWNA 2H8PD 2HLOA 1GL2D 2KK7A 3TF5A 3GF7A 1FZFB 1FZBA 1QGKB 3E1IA 3NXSA 2V4HA 2M5AB 3MD0A 2QG4A 3H1HE 2N1TA 1LNQA 1FZCC 3L74G 1VQ8P 1KQFB 3PTZA 5BU5A 3PP5A 1NU1D 4RJTA 1RY3A 3IN6A 1S2EA 1GL2B 2J3UA 1NTKK 4TLFA 1QL2A 4GDOA 1HJBA 3H32C 4PV1B 1E79H 4MN4C 5KAFE 3WU2E 1FZDA 1GW4A 3H6PA 4JBZA 2R3CA 3V4WA 2WT7A 3CCRP 2WMMA 3CWBD 1EXIA 1J1EC 3RK2C 3CC2P 1SQPJ 1NO4A 1L0NE 5GTIH 1OWAA 1ZR2A 3H1ID 1BGYE 4I6MC 2KIKA 5AVUB 1BDDA 2FYUJ 1GL2A 3A7OA 3AEEC 2QJKB 3GHGB 4N3YB 3PH0A 3CPWO 1YJ9P 2Y9ZA 1L0LE 2FYZA 3M91A 1JUNA 1PGJA 1SQQK 1SQPG 1RF1B 2FXMA 1YITP 2W6JH 1VQOP 3RGUA 2L91A 2Z4EC 5CMZA 1KYOH 1X22A 3CX5D 1R5SA 4U3FE 2FYUG 5KLVD 2M3EA 2HPCC 1VL2A 2ZAEB 1J1DC 1K04A 1LTAC 1NTZJ 1Z3UA 1YQ4C 1OMIA 3T97B 3RL0g 1AVYA 3H1HJ 1FBMA 5CJ4A 3GHGA 1M56D 1CSBA 5AVQB 3RL0C 1A02J 3H1KJ 2P1JA 3V2QA 2P67A 2YIUC 3LIDA 1LTJB 4JZCA 1S4XA 1NVOA 1N8RQ 1NTZG 4RESB 1AA0A 1SQVK 2NPSB 4EPUA 2N9YB 1YBKA 3TYYA 5H2FH 3H1HG 2ZYAA 2KI7B 3CCMP 2W8ZA 3KXDA 4H44C 3H1KG 2KP8A 1KB9H 5KAIH 2J0HA 1Y8AA 4L75A 2E75D 1NU1E 1PV3A 1FZEC 3T97A 4IFMA 1EDIA 2J3FA 1BGYJ 1BE3E 1RH5B 1K8AQ 1NTMJ 5AW8B 2K37A 3CX5I 3HE5B 3U1CA 1CI6A 1LTJA 2K88A 3CCEP 3RBZA 1FIBA 5AVYB 3NMDA 2FXOA 2N1TC
chains in the Genus database with same CATH topology
5APTA 1NWQA 2WSEH 1LTBC 4Y99B 2D39A 2J2PA 3CI9A 3OA7A 1FZAB 2XV5A 1KILD 1N7SD 1SFCB 1JY3O 2XNXB 1RF1C 2XDJA 2R32A 2H43C 2YO3A 1KFNA 1L4AB 2W6BA 1RE3B 3H32A 4LC1A 1S9KD 3B5ND 4C46A 4LGDE 3HUSA 1SP4A 3B8EB 1EQ7A 1XTCC 1MZ9A 2Z5HA 3EFGA 1N2DC 3V4QA 2PP6A 1AFOA 2J58A 2JJLA 5APWA 1ZR4A 3O8ZA 1NU1K 1URQD 3L35A 2J5ZA 1LTIC 2MJZA 2O01H 3VMYA 2R5DA 2YMYA 2Q3IA 4GKGA 3HE5A 1FOSE 3HD7C 2L5GB 2HODC 3P8CD 5AVZB 2OYHA 2WTYA 2E43A 3WMM0 1L0NK 3HE4A 5KJ7D 3NTNA 4M3LA 2J1GA 1KILB 1YYCA 1X9VA 2KB7P 1NTMK 3V2PA 1IO4A 1FAVA 1NKNA 5CCGD 1KZUB 1IFDA 1GTWA 1KFMA 1RF0C 2C9LY 1JNMA 1FZAA 3B5NB 1CI6B 1SQXK 5CJ0A 4IFFA 1LWUC 1FZCB 4I1LA 1LTTC 1HBWA 2J60A 1LTJC 3RK3C 1IFJA 3VMZA 3IFMA 3RK2D 1L0LK 1JY2P 2WPSA 3P8MC 1L4AA 1HH0A 5CHXA 1RE3A 3LW5H 2J3OA 3M0DA 2KYVA 3BVHC 1JMMA 4W7YA 2HG5D 4JYCA 2NPSC 1OXZA 2WNPF 3KDPB 1AQ5A 2QM8A 4KHXA 2KLVA 2OARA 2P2UA 4ZKPA 3VP9A 2Z4EA 1N86B 3VTPC 3M9QA 2OYIA 4ZFGA 1ZLLA 5CCHA 2C0WA 1T2KD 3FIBA 4HYTB 3M06A 4NYTA 1LT9C 1QL1A 2O1KA 1G2CA 3V5BA 1IFIA 1JTHB 3HUSB 1HWTC 3P7KA 2C9NY 2HPCA 2LKMA 1LTGC 4B86A 1YTZI 1LGHB 2N1TD 2A45G 2IX7C 2YO2A 1FZFA 1KILA 1RE4A 1NTZK 1N7SA 4WBAA 3L37A 1H88A 2FIBA 2POHA 1J1EB 3RK2B 1FZEB 2WPRA 3II6A 2HLOB 1VPCA 3HE4B 3B5NA 2FKWB 2W27A 3U1AA 4EIJA 5APXA 1DX7A 1SVFA 1JC9A 2GM4A 1FZCA 1HVVA 1T8ZA 5AW1B 2OYHC 1FZBB 2JHHC 4DOJA 1W2EA 2J64A 1GK6A 2WSCH 4O9BA 2CPSA 3E1IB 1URQA 2JHKF 5KLVK 1GW3A 4ZKUA 3N4XA 1T3JA 4Y99C 4WY4C 3KQGA 1N86A 1VDFA 1FZAC 3M9BA 2N9BA 5KJ7A 1GD2E 5AW3B 2N1TB 1NOHA 2QM7A 3HD7D 3CL3D 1GDTA 1SFCC 2WZ7A 1H8AA 2XNXC 2Z5IA 2WPQA 4AQRD 1FJKA 2J0GA 5CCGA 1JTHA 1GK4A 1L4AC 2XZRA 3RL0D 1RE3C 2W6AA 2J3FD 2ZXEB 3M0DC 3LIEA 2Z4EB 1WT6A 3L36A 4WB4A 2OYIB 2JHIF 3CLQA 1A02F 1GU5A 3BASA 3R2PA 1G2CB 2JHLF 2JHMF 1T3UA 2FFDB 1IFNA 1FZEA 1M1JC 1N7LA 1J2JB 3M9HA 2HPCB 2H8PD 1J1DB 1GL2D 2HLOA 3RK3D 3TSIA 4C7NB 2YKPA 1N73B 2Q9IA 2H7HA 1FZFB 1FZBA 3MIWA 1RE4B 1XTGB 4DZOA 1JY2N 1M7LA 4HH2A 1N7SB 5BVZA 2YNYA 2R5BA 2NPSD 1KILC 2XKMA 3P32A 3V2NA 1DEBA 1S9KE 3E1IA 5AW5B 1JOCA 2HYNA 3NXSA 1MV8A 3VN0A 4R9JA 2YKOA 3RL0B 3MD0A 3MTUE 2J61B 2M3BA 2N1TA 1FZCC 3KPEA 1URQB 5BU5A 3PP5A 1RY3A 3P8CE 5AW2B 5APVA 4C7RA 1IC2A 4I2LC 4M7FA 1RF1A 1GL2B 2J3UA 4LLHA 1FDMA 1NTKK 5AVVB 1N86C 1JY3P 1E5WA 2WITA 1QL2A 3BVHB 2FFDA 1HJBA 1X79B 3H32C 1ZV8A 2Q5UA 4JYOX 4C7NA 2HFED 2E42A 1HUCA 3HUSC 1NHLA 3SWYA 1N73A 1H89A 1LT9B 2J59M 5AW6B 1FZDA 5AW4B 1GW4A 3H6PA 3IR9A 3HD7A 2R3CA 3V4WA 1FZGB 4WY4D 3A3YB 2WT7A 1CZQA 2ZFCA 3C9IA 3KYQA 5AW0B 2I1KA 1J1EC 3RK2C 1WRGA 2KOGA 1DH3A 1PFIA 2Q9IB 1SFCD 1NAFA 2HLOC 2J61A 1NO4A 2XU6A 3VYIA 1OWAA 1SLQA 1ZR2A 2J0YA 1SQBK 4I6MC 1FZBC 1RF0A 3TK1A 1X8YA 2P7JA 5AVUB 3TNUA 1FJPA 4XE5B 3A5TA 2GUVA 3BRVB 1FU1A 3E1IC 4GIFA 3VMXA 5AW9B 1GL2A 3A7OA 3GHGB 4N3YB 3VOPA 1JY2O 3EQ2A 5APYA 2IFMA 1HTLC 3BVHA 4AYCA 1NKZB 3V2RA 2NPSA 1FICA 2VRSA 2FYZA 4WY4B 3M91A 1JUNA 3G3ZA 1SQQK 1IK9A 2FXMA 5AVRB 4JF7A 1RF1B 3A2AA 2H43B 3UIAA 4M7HA 2Z4EC 1IFMA 1LT9A 2OYIC 3M0AA 5CMZA 1HGZA 5CCHC 3N7NA 1FZGA 3BATA 4W7ZA 2FFDC 4IFDK 3NFQA 2WWWA 2HPCC 1FIDA 1J1DC 1Z56A 3HTKA 5AW7B 1G1IA 1N73C 1LTAC 1FZFC 1Z3UA 1M1JB 1RE4C 3HD7B 3L4FA 2WSFH 1N7SC 2HODB 2WT7B 2PAJA 1ZN5A 3MGNA 2I1JA 2IFNA 3BRTB 1SQPK 1FBMA 3OAKA 3B5NC 1IJDB 3HRNA 3GHGA 5CJ4A 1JY3N 1CSBA 4JYBA 1MFZA 5AVQB 3RL0C 1RF0B 3OJAB 1A02J 1MUUA 5AVXB 3TNUB 2P1JA 3V2QA 4R9TA 1LWUB 2P67A 1Z3SA 2FYUK 4WY4A 1URQC 4N6JA 3LIDA 3U59A 4XA4A 1LTJB 3RK3B 1JO5A 4JZCA 5KTBA 1JCCA 2JEEA 2H43A 1SFCA 5APQA 2XNXA 4RESB 1GL2C 5KJ7C 5APSA 4W80A 2O1JA 1SQVK 2NPSB 4EPUA 3TYYA 4N78D 5CCGC 2C0XA 2GUSA 1CW5A 5AVSB 5APUA 2KP8A 1M1JA 2GY7A 3MUDA 4EOTA 2J0HA 2HODA 3H32B 2A45H 2IPPA 1HGVA 1YTZT 2M8RA 1FZEC 3T97A 1FZGC 5BU8B 4IFMA 1JCDA 2J3FA 3HTKB 1GU4A 4OH8B 2Q9IC 2J3GA 2CPBA 1L4AD 5AW8B 2Q7CA 1NH4A 5AVTB 3VP8A 2YKQA 3HE5B 4N78E 1LWUA 1T2KC 3I5CA 3U1CA 2OYHB 1KQLA 2BASA 1CI6A 1LTJA 1LTSC 5AVWB 5CCHD 1GZLA 1FIBA 5AVYB 4AUWA 3NMDA 2KSJA 3GHGC 4GT1A 2A45I 1G1JA 1FOSF 2N1TC 3SWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FID A;  2A45 G;  1FZF A;  2D39 A;  1RE4 A;  2J2P A;  1N73 C;  1FZA B;  1FZF C;  1Z3U A;  1M1J B;  1RE4 C;  4M7F A;  2FIB A;  1RF1 A;  2HOD B;  2J3U A;  1FZE B;  1JY3 O;  2XNX B;  1RF1 C;  2HLO B;  1N86 C;  1JY3 P;  2H43 C;  1JC9 A;  3BVH B;  1FZC A;  3H32 A;  2FFD A;  1RE3 B;  2OYH C;  3GHG A;  1FZB B;  2JHH C;  1JY3 N;  1W2E A;  3HUS A;  3H32 C;  1RF0 B;  4JYO X;  2J64 A;  3HUS C;  1N73 A;  3E1I B;  2JHK F;  4R9T A;  1LWU B;  1Z3S A;  1LT9 B;  1FZD A;  2J5Z A;  1LTJ B;  4JZC A;  1N86 A;  1FZG B;  1FZA C;  2H43 A;  2XNX A;  2HOD C;  2OYH A;  2XNX C;  2Q9I B;  4EPU A;  2HLO C;  2J0G A;  2J1G A;  2J61 A;  2J0Y A;  1RE3 C;  1FZB C;  1RF0 A;  2J3F D;  2Z4E B;  2OYI B;  1RF0 C;  2JHI F;  1FZA A;  3E1I C;  1M1J A;  2GY7 A;  1LWU C;  2JHL F;  2JHM F;  2J0H A;  1T3U A;  2HOD A;  3H32 B;  2FFD B;  2A45 H;  1FZC B;  3GHG B;  1FZE A;  1M1J C;  2J60 A;  1LTJ C;  2HPC B;  1JY2 O;  2HLO A;  1FZE C;  1FZG C;  1JY2 P;  3BVH A;  1N73 B;  2Q9I A;  2J3F A;  1RE3 A;  1FZF B;  1FIC A;  1FZB A;  1RE4 B;  2J3O A;  1JY2 N;  3BVH C;  2Q9I C;  2J3G A;  2WNP F;  1RF1 B;  2Z4E A;  1N86 B;  3E1I A;  2OYI A;  4ZFG A;  2H43 B;  4M7H A;  1LWU A;  2Z4E C;  1LT9 A;  2OYH B;  2OYI C;  3FIB A;  4R9J A;  1LTJ A;  4NYT A;  1LT9 C;  2J61 B;  1FZG A;  3HUS B;  1FIB A;  2HPC A;  2FFD C;  1FZC C;  3GHG C;  2A45 I;  2HPC C; 
#chains in the Genus database with same CATH topology
 3TGU E;  3CWB E;  3L74 D;  3VMA A;  2E75 B;  2QIW A;  2YMK A;  1FZA B;  1BGY G;  4K35 A;  1DIP A;  1NTM G;  3H1I E;  2R32 A;  1NTK J;  2YO3 A;  2W6B A;  5C39 A;  1S1C X;  1S9K D;  3AE3 C;  4LGD E;  1EQ7 A;  1MZ9 A;  2LXC B;  3V4Q A;  2PP6 A;  5APW A;  1ZR4 A;  3L35 A;  1LTI C;  2MJZ A;  2O01 H;  1YJN P;  2R5D A;  3HE5 A;  3MUD C;  5CBN A;  2HOD C;  1WMK A;  2WTY A;  1PP9 J;  3HE4 A;  4M3L A;  5B66 H;  2J1G A;  1YYC A;  1NTK G;  5TIS E;  1AV1 A;  3A0H E;  3CX5 E;  4IL6 H;  1KFM A;  1YI2 P;  1K9M Q;  2E74 C;  2QVA A;  3JCU E;  2C9L Y;  1FZA A;  1SQX K;  5TJH A;  5KLV E;  4IFF A;  1LWU C;  1L2P A;  1FZC B;  2K9Y A;  1IFJ A;  2AXT E;  3RK2 D;  1NAY A;  3AEA C;  2RH0 A;  4R4L A;  2KYV A;  1PP9 G;  4KHX A;  2KUB A;  3VP9 A;  1TU3 F;  3VTP C;  3GMA A;  1SQP D;  5M1B A;  2OGU A;  3M06 A;  1QL1 A;  1G2C A;  3V5B A;  1JTH B;  1HWT C;  3P7K A;  2LKM A;  4B86 A;  1YTZ I;  1LGH B;  2FYU D;  1BE3 J;  2A45 G;  1DEE G;  1RE4 A;  2WSE J;  2FIB A;  2POH A;  1J1E B;  3RK2 B;  3II6 A;  3W68 A;  2FYN C;  3L70 J;  1DX7 A;  4EIJ A;  5APX A;  1JC9 A;  2K9J B;  1FZC A;  1T8Z A;  5AW1 B;  3L75 E;  1VQ7 P;  2E76 D;  4DJG A;  3TGU J;  4O9B A;  1OVU A;  2JHK F;  4Z1M H;  3AEF C;  1BE3 G;  1FC2 C;  4Y99 C;  3SSU A;  3ITK A;  1GD2 E;  5AW3 B;  1MFT A;  2QM7 A;  3CL3 D;  1GDT A;  2WZ7 A;  1H8A A;  1NTZ D;  2J0G A;  4R4M A;  2J5U A;  1JTH A;  3L70 G;  3G71 P;  3KZI E;  3RL0 D;  1RE3 C;  2W6A A;  3M0D C;  2Z4E B;  4WB4 A;  3H1H D;  3TGU G;  3BAS A;  2JHL F;  3H1K D;  3L74 E;  1N7L A;  1J2J B;  2HPC B;  1J1D B;  2YKP A;  2P10 A;  1USD A;  5CBO A;  2K9J A;  2H7H A;  2GA1 A;  3LW5 J;  1M7L A;  2R5B A;  1SQB J;  1S9K E;  3AE7 C;  2ZJS E;  2XND H;  4R9J A;  1QEX A;  2YKO A;  3RL0 B;  3MTU E;  2JDI H;  1KD1 Q;  2AEM A;  1OX3 A;  2M3B A;  3H25 A;  4BWN A;  2KNC B;  1ZME C;  2YIU B;  3KPE A;  3H1L E;  3L72 E;  5AW2 B;  4I2L C;  1EXJ A;  3ZDM A;  2V7Q H;  1FDM A;  5AVV B;  1SQB G;  1BGY D;  1N86 C;  1EDK A;  2OYO A;  1NTM D;  3BVH B;  2WVR A;  2O3J A;  2Q5U A;  2E42 A;  1HUC A;  4H44 B;  3SWY A;  2WSC J;  1OVV A;  5AW6 B;  4KT0 J;  4HJG H;  3C9I A;  5AW0 B;  2I1K A;  1ZRT E;  3L75 J;  1SFC D;  1SQP E;  1SLQ A;  2KNC A;  4UB8 E;  3TK1 A;  1NTK D;  4GOF A;  4HKZ H;  4XE5 B;  3A5T A;  2D2C D;  1FU1 A;  2A06 E;  4GIF A;  3VMX A;  5AW9 B;  4I7Z C;  3RBX A;  3VOP A;  1IK7 A;  3BVH A;  1NKZ B;  4YXD C;  2FBW C;  3L75 G;  1IK9 A;  5AVR B;  1PP9 D;  1OW7 A;  1IFM A;  4OGQ C;  2E74 D;  4RKU J;  5E79 E;  1HGZ A;  4NPD A;  3N7N A;  1M8O B;  1UII A;  2FFD C;  3NFQ A;  2WWW A;  2D2C B;  1VF5 D;  1FID A;  5AW7 B;  3AED C;  1N73 C;  1RE4 C;  1NTZ E;  2HOD B;  2WT7 B;  1UIX A;  3W67 A;  4D6T J;  3HRN A;  1IJD B;  1JY3 N;  1KQG B;  4JYB A;  1R5L A;  5AVX B;  2E74 B;  3H1L J;  3L72 J;  3H1K E;  3L73 J;  4R9T A;  1LWU B;  1Z3S A;  4N6J A;  4XA4 A;  1JCC A;  2JEE A;  2QRX A;  1VF5 B;  1SFC A;  1BE3 D;  1EC5 A;  5K5G B;  5APS A;  2ZVO B;  2O1J A;  2KLU A;  5TIS H;  2BEZ F;  3CX5 H;  2GUS A;  1CW5 A;  1VQP P;  4D6T G;  3B71 A;  4H13 D;  3JCU H;  1Q81 Q;  3L70 D;  3Q5S A;  3CC4 P;  3H1L G;  3L72 G;  3L73 G;  1U7M A;  1RQV A;  3MUD A;  2HOD A;  3TGU D;  1HGV A;  1VQM P;  1YTZ T;  2M8R A;  1FZG C;  2CPB A;  2Q7C A;  1NTM E;  3V6I A;  1NH4 A;  2FYN B;  2YKQ A;  1LWU A;  3I5C A;  1H0T B;  1LTS C;  2QSI A;  4PD4 D;  3C1L A;  3G9R A;  2H89 C;  2KSJ A;  4GT1 A;  2A45 I;  1G1J A;  1FOS F;  3SWF A;  1NWQ A;  2WQY C;  4Y99 B;  2D39 A;  3CI9 A;  1N7S D;  4EDF A;  1JY3 O;  2ITA A;  5GTH E;  2H43 C;  1NTK E;  2A06 G;  1VQ9 P;  1PL5 A;  1RE3 B;  1SQB D;  1ZP0 C;  2E76 C;  3HUS A;  1SP4 A;  3CCU P;  5B5E E;  3EFG A;  3BCC J;  2ZXX A;  1VQK P;  1NU1 K;  1URQ D;  3B4S A;  4L73 A;  2YMY A;  1FOS E;  3P8C D;  4L74 A;  1BDC A;  2E43 A;  1H0T A;  3WMM 0;  1KIL E;  2B87 A;  3KZI H;  1PP9 E;  3PRJ A;  2KB7 P;  1IO4 A;  1FAV A;  1NKN A;  5CCG D;  3GW6 A;  1KZU B;  4BXL A;  2CK3 H;  2OTK E;  3AEB C;  3BCC G;  1CI6 B;  3ABV C;  1LTT C;  1HBW A;  2J60 A;  4GOD A;  1RQU A;  2KSE A;  3JSV C;  1Q7Y Q;  2SPZ A;  2ZT9 C;  5CHX A;  1RE3 A;  2J3O A;  1MKM A;  3M0D A;  3BVH C;  3KDP B;  2QM8 A;  1PGP A;  1RHZ B;  2P2U A;  1N86 B;  4PD4 I;  1SQQ E;  3L75 D;  2OYI A;  1ZLL A;  2C0W A;  2W90 A;  4HYT B;  4QMA A;  2C9N Y;  4Y28 J;  1P84 D;  2AXC A;  2Y0E A;  1PPJ E;  3AE2 C;  1N7S A;  4WBA A;  3L37 A;  2IBZ I;  1AQT A;  2WPR A;  2JO1 A;  4OGQ D;  3HE4 B;  3U1A A;  3L70 E;  1OZH A;  3C8V A;  1KQS O;  3AEC C;  3SFE C;  2J64 A;  2CPS A;  1URQ A;  5KLV K;  4I7Z B;  4YPC A;  1N86 A;  1VDF A;  2N9B A;  3Q3D A;  2IYP A;  2NZ2 A;  3HD7 D;  1SFC C;  2Z5I A;  2WPQ A;  2IDB A;  1FJK A;  5CCG A;  4UB8 H;  2XZR A;  4PD4 E;  4OGQ B;  3USS A;  4WVZ A;  3D70 A;  2D2C C;  4D6T D;  1G2C B;  1T3U A;  2FFD B;  3M9H A;  3H1L D;  3L72 D;  2E5T A;  3L73 D;  3KHU A;  3RK3 D;  4C7N B;  5KKZ C;  1N73 B;  2Q9I A;  1AVO A;  3MIW A;  1RE4 B;  1XTG B;  4DZO A;  1JY2 N;  2K3R A;  4HH2 A;  2YNY A;  1FDI A;  2IBZ E;  2QE7 H;  1KIL C;  2XKM A;  3V2N A;  1SQB E;  5E79 H;  1JOC A;  1K73 Q;  1P84 I;  1MV8 A;  1BCC E;  3K5B A;  2B88 A;  2J61 B;  1VF5 C;  3CCV P;  3L71 E;  3P8C E;  1IC2 A;  1ZRT D;  1SQQ J;  1JY3 P;  2FFD A;  1OVR A;  3F5H A;  1X79 B;  4C7N A;  2A06 D;  1OIP A;  1ZOY C;  3HUS C;  1NHL A;  1N73 A;  5DJU B;  1H89 A;  1LT9 B;  2J59 M;  5AW4 B;  3I56 P;  3H1J J;  3HD7 A;  1FZG B;  3A3Y B;  1CZQ A;  2ZFC A;  3KYQ A;  4H0L C;  1SQQ G;  1DH3 A;  1PFI A;  2J61 A;  3VYI A;  1BSH A;  3QH9 A;  5KAF H;  4H13 C;  1RF0 A;  1X8Y A;  2P7J A;  3WU2 H;  3Q5R A;  3TNU A;  1PPJ G;  2JWD A;  1P84 E;  1SQX E;  2B89 A;  3BCC D;  2IZ0 A;  1JY2 O;  3EQ2 A;  3H1J G;  1S5L X;  5APY A;  4AYC A;  1SQV J;  4PJ0 E;  2VRS A;  2JR8 A;  1FIC A;  1S3J A;  4U7J A;  4JF7 A;  1VQL P;  2IYO A;  2H43 B;  4DT0 A;  1YJW P;  1LT9 A;  2OYI C;  3M0A A;  2E76 B;  2OTJ P;  3AEG C;  1U57 A;  1FZG A;  3BAT A;  4IFD K;  3A0B E;  2ZT9 D;  1Z56 A;  3HTK A;  3FXE A;  1M1J B;  1SQV G;  3L4F A;  1N7S C;  2PAJ A;  1ZN5 A;  5GTH H;  2I1J A;  1BCC J;  1Q82 Q;  2IFN A;  1SQP K;  3OAK A;  5B5E H;  4D6T E;  3L71 J;  2LXB A;  3OJA B;  5H2F E;  4GOE A;  2WSS H;  3L73 E;  2FYU K;  3RK3 E;  1URQ C;  3AE9 C;  1OFC X;  2BCC J;  5DJT B;  5KLI C;  3U59 A;  2IBZ G;  5KTB A;  2H43 A;  2XNX A;  2ZT9 B;  4W80 A;  1BCC G;  4XFJ A;  5CCG C;  2C0X A;  1KMI Z;  2OTL P;  1HF9 A;  1AJY A;  2Y9Y A;  3L71 G;  3PLN A;  2YXR B;  1M1J A;  2GY7 A;  3CXH D;  1VQN P;  2A45 H;  1EZV G;  2BCC G;  1LT1 A;  3S9O A;  5BU8 B;  1JCD A;  3E1R A;  4JPZ B;  2Q9I C;  2J3G A;  2OQQ A;  2E5Y A;  4EYY Q;  5AVT B;  3VP8 A;  4N78 E;  2O01 N;  2WPV B;  1KQL A;  1SQX J;  4NPE A;  5CCH D;  1GZL A;  2IZ1 A;  1DD4 A;  3JC2 2;  2WSE H;  1JEK A;  1LTB C;  3WUT A;  1KIL D;  2Y0C A;  3I55 P;  1SFC B;  2XDJ A;  3B5N D;  1QVF O;  4C46 A;  3AE5 C;  1SQX G;  1XTC C;  2Z5H A;  4YXW H;  1S5L E;  3BCC E;  2J58 A;  4HB1 A;  2KZJ A;  3O8Z A;  2Q3I A;  4GKG A;  3HD7 C;  5KKZ B;  5AVZ B;  1L0N K;  5KJ7 D;  1W5C E;  1Q90 D;  3Q1M A;  1SQQ D;  1LP1 A;  1KIL B;  1X9V A;  4PD4 H;  1NTM K;  3V2P A;  3CXH I;  1RF0 C;  2ZYD A;  4PV1 D;  3B5N B;  5CJ0 A;  4EI2 A;  1PPJ D;  3G6E P;  4I1L A;  3EWK A;  3MHV A;  1Q86 Q;  3RK3 C;  3VMZ A;  4H0L D;  1L0L K;  1JY2 P;  3O6Q A;  1Y9B A;  3A0H H;  3LW5 H;  3H1J D;  1R8E A;  2JWA A;  4JYC A;  1OXZ A;  2OAR A;  4ZKP A;  1BSN A;  4OVN F;  5CCH A;  2QJP C;  1T2K D;  1M57 D;  2AXT H;  4NYT A;  1LT9 C;  1K05 A;  3HUS B;  1IZN B;  1JB0 J;  2YO2 A;  2KZI A;  1FZF A;  1VQ4 P;  1KIL A;  3GLM A;  1H88 A;  4H0L B;  1SQV D;  4ASW A;  3CD6 P;  3R4Y A;  3B5N A;  2B87 B;  2G8Y A;  2RN0 A;  2GM4 A;  1HVV A;  2OYH C;  1Y47 A;  2M5A A;  4H13 B;  2ZYG A;  1GK6 A;  3CXH E;  2WSC H;  3S4R A;  4IOI H;  4ZKU A;  3N4X A;  1FDO A;  2MKV A;  3AE8 C;  3KQG A;  2WSF J;  3M9B A;  5KJ7 A;  2O01 J;  3D6Y A;  2BEQ D;  1NOH A;  2IBZ D;  3WUV A;  2XNX C;  2QJY C;  4AQR D;  1GK4 A;  1L4A C;  2J3F D;  1BCC D;  3LIE A;  1P84 H;  3CME P;  3L36 A;  2OYI B;  1EDJ A;  1W2B O;  1GU5 A;  1S72 P;  3L71 D;  3CCQ P;  2JHM F;  1M1J C;  1KOR A;  1PGO A;  4PJ0 H;  3TSI A;  1EZV D;  2BCC D;  1N7S B;  5BVZ A;  2NPS D;  1ZW0 A;  2KS1 B;  3P32 A;  1DEB A;  5AW5 B;  2HYN A;  3MZW B;  3VN0 A;  3A0B H;  1U7J A;  1URQ B;  3D71 A;  5KLI B;  1PIX A;  5APV A;  4C7R A;  1SS1 A;  4M7F A;  2P58 A;  1RF1 A;  4LLH A;  3CC7 P;  2Q3E A;  1E5W A;  2WIT A;  4YTP C;  1NYH A;  2PRR A;  3CCS P;  1ZV8 A;  4JYO X;  2HFE D;  3PJS K;  1SQX D;  2M0B A;  2RKL A;  1KYO D;  1EDL A;  3IR9 A;  2KS1 A;  4A7P A;  1PGQ A;  3H1J E;  4WY4 D;  3CCJ P;  1WRG A;  2KOG A;  2Q9I B;  1L0N J;  3IF4 A;  1NAF A;  2HLO C;  2XU6 A;  1ZXG A;  2J0Y A;  2QEX P;  1SQB K;  1FZB C;  4UB6 E;  1FJP A;  1DD3 A;  2GUV A;  3BRV B;  3E1I C;  3MP7 B;  1M90 Q;  1EZV I;  3GG2 A;  3S1K A;  2IFM A;  1HTL C;  1L0L J;  3QWO C;  1VQ6 P;  3V2R A;  2NPS A;  1HJ0 A;  1SQV E;  4WY4 B;  1L0N G;  3G3Z A;  3A2A A;  3UIA A;  4M7H A;  4OWF A;  5CCH C;  4U3F J;  4JQ0 D;  1GMJ A;  4W7Z A;  4RO0 A;  2UWJ E;  2ZVN B;  1KB9 D;  1G1I A;  3FXD A;  2AEF A;  1FZF C;  1L0L G;  3HD7 B;  2WSF H;  3MGN A;  3CCL P;  2V7Q J;  3BRT B;  3B5N C;  2NRG A;  2Q6Q A;  1KC8 Q;  1MFZ A;  2G3A A;  1S5L H;  1RF0 B;  1KYO I;  1MUU A;  1OW6 A;  4U3F G;  2K1A A;  4ASV A;  3TNU B;  1T6A A;  3F89 A;  4WY4 A;  4CPG A;  1EZV E;  3RK3 B;  2BCC E;  1JO5 A;  2JP3 A;  2W83 C;  3SWK A;  5APQ A;  1GL2 C;  5KJ7 C;  2PGD A;  3OW2 O;  1QLE D;  4KJM A;  1OW8 A;  3AE6 C;  4N78 D;  4DCK A;  1M1K Q;  4WWI A;  5GTI E;  1JM0 A;  5AVS B;  2QJP B;  5APU A;  4PV1 C;  2AEJ A;  2HR3 A;  3GF3 A;  1NU1 J;  4EOT A;  3H32 B;  2IPP A;  1USE A;  3Q5P A;  3FWL A;  3HTK B;  1GU4 A;  4OH8 B;  3Q2Y A;  1L4A D;  4K3A A;  3SFD C;  1NGM B;  1T2K C;  2R44 A;  2OYH B;  3WUU A;  2BAS A;  5AVW B;  1KB9 I;  4AUW A;  1KYO E;  1NU1 G;  1FS0 E;  2QJK C;  3GHG C;  1VQ5 P;  1YHQ P;  3CWB J;  5APT A;  4IL6 X;  4TT3 H;  2J2P A;  3IAO A;  3OA7 A;  2R3S A;  2YXQ B;  2XV5 A;  3H1I J;  2XNX B;  1RF1 C;  2QJY B;  1KN7 A;  1KFN A;  1L4A B;  3H32 A;  4LC1 A;  3AE4 C;  3CXH H;  2QA4 P;  3B8E B;  1N2D C;  1YQ3 C;  1AFO A;  2JJL A;  1KTM A;  3AE1 C;  2FXP A;  1NJI Q;  3CWB G;  4BRY B;  2J5Z A;  3VMY A;  1FE6 A;  2H88 C;  2L5G B;  2JKV A;  2KXP B;  2OYH A;  3H1I G;  3NTN A;  1X0T A;  1IFD A;  1GTW A;  1JMB A;  5KLV J;  4H44 D;  1JNM A;  1QX8 A;  2Q1K A;  1YIJ P;  1KB9 E;  1LTJ C;  5KAI E;  2PFX A;  3IFM A;  1PZQ A;  2WPS A;  3P8M C;  1L4A A;  1HH0 A;  1JMM A;  4W7Y A;  2HG5 D;  2NPS C;  2WNP F;  1KV4 A;  1AQ5 A;  2RMZ A;  2KLV A;  2Z4E A;  3M9Q A;  4ZFG A;  2B9B A;  1L0N D;  3FIB A;  4BRY A;  2O1K A;  1IFI A;  3EFF K;  5KLV G;  4L76 A;  2HPC A;  1LTG C;  2N1T D;  2IX7 C;  4ZMD A;  5EFW B;  1NTZ K;  3TDK A;  3E7K A;  4NPF X;  1FZE B;  2I8D A;  3FX0 A;  1L0L D;  1LJ2 A;  2HLO B;  1VPC A;  2FKW B;  2W27 A;  1SVF A;  3FGA D;  1LP1 B;  1FZB B;  2JHH C;  4DOJ A;  2DW3 A;  1W2E A;  3E1I B;  2Y0D A;  4U3F D;  1GW3 A;  3G4S P;  3D6Z A;  1T3J A;  2FYU E;  4WY4 C;  2E75 C;  5L8R J;  1FZA C;  2N1T B;  2FY8 A;  3O6Q B;  4ZNC A;  4UB6 H;  3PHL A;  5B66 E;  2ZXE B;  1Q2N A;  1WT6 A;  2LR2 A;  2JHI F;  3CLQ A;  1A02 F;  1QVG O;  1IFP A;  4IL6 E;  3R2P A;  3CMA P;  3L74 J;  1D7M A;  1IFN A;  1FZE A;  3FWN A;  2H8P D;  2HLO A;  1GL2 D;  2KK7 A;  3TF5 A;  3GF7 A;  1FZF B;  1FZB A;  1QGK B;  3E1I A;  3NXS A;  2V4H A;  2M5A B;  3MD0 A;  2QG4 A;  3H1H E;  2N1T A;  1LNQ A;  1FZC C;  3L74 G;  1VQ8 P;  1KQF B;  3PTZ A;  5BU5 A;  3PP5 A;  1NU1 D;  4RJT A;  1RY3 A;  3IN6 A;  1S2E A;  1GL2 B;  2J3U A;  1NTK K;  4TLF A;  1QL2 A;  4GDO A;  1HJB A;  3H32 C;  4PV1 B;  1E79 H;  4MN4 C;  5KAF E;  3WU2 E;  1FZD A;  1GW4 A;  3H6P A;  4JBZ A;  2R3C A;  3V4W A;  2WT7 A;  3CCR P;  2WMM A;  3CWB D;  1EXI A;  1J1E C;  3RK2 C;  3CC2 P;  1SQP J;  1NO4 A;  1L0N E;  5GTI H;  1OWA A;  1ZR2 A;  3H1I D;  1BGY E;  4I6M C;  2KIK A;  5AVU B;  1BDD A;  2FYU J;  1GL2 A;  3A7O A;  3AEE C;  2QJK B;  3GHG B;  4N3Y B;  3PH0 A;  3CPW O;  1YJ9 P;  2Y9Z A;  1L0L E;  2FYZ A;  3M91 A;  1JUN A;  1PGJ A;  1SQQ K;  1SQP G;  1RF1 B;  2FXM A;  1YIT P;  2W6J H;  1VQO P;  3RGU A;  2L91 A;  2Z4E C;  5CMZ A;  1KYO H;  1X22 A;  3CX5 D;  1R5S A;  4U3F E;  2FYU G;  5KLV D;  2M3E A;  2HPC C;  1VL2 A;  2ZAE B;  1J1D C;  1K04 A;  1LTA C;  1NTZ J;  1Z3U A;  1YQ4 C;  1OMI A;  3T97 B;  3RL0 g;  1AVY A;  3H1H J;  1FBM A;  5CJ4 A;  3GHG A;  1M56 D;  1CSB A;  5AVQ B;  3RL0 C;  1A02 J;  3H1K J;  2P1J A;  3V2Q A;  2P67 A;  2YIU C;  3LID A;  1LTJ B;  4JZC A;  1S4X A;  1NVO A;  1N8R Q;  1NTZ G;  4RES B;  1AA0 A;  1SQV K;  2NPS B;  4EPU A;  2N9Y B;  1YBK A;  3TYY A;  5H2F H;  3H1H G;  2ZYA A;  2KI7 B;  3CCM P;  2W8Z A;  3KXD A;  4H44 C;  3H1K G;  2KP8 A;  1KB9 H;  5KAI H;  2J0H A;  1Y8A A;  4L75 A;  2E75 D;  1NU1 E;  1PV3 A;  1FZE C;  3T97 A;  4IFM A;  1EDI A;  2J3F A;  1BGY J;  1BE3 E;  1RH5 B;  1K8A Q;  1NTM J;  5AW8 B;  2K37 A;  3CX5 I;  3HE5 B;  3U1C A;  1CI6 A;  1LTJ A;  2K88 A;  3CCE P;  3RBZ A;  1FIB A;  5AVY B;  3NMD A;  2FXO A;  2N1T C; 
#chains in the Genus database with same CATH homology
 5APT A;  1NWQ A;  2WSE H;  1LTB C;  4Y99 B;  2D39 A;  2J2P A;  3CI9 A;  3OA7 A;  1FZA B;  2XV5 A;  1KIL D;  1N7S D;  1SFC B;  1JY3 O;  2XNX B;  1RF1 C;  2XDJ A;  2R32 A;  2H43 C;  2YO3 A;  1KFN A;  1L4A B;  2W6B A;  1RE3 B;  3H32 A;  4LC1 A;  1S9K D;  3B5N D;  4C46 A;  4LGD E;  3HUS A;  1SP4 A;  3B8E B;  1EQ7 A;  1XTC C;  1MZ9 A;  2Z5H A;  3EFG A;  1N2D C;  3V4Q A;  2PP6 A;  1AFO A;  2J58 A;  2JJL A;  5APW A;  1ZR4 A;  3O8Z A;  1NU1 K;  1URQ D;  3L35 A;  2J5Z A;  1LTI C;  2MJZ A;  2O01 H;  3VMY A;  2R5D A;  2YMY A;  2Q3I A;  4GKG A;  3HE5 A;  1FOS E;  3HD7 C;  2L5G B;  2HOD C;  3P8C D;  5AVZ B;  2OYH A;  2WTY A;  2E43 A;  3WMM 0;  1L0N K;  3HE4 A;  5KJ7 D;  3NTN A;  4M3L A;  2J1G A;  1KIL B;  1YYC A;  1X9V A;  2KB7 P;  1NTM K;  3V2P A;  1IO4 A;  1FAV A;  1NKN A;  5CCG D;  1KZU B;  1IFD A;  1GTW A;  1KFM A;  1RF0 C;  2C9L Y;  1JNM A;  1FZA A;  3B5N B;  1CI6 B;  1SQX K;  5CJ0 A;  4IFF A;  1LWU C;  1FZC B;  4I1L A;  1LTT C;  1HBW A;  2J60 A;  1LTJ C;  3RK3 C;  1IFJ A;  3VMZ A;  3IFM A;  3RK2 D;  1L0L K;  1JY2 P;  2WPS A;  3P8M C;  1L4A A;  1HH0 A;  5CHX A;  1RE3 A;  3LW5 H;  2J3O A;  3M0D A;  2KYV A;  3BVH C;  1JMM A;  4W7Y A;  2HG5 D;  4JYC A;  2NPS C;  1OXZ A;  2WNP F;  3KDP B;  1AQ5 A;  2QM8 A;  4KHX A;  2KLV A;  2OAR A;  2P2U A;  4ZKP A;  3VP9 A;  2Z4E A;  1N86 B;  3VTP C;  3M9Q A;  2OYI A;  4ZFG A;  1ZLL A;  5CCH A;  2C0W A;  1T2K D;  3FIB A;  4HYT B;  3M06 A;  4NYT A;  1LT9 C;  1QL1 A;  2O1K A;  1G2C A;  3V5B A;  1IFI A;  1JTH B;  3HUS B;  1HWT C;  3P7K A;  2C9N Y;  2HPC A;  2LKM A;  1LTG C;  4B86 A;  1YTZ I;  1LGH B;  2N1T D;  2A45 G;  2IX7 C;  2YO2 A;  1FZF A;  1KIL A;  1RE4 A;  1NTZ K;  1N7S A;  4WBA A;  3L37 A;  1H88 A;  2FIB A;  2POH A;  1J1E B;  3RK2 B;  1FZE B;  2WPR A;  3II6 A;  2HLO B;  1VPC A;  3HE4 B;  3B5N A;  2FKW B;  2W27 A;  3U1A A;  4EIJ A;  5APX A;  1DX7 A;  1SVF A;  1JC9 A;  2GM4 A;  1FZC A;  1HVV A;  1T8Z A;  5AW1 B;  2OYH C;  1FZB B;  2JHH C;  4DOJ A;  1W2E A;  2J64 A;  1GK6 A;  2WSC H;  4O9B A;  2CPS A;  3E1I B;  1URQ A;  2JHK F;  5KLV K;  1GW3 A;  4ZKU A;  3N4X A;  1T3J A;  4Y99 C;  4WY4 C;  3KQG A;  1N86 A;  1VDF A;  1FZA C;  3M9B A;  2N9B A;  5KJ7 A;  1GD2 E;  5AW3 B;  2N1T B;  1NOH A;  2QM7 A;  3HD7 D;  3CL3 D;  1GDT A;  1SFC C;  2WZ7 A;  1H8A A;  2XNX C;  2Z5I A;  2WPQ A;  4AQR D;  1FJK A;  2J0G A;  5CCG A;  1JTH A;  1GK4 A;  1L4A C;  2XZR A;  3RL0 D;  1RE3 C;  2W6A A;  2J3F D;  2ZXE B;  3M0D C;  3LIE A;  2Z4E B;  1WT6 A;  3L36 A;  4WB4 A;  2OYI B;  2JHI F;  3CLQ A;  1A02 F;  1GU5 A;  3BAS A;  3R2P A;  1G2C B;  2JHL F;  2JHM F;  1T3U A;  2FFD B;  1IFN A;  1FZE A;  1M1J C;  1N7L A;  1J2J B;  3M9H A;  2HPC B;  2H8P D;  1J1D B;  1GL2 D;  2HLO A;  3RK3 D;  3TSI A;  4C7N B;  2YKP A;  1N73 B;  2Q9I A;  2H7H A;  1FZF B;  1FZB A;  3MIW A;  1RE4 B;  1XTG B;  4DZO A;  1JY2 N;  1M7L A;  4HH2 A;  1N7S B;  5BVZ A;  2YNY A;  2R5B A;  2NPS D;  1KIL C;  2XKM A;  3P32 A;  3V2N A;  1DEB A;  1S9K E;  3E1I A;  5AW5 B;  1JOC A;  2HYN A;  3NXS A;  1MV8 A;  3VN0 A;  4R9J A;  2YKO A;  3RL0 B;  3MD0 A;  3MTU E;  2J61 B;  2M3B A;  2N1T A;  1FZC C;  3KPE A;  1URQ B;  5BU5 A;  3PP5 A;  1RY3 A;  3P8C E;  5AW2 B;  5APV A;  4C7R A;  1IC2 A;  4I2L C;  4M7F A;  1RF1 A;  1GL2 B;  2J3U A;  4LLH A;  1FDM A;  1NTK K;  5AVV B;  1N86 C;  1JY3 P;  1E5W A;  2WIT A;  1QL2 A;  3BVH B;  2FFD A;  1HJB A;  1X79 B;  3H32 C;  1ZV8 A;  2Q5U A;  4JYO X;  4C7N A;  2HFE D;  2E42 A;  1HUC A;  3HUS C;  1NHL A;  3SWY A;  1N73 A;  1H89 A;  1LT9 B;  2J59 M;  5AW6 B;  1FZD A;  5AW4 B;  1GW4 A;  3H6P A;  3IR9 A;  3HD7 A;  2R3C A;  3V4W A;  1FZG B;  4WY4 D;  3A3Y B;  2WT7 A;  1CZQ A;  2ZFC A;  3C9I A;  3KYQ A;  5AW0 B;  2I1K A;  1J1E C;  3RK2 C;  1WRG A;  2KOG A;  1DH3 A;  1PFI A;  2Q9I B;  1SFC D;  1NAF A;  2HLO C;  2J61 A;  1NO4 A;  2XU6 A;  3VYI A;  1OWA A;  1SLQ A;  1ZR2 A;  2J0Y A;  1SQB K;  4I6M C;  1FZB C;  1RF0 A;  3TK1 A;  1X8Y A;  2P7J A;  5AVU B;  3TNU A;  1FJP A;  4XE5 B;  3A5T A;  2GUV A;  3BRV B;  1FU1 A;  3E1I C;  4GIF A;  3VMX A;  5AW9 B;  1GL2 A;  3A7O A;  3GHG B;  4N3Y B;  3VOP A;  1JY2 O;  3EQ2 A;  5APY A;  2IFM A;  1HTL C;  3BVH A;  4AYC A;  1NKZ B;  3V2R A;  2NPS A;  1FIC A;  2VRS A;  2FYZ A;  4WY4 B;  3M91 A;  1JUN A;  3G3Z A;  1SQQ K;  1IK9 A;  2FXM A;  5AVR B;  4JF7 A;  1RF1 B;  3A2A A;  2H43 B;  3UIA A;  4M7H A;  2Z4E C;  1IFM A;  1LT9 A;  2OYI C;  3M0A A;  5CMZ A;  1HGZ A;  5CCH C;  3N7N A;  1FZG A;  3BAT A;  4W7Z A;  2FFD C;  4IFD K;  3NFQ A;  2WWW A;  2HPC C;  1FID A;  1J1D C;  1Z56 A;  3HTK A;  5AW7 B;  1G1I A;  1N73 C;  1LTA C;  1FZF C;  1Z3U A;  1M1J B;  1RE4 C;  3HD7 B;  3L4F A;  2WSF H;  1N7S C;  2HOD B;  2WT7 B;  2PAJ A;  1ZN5 A;  3MGN A;  2I1J A;  2IFN A;  3BRT B;  1SQP K;  1FBM A;  3OAK A;  3B5N C;  1IJD B;  3HRN A;  3GHG A;  5CJ4 A;  1JY3 N;  1CSB A;  4JYB A;  1MFZ A;  5AVQ B;  3RL0 C;  1RF0 B;  3OJA B;  1A02 J;  1MUU A;  5AVX B;  3TNU B;  2P1J A;  3V2Q A;  4R9T A;  1LWU B;  2P67 A;  1Z3S A;  2FYU K;  4WY4 A;  1URQ C;  4N6J A;  3LID A;  3U59 A;  4XA4 A;  1LTJ B;  3RK3 B;  1JO5 A;  4JZC A;  5KTB A;  1JCC A;  2JEE A;  2H43 A;  1SFC A;  5APQ A;  2XNX A;  4RES B;  1GL2 C;  5KJ7 C;  5APS A;  4W80 A;  2O1J A;  1SQV K;  2NPS B;  4EPU A;  3TYY A;  4N78 D;  5CCG C;  2C0X A;  2GUS A;  1CW5 A;  5AVS B;  5APU A;  2KP8 A;  1M1J A;  2GY7 A;  3MUD A;  4EOT A;  2J0H A;  2HOD A;  3H32 B;  2A45 H;  2IPP A;  1HGV A;  1YTZ T;  2M8R A;  1FZE C;  3T97 A;  1FZG C;  5BU8 B;  4IFM A;  1JCD A;  2J3F A;  3HTK B;  1GU4 A;  4OH8 B;  2Q9I C;  2J3G A;  2CPB A;  1L4A D;  5AW8 B;  2Q7C A;  1NH4 A;  5AVT B;  3VP8 A;  2YKQ A;  3HE5 B;  4N78 E;  1LWU A;  1T2K C;  3I5C A;  3U1C A;  2OYH B;  1KQL A;  2BAS A;  1CI6 A;  1LTJ A;  1LTS C;  5AVW B;  5CCH D;  1GZL A;  1FIB A;  5AVY B;  4AUW A;  3NMD A;  2KSJ A;  3GHG C;  4GT1 A;  2A45 I;  1G1J A;  1FOS F;  2N1T C;  3SWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...