2JHLF

Structure of globular heads of m-ficolin complexed with sialic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
217
Chain Sequence
SCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRTDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-1
publication title Structural Basis for Innate Immune Sensing by M-Ficolin and its Control by a Ph-Dependent Conformational Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 75
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2jhlF01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2jhlF02
2J61B 3HUSC 1LTJC 2J3UA 1FZCC 1RE4C 1FZGB 1FZAC 1LWUB 2OYIB 4EPUA 3H32C 1FZGC 2D39A 2H43B 2HODC 1RF1B 1N86C 1FIBA 1Z3SA 3E1IB 2J0HA 2HPCB 2Q9IB 3BVHB 3GHGC 2WNPF 1FZEB 2H43C 1N73B 2OYHB 1RE3B 1RF1C 2J3FD 1FZDA 2J1GA 4NYTA 2JHKF 3E1IC 2HPCC 2Q9IC 2J5ZA 2J3OA 3BVHC 1FZFB 1JC9A 1FZEC 1N73C 2OYHC 1RE3C 2HLOB 4JZCA 2FIBA 1M1JB 2JHIF 1LT9B 1LWUC 2FFDB 2JHMF 2OYIC 1FIDA 2XNXB 2J0YA 2J61A 1FZFC 2J60A 2HLOC 4M7FA 2J0GA 2J3FA 1M1JC 1RF0B 2FFDC 2XNXC 2Z4EB 2JHLF 1FICA 4R9JA 3FIBA 1Z3UA 1RF0C 3H32B 4R9TA 2Z4EC 2HODB 4ZFGA 1FZBB 1N86B 2JHHC 4M7HA 2J3GA 1LT9C 2J2PA 3HUSB 1LTJB 2GY7A 4JYOX 1FZCB 1RE4B 1FZBC 1FZAB 2J64A
chains in the Genus database with same CATH superfamily
2J61B 3HUSC 1LTJC 2J3UA 1FZCC 1RE4C 1FZGB 1FZAC 1LWUB 2OYIB 4EPUA 3H32C 1FZGC 3GHGB 2D39A 2H43B 2HODC 1RF1B 1N86C 1FIBA 1Z3SA 3E1IB 2J0HA 2HPCB 2Q9IB 3BVHB 3GHGC 2WNPF 1FZEB 2H43C 1N73B 2OYHB 1RE3B 1RF1C 2J3FD 1FZDA 2J1GA 4NYTA 2JHKF 3E1IC 2HPCC 2Q9IC 2J5ZA 2J3OA 3BVHC 1FZFB 1JC9A 1FZEC 1N73C 2OYHC 1RE3C 2HLOB 4JZCA 2FIBA 1M1JB 2JHIF 1LT9B 1LWUC 2FFDB 2JHMF 2OYIC 1FIDA 2XNXB 2J0YA 2J61A 1FZFC 2J60A 2HLOC 4M7FA 2J0GA 2J3FA 1M1JC 1RF0B 2FFDC 2XNXC 2Z4EB 2JHLF 1FICA 4R9JA 3FIBA 1Z3UA 1RF0C 3H32B 4R9TA 2Z4EC 2HODB 4ZFGA 1FZBB 1N86B 2JHHC 4M7HA 2J3GA 1LT9C 2J2PA 3HUSB 1LTJB 2GY7A 4JYOX 1FZCB 1RE4B 1FZBC 1FZAB 2J64A
chains in the Genus database with same CATH topology
2J61B 3HUSC 1LTJC 2J3UA 1FZCC 1RE4C 1FZGB 1FZAC 1LWUB 2OYIB 4EPUA 3H32C 1FZGC 2D39A 2H43B 2HODC 1RF1B 1N86C 1FIBA 1Z3SA 3E1IB 2J0HA 2HPCB 2Q9IB 3BVHB 3GHGC 2WNPF 1FZEB 2H43C 1N73B 2OYHB 1RE3B 1RF1C 2J3FD 1FZDA 2J1GA 4NYTA 2JHKF 3E1IC 2HPCC 2Q9IC 2J5ZA 2J3OA 3BVHC 1FZFB 1JC9A 1FZEC 1N73C 2OYHC 1RE3C 2HLOB 4JZCA 2FIBA 1M1JB 2JHIF 1LT9B 1LWUC 2FFDB 2JHMF 2OYIC 1FIDA 2XNXB 2J0YA 2J61A 1FZFC 2J60A 2HLOC 4M7FA 2J0GA 2J3FA 1M1JC 1RF0B 2FFDC 2XNXC 2Z4EB 2JHLF 1FICA 4R9JA 3FIBA 1Z3UA 1RF0C 3H32B 4R9TA 2Z4EC 2HODB 4ZFGA 1FZBB 1N86B 2JHHC 4M7HA 2J3GA 1LT9C 2J2PA 3HUSB 1LTJB 2GY7A 4JYOX 1FZCB 1RE4B 1FZBC 1FZAB 2J64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J61 B;  3HUS C;  1LTJ C;  2J3U A;  1FZC C;  1RE4 C;  1FZG B;  1FZA C;  1LWU B;  2OYI B;  4EPU A;  3H32 C;  1FZG C;  2D39 A;  2H43 B;  2HOD C;  1RF1 B;  1N86 C;  1FIB A;  1Z3S A;  3E1I B;  2J0H A;  2HPC B;  2Q9I B;  3BVH B;  3GHG C;  2WNP F;  1FZE B;  2H43 C;  1N73 B;  2OYH B;  1RE3 B;  1RF1 C;  2J3F D;  1FZD A;  2J1G A;  4NYT A;  2JHK F;  3E1I C;  2HPC C;  2Q9I C;  2J5Z A;  2J3O A;  3BVH C;  1FZF B;  1JC9 A;  1FZE C;  1N73 C;  2OYH C;  1RE3 C;  2HLO B;  4JZC A;  2FIB A;  1M1J B;  2JHI F;  1LT9 B;  1LWU C;  2FFD B;  2JHM F;  2OYI C;  1FID A;  2XNX B;  2J0Y A;  2J61 A;  1FZF C;  2J60 A;  2HLO C;  4M7F A;  2J0G A;  2J3F A;  1M1J C;  1RF0 B;  2FFD C;  2XNX C;  2Z4E B;  2JHL F;  1FIC A;  4R9J A;  3FIB A;  1Z3U A;  1RF0 C;  3H32 B;  4R9T A;  2Z4E C;  2HOD B;  4ZFG A;  1FZB B;  1N86 B;  2JHH C;  4M7H A;  2J3G A;  1LT9 C;  2J2P A;  3HUS B;  1LTJ B;  2GY7 A;  4JYO X;  1FZC B;  1RE4 B;  1FZB C;  1FZA B;  2J64 A; 
#chains in the Genus database with same CATH topology
 2J61 B;  3HUS C;  1LTJ C;  2J3U A;  1FZC C;  1RE4 C;  1FZG B;  1FZA C;  1LWU B;  2OYI B;  4EPU A;  3H32 C;  1FZG C;  3GHG B;  2D39 A;  2H43 B;  2HOD C;  1RF1 B;  1N86 C;  1FIB A;  1Z3S A;  3E1I B;  2J0H A;  2HPC B;  2Q9I B;  3BVH B;  3GHG C;  2WNP F;  1FZE B;  2H43 C;  1N73 B;  2OYH B;  1RE3 B;  1RF1 C;  2J3F D;  1FZD A;  2J1G A;  4NYT A;  2JHK F;  3E1I C;  2HPC C;  2Q9I C;  2J5Z A;  2J3O A;  3BVH C;  1FZF B;  1JC9 A;  1FZE C;  1N73 C;  2OYH C;  1RE3 C;  2HLO B;  4JZC A;  2FIB A;  1M1J B;  2JHI F;  1LT9 B;  1LWU C;  2FFD B;  2JHM F;  2OYI C;  1FID A;  2XNX B;  2J0Y A;  2J61 A;  1FZF C;  2J60 A;  2HLO C;  4M7F A;  2J0G A;  2J3F A;  1M1J C;  1RF0 B;  2FFD C;  2XNX C;  2Z4E B;  2JHL F;  1FIC A;  4R9J A;  3FIB A;  1Z3U A;  1RF0 C;  3H32 B;  4R9T A;  2Z4E C;  2HOD B;  4ZFG A;  1FZB B;  1N86 B;  2JHH C;  4M7H A;  2J3G A;  1LT9 C;  2J2P A;  3HUS B;  1LTJ B;  2GY7 A;  4JYO X;  1FZC B;  1RE4 B;  1FZB C;  1FZA B;  2J64 A; 
#chains in the Genus database with same CATH homology
 2J61 B;  3HUS C;  1LTJ C;  2J3U A;  1FZC C;  1RE4 C;  1FZG B;  1FZA C;  1LWU B;  2OYI B;  4EPU A;  3H32 C;  1FZG C;  2D39 A;  2H43 B;  2HOD C;  1RF1 B;  1N86 C;  1FIB A;  1Z3S A;  3E1I B;  2J0H A;  2HPC B;  2Q9I B;  3BVH B;  3GHG C;  2WNP F;  1FZE B;  2H43 C;  1N73 B;  2OYH B;  1RE3 B;  1RF1 C;  2J3F D;  1FZD A;  2J1G A;  4NYT A;  2JHK F;  3E1I C;  2HPC C;  2Q9I C;  2J5Z A;  2J3O A;  3BVH C;  1FZF B;  1JC9 A;  1FZE C;  1N73 C;  2OYH C;  1RE3 C;  2HLO B;  4JZC A;  2FIB A;  1M1J B;  2JHI F;  1LT9 B;  1LWU C;  2FFD B;  2JHM F;  2OYI C;  1FID A;  2XNX B;  2J0Y A;  2J61 A;  1FZF C;  2J60 A;  2HLO C;  4M7F A;  2J0G A;  2J3F A;  1M1J C;  1RF0 B;  2FFD C;  2XNX C;  2Z4E B;  2JHL F;  1FIC A;  4R9J A;  3FIB A;  1Z3U A;  1RF0 C;  3H32 B;  4R9T A;  2Z4E C;  2HOD B;  4ZFG A;  1FZB B;  1N86 B;  2JHH C;  4M7H A;  2J3G A;  1LT9 C;  2J2P A;  3HUS B;  1LTJ B;  2GY7 A;  4JYO X;  1FZC B;  1RE4 B;  1FZB C;  1FZA B;  2J64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...