3HUSC

Crystal structure of recombinant gamma n308k fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
291
Chain Sequence
DSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHKGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Impaired protofibril formation in fibrinogen gammaN308K is due to altered D:D and "A:a" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 75
structure length 291
sequence length 291
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3husC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3husC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3husC03
4JYOX 2Z4EC 3GHGC 4JZCA 1JY3N 1N73C 1RF1A 1RE4C 2J1GA 1T3UA 2J2PA 2OYHB 1LT9B 1FZDA 1FIDA 2OYIA 3H32B 1RE3C 2J3UA 1FZEC 4R9JA 2J64A 2XNXC 1JY2N 2Q9IA 1FZFC 1JY2P 1RF0C 1N86C 3FIBA 1FZCB 3E1IA 1LTJB 1LWUC 3BVHB 2H43C 2OYHA 2HPCA 1LT9A 2JHLF 3H32A 3GHGB 2HODB 2FIBA 2J0HA 4ZFGA 1N73B 1RE4B 4R9TA 3HUSB 1FZBC 2J3OA 2J61B 1FZCA 2J0GA 2J60A 1LTJA 1M1JC 1FZEB 3BVHA 2HLOB 2XNXB 1JY3O 1FZFB 2Q9IC 1N86B 1RF0B 4NYTA 3GHGA 2HODA 1FIBA 2JHIF 1FZAB 3E1IC 1N73A 1LWUB 1RE4A 4M7FA 3HUSA 2JHMF 2FFDB 2OYHC 2J61A 2HPCC 1FZGC 1JY2O 1LT9C 2Z4EB 1FZEA 2JHHC 1Z3SA 1Z3UA 2HLOA 2WNPF 4EPUA 2A45I 2D39A 2A45G 2XNXA 1RF1C 1FZFA 1W2EA 2J5ZA 1FZBB 1N86A 1RF0A 2GY7A 1RE3B 2OYIC 2J3GA 1FZAA 1M1JB 1LWUA 3BVHC 2FFDA 2J0YA 2Z4EA 4M7HA 2JHKF 2HODC 3E1IB 2H43B 1JY3P 1FZBA 3HUSC 2HPCB 1FZGB 1RE3A 1JC9A 1M1JA 3H32C 1FICA 2J3FD 2HLOC 1RF1B 2A45H 1FZCC 1LTJC 2OYIB 2H43A 1FZAC 2J3FA 1FZGA 2Q9IB 2FFDC
chains in the Genus database with same CATH superfamily
2C9NY 2Z4EC 1N73C 1M90Q 1LT9B 4TT3H 1FIDA 1VQ5P 1LP1A 1IFJA 1NO4A 4RJTA 1KYOD 1PPJE 1NTZJ 3SWKA 3HE4B 5CMZA 3ZDMA 4NPDA 1Y8AA 1FZCA 4C7NB 3G71P 2QJPB 1JY3O 3L71J 2AXCA 1RY3A 1N73A 2KSEA 3L72D 2JJLA 1L0NJ 1JY2O 5AW5B 2DW3A 2A45G 1H0TB 1RF1C 1NTKJ 3L75G 1S5LX 1S9KE 3RBZA 1SQBD 5AVWB 2Z5HA 4H13B 3KDPB 1EZVE 1SQVG 1N7SD 3KPEA 1Q7YQ 2K3RA 2HFED 1BCCJ 2QIWA 1RE3A 3JSVC 1JB0J 1FE6A 3VMXA 2HYNA 1U7MA 2UWJE 5KJ7D 2YIUC 5KLIB 2RN0A 3GHGC 3RK2D 1RF1A 3PTZA 1SQXD 3H1LE 2CPSA 1JMBA 1FZEC 2R3CA 1SFCC 3E7KA 5AW8B 3VP9A 3LW5H 2KS1B 3RK2C 3E1IA 1CI6A 2MJZA 1KTMA 1QVFO 1NTMK 4ZMDA 3L72J 3L74D 4ZFGA 3Q3DA 4PD4I 1Z56A 3LIDA 2P2UA 2J61B 2IPPA 3CXHD 3L4FA 1Q2NA 4KT0J 4A7PA 2QEXP 3B4SA 4LC1A 1RF0B 3GHGA 1SQBJ 1FIBA 3U1AA 2RMZA 2QE7H 1LT9C 1FZEA 1YTZI 2A45I 1D7MA 1KQFB 2QJYB 5KLVE 1GTWA 3VP8A 1KC8Q 4BXLA 4D6TE 2KP8A 2HPCB 1R5LA 2ZT9D 3AE1C 3TGUG 3W68A 2QJPC 1SQXJ 1VQ8P 2KYVA 1SVFA 2H88C 3I56P 1U57A 3SWFA 3RL0g 5BVZA 1JM0A 1LTIC 3MP7B 2GM4A 1NKZB 4L74A 2YO2A 1FOSF 1PP9E 2WPVB 4L75A 1KB9D 4H13D 3TF5A 3S9OA 1HH0A 1FS0E 3L74J 1BE3G 2ZXXA 1KQLA 4IFMA 4W7YA 4DCKA 1N86C 1BSNA 3P8CE 4O9BA 2PFXA 3V6IA 2OYHA 1SQQE 3IF4A 1IK7A 2R44A 2FYUE 4C46A 1OMIA 3H1IE 1N2DC 1JNMA 4XE5B 3WUTA 2IDBA 1NU1K 1NKNA 1J1DB 1MUUA 3FWNA 4WWIA 3Q5PA 3KXDA 5L8RJ 3G9RA 2RH0A 3M0AA 4EIJA 2JHHC 1Z3SA 2QM8A 2XV5A 4H0LB 3RL0B 1N86A 2GY7A 1BSHA 1KORA 1GD2E 5H2FH 3I5CA 2OGUA 1ZLLA 2FFDA 1SQPD 2L5GB 5AVXB 2V7QJ 3A0BE 3FXEA 3K5BA 3R2PA 1EC5A 1WRGA 2XKMA 1PPJD 1IJDB 3MUDC 2FXPA 4U7JA 1N8RQ 2Q9IB 3Q2YA 1A02J 5CCGA 1E79H 3BATA 2FKWB 3O6QB 1SP4A 2K88A 4CPGA 2IBZG 2QJYC 1AJYA 3H32B 3L70E 1J1EB 2BCCG 1FZFC 1ZP0C 1PL5A 5APVA 1HJ0A 1K8AQ 1S2EA 1S9KD 1M1JC 4PD4H 3MUDA 1BGYE 4PD4E 4GOFA 3L37A 4R4MA 5AVUB 2NRGA 3H1KG 2C0WA 1S1CX 2E74C 1X0TA 2FXMA 1FZFA 4YTPC 1MV8A 1W2EA 3PRJA 1K9MQ 1T8ZA 2W90A 1IZNB 1P84H 1YTZT 5AVTB 1NVOA 4UB8H 1OW6A 2P7JA 3H1LD 1GL2B 1JY3P 1P84E 1FZGB 4ZNCA 4UB8E 1BDCA 2GUSA 1JC9A 1M1JA 2H8PD 3CWBG 2R32A 2YXRB 2WWWA 4H0LD 3RL0D 3V4QA 4AQRD 1LTJC 2C0XA 5AVZB 2H43A 3CXHE 1L0LK 4RO0A 1JUNA 3GF3A 4H0LC 3RL0C 2N1TB 2IBZI 1UIIA 3RK3C 3AEBC 2J64A 2XNXC 3KQGA 3MZWB 1T2KD 2QRXA 4I6MC 3BVHB 1JTHB 1MKMA 3V2NA 1FOSE 2O3JA 2ZFCA 2YO3A 4JYBA 2WSFH 3IFMA 1NTZK 1Y47A 3FWLA 5KLVD 1OW8A 1G2CA 1S3JA 2J0GA 1LTJA 1NTZG 3CCJP 3MGNA 4YPCA 1NTME 2Q9IC 2ZVOB 1GU5A 1N7LA 1FZAB 4D6TD 2KNCA 4N6JA 5M1BA 2K9JB 3H1HG 3L71G 1X79B 2E75B 1SLQA 2WT7A 3H1LJ 2Y0CA 2XNXA 1L0NK 2BASA 2C9LY 1J1EC 2J5ZA 1MFZA 2OYIC 1L0NG 1OWAA 2A06G 3BRVB 1NTKK 1NHLA 2ZYDA 1HVVA 3HD7B 3LW5J 1NTKG 3E1IB 5E79H 5CJ0A 1PFIA 3PLNA 4HH2A 4BWNA 5E79E 2J3FD 2JR8A 2Y9YA 3P8CD 5AVRB 2QVAA 4IFDK 1SQQD 1BCCG 1VF5C 2PP6A 5CCHD 4N78E 4PV1D 4WY4A 1YIJP 2FYUD 3SSUA 2JWDA 4K35A 2Y0DA 3H1ID 1Y9BA 4IL6H 1FZDA 4R4LA 1GL2D 2OYIA 2D2CB 5CCHC 1LTGC 2KLVA 2QA4P 5DJUB 5KLVJ 1M7LA 4IL6E 3H1JE 4KHXA 2N9BA 4U3FD 1GDTA 4RKUJ 3NMDA 4TLFA 1GL2C 1QLED 4GOEA 4D6TJ 1SQPE 1S4XA 1EDJA 3A0HH 2N1TD 2O01N 4DOJA 3IAOA 3CCEP 3A0HE 3HTKA 3L72G 1JCDA 4BRYB 3C1LA 2W6BA 2E76B 1PP9J 5EFWB 3BCCE 1TU3F 5AVSB 3CX5H 1NU1E 2NPSA 2IZ1A 1SQBG 5GTIH 2WQYC 1E5WA 2KSJA 3CX5E 3NFQA 2AXTH 2I8DA 3BVHC 5APQA 1OVUA 2Z4EA 4KJMA 1SQQJ 1NJIQ 2ZT9B 2J59M 2FYUJ 3L70D 3QH9A 4YXDC 2QM7A 3H1IJ 4K3AA 2LR2A 2E75D 2Q3EA 2YXQB 3G6EP 1FZAC 4AYCA 1LTBC 1ZMEC 3D6YA 1SQVK 1SQXG 1RQUA 4DZOA 4JZCA 3HD7D 5KKZB 1K04A 2AEMA 3OJAB 1H88A 1HBWA 2CPBA 3TSIA 3MD0A 1BGYD 1KYOI 4PD4D 1FAVA 2HR3A 1N7SC 3CD6P 3L74G 2M3EA 1JCCA 1NYHA 1Q90D 3CCRP 2Q5UA 1HWTC 2FIBA 1KILE 1FZBC 5KJ7C 5APSA 2B87B 3KHUA 2D2CD 3L75D 4XA4A 4JF7A 1X9VA 3L73E 1P84D 2W83C 4Z1MH 1LWUB 3D6ZA 2R5DA 3B71A 1OX3A 2ITAA 3GMAA 1H8AA 2D2CC 3L70J 1N7SA 2J3GA 1VQLP 2YKQA 2IYOA 2Q3IA 2KXPB 1ZV8A 5KTBA 2OARA 1FZBA 5KJ7A 3M9HA 2E76D 1FDOA 5CHXA 1SFCA 1YHQP 1OZHA 3V2QA 1LT1A 3M06A 1BGYJ 4PJ0H 2WVRA 2E76C 1FJKA 1KN7A 1EQ7A 3AE4C 1LGHB 4JYOX 3AE9C 4PJ0E 2M5AA 3HE5B 1R8EA 2J1GA 1JEKA 3S1KA 2P67A 2J3UA 1URQB 1L0LE 1NTMD 3UIAA 3AEGC 3CPWO 4GDOA 1PV3A 2LXCB 3F89A 3L75J 1LT9A 2ZT9C 4Y28J 4OGQB 2J0HA 1RE4B 3AEFC 3HUSB 1FJPA 1AQ5A 1AFOA 3H6PA 1GK4A 2OYOA 4HKZH 3VMYA 2H89C 1VQOP 1YBKA 3HE4A 2ZYAA 1R5SA 2KB7P 4H13C 3V2PA 5KKZC 4XFJA 4M7FA 1T3JA 3CC4P 4C7NA 3FXDA 5APWA 4LLHA 3M9BA 1LNQA 4N78D 3TGUD 3A3YB 3KZIH 4W7ZA 5KLIC 1KILB 1ZR4A 2AEJA 4U3FE 3KZIE 1H0TA 4C7RA 3TNUB 1J2JB 2NZ2A 2XU6A 3H1JD 1M56D 2WSFJ 1BE3D 1NTMJ 2JDIH 1VQMP 5H2FE 1K05A 1XTCC 4RESB 3PP5A 3T97B 1USDA 1L4AB 2WPSA 1IFIA 1OVRA 5AW9B 3P8MC 1AQTA 2ZJSE 1GW3A 1RF0C 1UIXA 2LKMA 1IFNA 3BCCD 3CLQA 3IN6A 2WTYA 3R4YA 1NU1D 3VYIA 2W6AA 2HODB 1HTLC 3CX5D 3GW6A 1HGZA 1FDMA 2KS1A 5AVYB 3AE7C 2HLOB 1EZVG 1S5LH 1QL2A 1URQD 3W67A 4NYTA 1S5LE 1LTAC 1EXIA 2J61A 2HPCC 3F5HA 1OFCX 1URQC 2R5BA 1AVOA 4OGQD 1RF0A 5AW4B 5AVVB 2FBWC 3H1JJ 5APUA 3TK1A 2KUBA 3JC22 3NXSA 5DJTB 2J0YA 2HG5D 3H1LG 3B5NB 1PZQA 4LGDE 3FX0A 3P32A 4OGQC 4Y99B 3HUSC 1SQPJ 2E43A 1GW4A 2GUVA 2PGDA 2IBZD 3EFGA 2A45H 5APYA 4PV1B 3H25A 1W2BO 2O01H 4NPFX 1LP1B 2I1JA 3L75E 1S72P 1KZUB 1KILD 1JY3N 3BCCJ 4WVZA 3VMAA 1NU1J 4I7ZB 5APXA 1JY2N 1USEA 3L73D 2YKPA 1SQVE 1JY2P 3Q1MA 1RQVA 2P1JA 1J1DC 1FZCB 1IFMA 3M0DC 2IFMA 2Q1KA 5KLVG 5BU5A 1IO4A 1AVYA 2W8ZA 1N73B 3PJSK 3ITKA 3CCMP 1L4AD 4W80A 5GTHH 1EZVI 2E5TA 4D6TG 1ZW0A 4H44B 1VL2A 2BEQD 3EFFK 2PRRA 1L4AC 4GODA 1T2KC 3JCUH 4L76A 1RE3B 2WSEH 1PP9G 2WSCH 1YITP 2JWAA 2KLUA 3II6A 2HODC 4AUWA 1L0LD 3SFEC 1X8YA 3H32C 5AVQB 4JQ0D 1SQQG 2HLOC 1RF1B 4WBAA 2FYUG 4EYYQ 3HRNA 3L73J 1IC2A 4HJGH 3H1IG 3S4RA 2WSSH 1XTGB 1VQ9P 3B5ND 2LXBA 1CI6B 2ZXEB 1T3UA 4EOTA 3U1CA 4HYTB 3CCSP 3VOPA 2Q9IA 3B5NC 3O6QA 4Y99C 3TGUE 2YIUB 2YMKA 3A5TA 3H32A 3GHGB 1GU4A 2QG4A 2O1KA 2B89A 1JMMA 3H1HD 2B9BA 2OTKE 4JPZB 4PV1C 1FZEB 1FU1A 3EWKA 1GK6A 2W27A 2JHIF 3PHLA 1BE3E 5B66H 1FZGC 2IX7C 1NTKD 1DD3A 3PH0A 4EDFA 1Z3UA 1Q86Q 2AEFA 3CCUP 3L36A 4JYCA 1L0LJ 1YJ9P 2FYZA 3O8ZA 2OTLP 1VQ6P 3RBXA 1M57D 3GG2A 2QSIA 1BCCD 4H44D 3L70G 1DD4A 2KOGA 3CL3D 2N1TC 4ZKUA 2ZYGA 3VN0A 1SQBK 5CCHA 2N9YB 1QVGO 4H44C 4MN4C 4IFFA 5GTIE 5KAIH 1GL2A 3CC2P 2JKVA 1G1IA 1FZGA 2AXTE 3Q5SA 3V2RA 1PIXA 1FC2C 5KAIE 3WMM0 2V4HA 5TISH 2OYHB 1BGYG 4UB6H 1KQSO 1NH4A 1RE3C 5TISE 4R9JA 3H1HJ 5BU8B 4UB6E 3I55P 1SQXK 1DH3A 1VQKP 2N1TA 1YJNP 2POHA 1QGKB 4U3FJ 2E75C 1OIPA 1DEBA 2R3SA 1OW7A 4DT0A 2Q7CA 2MKVA 3BVHA 1JTHA 2YMYA 2FYNB 3HD7C 1N86B 2IBZE 1YYCA 2XZRA 4JBZA 3E1IC 2JHMF 2FFDB 2BCCE 1DIPA 4QMAA 1YQ4C 3AE8C 2WNPF 1LJ2A 3SFDC 3C8VA 1RHZB 2GA1A 2M0BA 3N4XA 4I2LC 1FZAA 5AW1B 1M8OB 2L91A 1SFCD 2K9JA 3VMZA 2B88A 3EQ2A 2JHKF 3AE6C 1NAFA 1AA0A 1Q82Q 1VQNP 3CI9A 3Q5RA 3V4WA 2M3BA 1ZXGA 2WZ7A 1SQVD 1LTTC 1OVVA 1ZRTE 3HD7A 3VTPC 1BDDA 3H1KE 1NAYA 1JO5A 2JEEA 2CK3H 3RK3E 1VPCA 1NTMG 4NPEA 2IZ0A 5C39A 1NWQA 4ASWA 4N3YB 3CWBE 1DEEG 1YI2P 3IR9A 3D70A 4GT1A 2K37A 1G1JA 4R9TA 3C9IA 2Q6QA 2IYPA 1P84I 1U7JA 1FZFB 3B8EB 3CMAP 1KQGB 1JOCA 3GLMA 2O01J 2OYHC 1X22A 2WMMA 3CXHI 1HF9A 2OTJP 3AE5C 4BRYA 1SQVJ 1M1JB 3BASA 1K73Q 2KK7A 1NGMB 1OXZA 1NTZE 4DJGA 2H43B 1HUCA 3H1JG 4ZKPA 2JP3A 1CZQA 1QL1A 4M3LA 2WPRA 2E74B 3WUVA 1SQPK 2FYNC 4B86A 3U59A 1VDFA 2FY8A 3H1HE 3L71E 1SQPG 5K5GB 1LTSC 2FFDC 3FGAD 1L0NE 2J5UA 1YQ3C 2A06E 2J2PA 4OVNF 1GZLA 1PPJG 1NTKE 5CCGD 3BCCG 3P7KA 1H89A 1G2CB 1LTJB 1NU1G 3E1RA 1LWUC 2WSEJ 2OQQA 2WSCJ 2KZIA 1KB9I 2W6JH 1EDIA 3KYQA 1A02F 3RGUA 3G4SP 5CCGC 1BCCE 3N7NA 4IL6X 2I1KA 2KNCB 2J3OA 1ZOYC 2J60A 3ABVC 5CJ4A 3RK3B 1YJWP 2WT7B 1KD1Q 2XNXB 1KYOH 3A0BH 1EXJA 1KMIZ 1WT6A 5AW3B 1KYOE 5B5EH 4L73A 2B87A 2Z5IA 3AE3C 1HGVA 5B5EE 1DX7A 3L35A 1KV4A 1LWUA 1EDLA 2SPZA 3QWOC 3TGUJ 3MTUE 4WB4A 2WPQA 3TYYA 1QEXA 2KZJA 3BRTB 1VQ7P 2JO1A 3AE2C 4YXWH 3L72E 4WY4B 1FDIA 3SWYA 4IOIH 1FICA 4ASVA 4OH8B 3V5BA 1ZR2A 2OYIB 1KFMA 2PAJA 1SQBE 1Q81Q 1BE3J 1RE4C 3M9QA 2M8RA 3L73G 2H7HA 2QJKB 1GMJA 5AW0B 4I1LA 2E74D 1PGJA 2ZAEB 1EZVD 3HE5A 3OW2O 1VF5B 2BCCD 1T6AA 3HTKB 5TJHA 2H43C 5AW2B 2HPCA 3CX5I 3MIWA 4EI2A 1VQ4P 1URQA 2K9YA 3GF7A 1SQXE 1ZN5A 2Y0EA 2NPSB 2G8YA 1PGOA 1KILC 5KLVK 1CSBA 1RE4A 3A7OA 3HUSA 1CW5A 2Z4EB 1ZRTD 4EPUA 3CMEP 3G3ZA 3A2AA 1HJBA 2K1AA 3L74E 3H1KD 3CXHH 2WITA 3MHVA 3RK3D 5GTHE 1AV1A 3OA7A 1L0LG 3M91A 3CCLP 2G3AA 3CCQP 3WU2H 1M1KQ 3AEEC 2J58A 2ZVNB 4OWFA 3WU2E 1KILA 1IK9A 1MZ9A 1L2PA 3CWBD 3JCUE 3M0DA 1RH5B 4GIFA 1PGPA 2RKLA 3TNUA 5KAFH 1IFDA 5CBOA 2BCCJ 2KIKA 1IFPA 5KAFE 2VRSA 1SQQK 3AEAC 3D71A 2XDJA 1SS1A 4WY4D 2E5YA 2FYUK 1QX8A 3FIBA 3T97A 3OAKA 2O1JA 2V7QH 3NTNA 1L4AA 2JHLF 3CCVP 4WY4C 3LIEA 1KB9H 5AW6B 2IFNA 1KB9E 4U3FG 1PGQA 3WUUA 3CC7P 3H1KJ 1NTZD 3AECC 1PP9D 1VQPP 2HODA 2XNDH 4HB1A 1N7SB 5AW7B 1FBMA 2YNYA 1VF5D 4GKGA 2QJKC 2HLOA 3AEDC 2D39A 3L71D 1FZBB 2P58A 5CBNA 1WMKA 1SFCB 2Y9ZA 2FXOA 1MFTA 2NPSD 2KI7B 5APTA 1L0ND 3CWBJ 3RK2B 4M7HA 2A06D 3TDKA 1KFNA 2BEZF 4I7ZC 2M5AB 5B66E 2YKOA 2NPSC 2E42A 3B5NA 1FZCC 2P10A 1W5CE 1EDKA 1NOHA 3USSA 2J3FA
chains in the Genus database with same CATH topology
2C9NY 2Z4EC 1XTCC 4RESB 3PP5A 1N73C 1VPCA 3RL0C 2N1TB 1L4AB 2WPSA 1LT9B 1IFIA 1FIDA 5AW9B 3P8MC 3RK3C 2J64A 1IFJA 2XNXC 1GW3A 3KQGA 1T2KD 1NO4A 1RF0C 1NWQA 4I6MC 2LKMA 4N3YB 1IFNA 3BVHB 1JTHB 3CLQA 3V2NA 1FOSE 2WTYA 2ZFCA 3IR9A 2YO3A 3HE4B 4GT1A 4JYBA 3VYIA 2W6AA 2WSFH 2HODB 1HTLC 3IFMA 1G1JA 1NTZK 1HGZA 5CMZA 4R9TA 1FDMA 1G2CA 3C9IA 5AVYB 1FZCA 2J0GA 1LTJA 4C7NB 3MGNA 2HLOB 1QL2A 1JY3O 1URQD 1FZFB 2Q9IC 1RY3A 3B8EB 4NYTA 1GU5A 1N7LA 1FZAB 1N73A 1LTAC 1JOCA 4N6JA 2JJLA 2OYHC 2J61A 2HPCC 1JY2O 5AW5B 1X79B 1SLQA 2WT7A 1URQC 2R5BA 2A45G 2XNXA 1RF1C 1L0NK 2BASA 2C9LY 1J1EC 2J5ZA 1RF0A 5AW4B 5AVVB 1MFZA 1S9KE 2OYIC 3BASA 1M1JB 1OWAA 3BRVB 5APUA 5AVWB 3NXSA 1NTKK 2Z5HA 1NHLA 3TK1A 2HG5D 2J0YA 3B5NB 1HVVA 4LGDE 3HD7B 1OXZA 3P32A 3E1IB 4Y99B 5CJ0A 1HUCA 3KDPB 1PFIA 4ZKPA 3KPEA 1N7SD 2H43B 2HFED 3HUSC 4HH2A 1RE3A 1CZQA 1QL1A 2E43A 4M3LA 1GW4A 2J3FD 2WPRA 2GUVA 3VMXA 1SQPK 3EFGA 2A45H 4B86A 2HYNA 3U59A 1VDFA 3P8CD 5APYA 5AVRB 4IFDK 5KJ7D 2PP6A 2O01H 5CCHD 1LTSC 4N78E 2I1JA 4WY4A 2FFDC 1KZUB 3GHGC 1KILD 3RK2D 1JY3N 1RF1A 2J2PA 1FZDA 1GL2D 2CPSA 1GZLA 2OYIA 5CCHC 1FZEC 5APXA 2R3CA 1SFCC 1LTGC 2KLVA 1JY2N 1M7LA 5CCGD 2YKPA 1JY2P 5AW8B 3VP9A 2P1JA 4KHXA 3LW5H 2N9BA 3P7KA 1G2CB 1J1DC 3RK2C 1IFMA 1H89A 1FZCB 1GDTA 3E1IA 1LTJB 1CI6A 1LWUC 2MJZA 3NMDA 3M0DC 1GL2C 2IFMA 1NTMK 5BU5A 3KYQA 1A02F 1IO4A 5CCGC 3N7NA 4ZFGA 1N73B 2I1KA 1Z56A 3LIDA 2P2UA 2J3OA 2J61B 2J60A 2N1TD 1L4AD 2IPPA 4W80A 4DOJA 5CJ4A 3RK3B 3HTKA 3L4FA 2WT7B 2XNXB 4LC1A 1RF0B 1JCDA 3GHGA 1FIBA 1WT6A 2W6BA 5AW3B 3U1AA 1L4AC 1LT9C 2Z5IA 5AVSB 1FZEA 1HGVA 1YTZI 2NPSA 2A45I 1T2KC 1E5WA 2KSJA 3NFQA 1DX7A 3L35A 1RE3B 2WSEH 1LWUA 2WSCH 1GTWA 3BVHC 5APQA 3VP8A 3II6A 2Z4EA 3MTUE 4WB4A 2WPQA 2HODC 3TYYA 3BRTB 4AUWA 2KP8A 2HPCB 4WY4B 2J59M 3SWYA 1X8YA 3H32C 1FICA 5AVQB 2QM7A 2HLOC 1RF1B 2KYVA 1SVFA 4OH8B 3V5BA 4WBAA 1ZR2A 2OYIB 1KFMA 3SWFA 1FZAC 2PAJA 4AYCA 1LTBC 3HRNA 5BVZA 1IC2A 1LTIC 2GM4A 1NKZB 1SQVK 1XTGB 4DZOA 2YO2A 3B5ND 1FOSF 4JZCA 3HD7D 1CI6B 1RE4C 3OJAB 2ZXEB 1T3UA 3M9QA 1H88A 1HBWA 2M8RA 4EOTA 1HH0A 3U1CA 2H7HA 2CPBA 4HYTB 3TSIA 3MD0A 5AW0B 1KQLA 3VOPA 1FAVA 4IFMA 4I1LA 2Q9IA 4W7YA 3B5NC 1N86C 1N7SC 3HE5A 3P8CE 4O9BA 3HTKB 4Y99C 2H43C 2OYHA 5AW2B 2HPCA 1JCCA 3A5TA 3MIWA 3H32A 1URQA 2Q5UA 3GHGB 1GU4A 1HWTC 2FIBA 2O1KA 1JMMA 4C46A 1FZBC 5KJ7C 5APSA 1N2DC 1JNMA 1ZN5A 4XE5B 1FU1A 1FZEB 2NPSB 1NU1K 4XA4A 1GK6A 1NKNA 1KILC 4JF7A 2W27A 1J1DB 1X9VA 1MUUA 2JHIF 5KLVK 1LWUB 1CSBA 1RE4A 3A7OA 2R5DA 3HUSA 1FZGC 1H8AA 3M0AA 2IX7C 4EIJA 1CW5A 2Z4EB 2JHHC 1Z3SA 2QM8A 1Z3UA 2XV5A 4EPUA 3G3ZA 3RL0B 3L36A 3A2AA 1HJBA 4JYCA 1N86A 2GY7A 2FYZA 3O8ZA 1N7SA 2J3GA 1GD2E 2WITA 3I5CA 2YKQA 1ZLLA 2FFDA 3RK3D 2Q3IA 2L5GB 3OA7A 3M91A 5AVXB 2KOGA 1ZV8A 5KTBA 3CL3D 2OARA 2N1TC 1FZBA 4ZKUA 5KJ7A 3M9HA 3VN0A 1SQBK 5CCHA 5CHXA 1SFCA 2J58A 3R2PA 1KILA 1IK9A 1MZ9A 1WRGA 2XKMA 3V2QA 4IFFA 3M06A 3M0DA 1IJDB 1GL2A 1FJKA 4GIFA 3TNUA 1G1IA 1FZGA 2Q9IB 1EQ7A 1IFDA 1LGHB 3V2RA 4JYOX 1A02J 5CCGA 3WMM0 3BATA 2FKWB 3HE5B 2VRSA 1SP4A 2J1GA 2OYHB 1SQQK 1NH4A 2P67A 1RE3C 3H32B 2J3UA 2XDJA 1URQB 4WY4D 3UIAA 4R9JA 5BU8B 1J1EB 1FZFC 2FYUK 3FIBA 3T97A 3OAKA 1SQXK 2O1JA 3NTNA 1DH3A 2N1TA 1L4AA 1LT9A 2POHA 2JHLF 5APVA 4WY4C 3LIEA 1DEBA 2J0HA 5AW6B 1RE4B 2IFNA 1S9KD 3HUSB 1FJPA 2Q7CA 1AQ5A 1M1JC 3BVHA 3MUDA 1AFOA 1JTHA 2YMYA 3H6PA 1GK4A 3VMYA 3HE4A 3HD7C 1N86B 2HODA 1YYCA 1N7SB 2XZRA 3E1IC 5AW7B 2KB7P 3L37A 3V2PA 1FBMA 5AVUB 4M7FA 2JHMF 2YNYA 4GKGA 2FFDB 1T3JA 4C7NA 2C0WA 2HLOA 2WNPF 2D39A 5APWA 4LLHA 2FXMA 1FZFA 1MV8A 1W2EA 3M9BA 1FZBB 3N4XA 4I2LC 1FZAA 4N78D 5AW1B 1SFCB 3A3YB 1T8ZA 4W7ZA 1SFCD 2NPSD 1YTZT 5AVTB 1KILB 5APTA 3RK2B 3VMZA 4M7HA 1ZR4A 3EQ2A 2JHKF 1NAFA 2P7JA 4C7RA 1GL2B 1JY3P 3CI9A 3TNUB 1J2JB 1KFNA 1FZGB 2GUSA 3V4WA 2M3BA 1JC9A 1M1JA 2XU6A 2WZ7A 2H8PD 2YKOA 2NPSC 2R32A 1LTTC 2E42A 2WWWA 3B5NA 3HD7A 3RL0D 3V4QA 3VTPC 4AQRD 1FZCC 1LTJC 2C0XA 5AVZB 2H43A 1L0LK 1NOHA 1JO5A 2J3FA 2JEEA 1JUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYO X;  2Z4E C;  3GHG C;  4JZC A;  1JY3 N;  1N73 C;  1RF1 A;  1RE4 C;  2J1G A;  1T3U A;  2J2P A;  2OYH B;  1LT9 B;  1FZD A;  1FID A;  2OYI A;  3H32 B;  1RE3 C;  2J3U A;  1FZE C;  4R9J A;  2J64 A;  2XNX C;  1JY2 N;  2Q9I A;  1FZF C;  1JY2 P;  1RF0 C;  1N86 C;  3FIB A;  1FZC B;  3E1I A;  1LTJ B;  1LWU C;  3BVH B;  2H43 C;  2OYH A;  2HPC A;  1LT9 A;  2JHL F;  3H32 A;  3GHG B;  2HOD B;  2FIB A;  2J0H A;  4ZFG A;  1N73 B;  1RE4 B;  4R9T A;  3HUS B;  1FZB C;  2J3O A;  2J61 B;  1FZC A;  2J0G A;  2J60 A;  1LTJ A;  1M1J C;  1FZE B;  3BVH A;  2HLO B;  2XNX B;  1JY3 O;  1FZF B;  2Q9I C;  1N86 B;  1RF0 B;  4NYT A;  3GHG A;  2HOD A;  1FIB A;  2JHI F;  1FZA B;  3E1I C;  1N73 A;  1LWU B;  1RE4 A;  4M7F A;  3HUS A;  2JHM F;  2FFD B;  2OYH C;  2J61 A;  2HPC C;  1FZG C;  1JY2 O;  1LT9 C;  2Z4E B;  1FZE A;  2JHH C;  1Z3S A;  1Z3U A;  2HLO A;  2WNP F;  4EPU A;  2A45 I;  2D39 A;  2A45 G;  2XNX A;  1RF1 C;  1FZF A;  1W2E A;  2J5Z A;  1FZB B;  1N86 A;  1RF0 A;  2GY7 A;  1RE3 B;  2OYI C;  2J3G A;  1FZA A;  1M1J B;  1LWU A;  3BVH C;  2FFD A;  2J0Y A;  2Z4E A;  4M7H A;  2JHK F;  2HOD C;  3E1I B;  2H43 B;  1JY3 P;  1FZB A;  3HUS C;  2HPC B;  1FZG B;  1RE3 A;  1JC9 A;  1M1J A;  3H32 C;  1FIC A;  2J3F D;  2HLO C;  1RF1 B;  2A45 H;  1FZC C;  1LTJ C;  2OYI B;  2H43 A;  1FZA C;  2J3F A;  1FZG A;  2Q9I B;  2FFD C; 
#chains in the Genus database with same CATH topology
 2C9N Y;  2Z4E C;  1N73 C;  1M90 Q;  1LT9 B;  4TT3 H;  1FID A;  1VQ5 P;  1LP1 A;  1IFJ A;  1NO4 A;  4RJT A;  1KYO D;  1PPJ E;  1NTZ J;  3SWK A;  3HE4 B;  5CMZ A;  3ZDM A;  4NPD A;  1Y8A A;  1FZC A;  4C7N B;  3G71 P;  2QJP B;  1JY3 O;  3L71 J;  2AXC A;  1RY3 A;  1N73 A;  2KSE A;  3L72 D;  2JJL A;  1L0N J;  1JY2 O;  5AW5 B;  2DW3 A;  2A45 G;  1H0T B;  1RF1 C;  1NTK J;  3L75 G;  1S5L X;  1S9K E;  3RBZ A;  1SQB D;  5AVW B;  2Z5H A;  4H13 B;  3KDP B;  1EZV E;  1SQV G;  1N7S D;  3KPE A;  1Q7Y Q;  2K3R A;  2HFE D;  1BCC J;  2QIW A;  1RE3 A;  3JSV C;  1JB0 J;  1FE6 A;  3VMX A;  2HYN A;  1U7M A;  2UWJ E;  5KJ7 D;  2YIU C;  5KLI B;  2RN0 A;  3GHG C;  3RK2 D;  1RF1 A;  3PTZ A;  1SQX D;  3H1L E;  2CPS A;  1JMB A;  1FZE C;  2R3C A;  1SFC C;  3E7K A;  5AW8 B;  3VP9 A;  3LW5 H;  2KS1 B;  3RK2 C;  3E1I A;  1CI6 A;  2MJZ A;  1KTM A;  1QVF O;  1NTM K;  4ZMD A;  3L72 J;  3L74 D;  4ZFG A;  3Q3D A;  4PD4 I;  1Z56 A;  3LID A;  2P2U A;  2J61 B;  2IPP A;  3CXH D;  3L4F A;  1Q2N A;  4KT0 J;  4A7P A;  2QEX P;  3B4S A;  4LC1 A;  1RF0 B;  3GHG A;  1SQB J;  1FIB A;  3U1A A;  2RMZ A;  2QE7 H;  1LT9 C;  1FZE A;  1YTZ I;  2A45 I;  1D7M A;  1KQF B;  2QJY B;  5KLV E;  1GTW A;  3VP8 A;  1KC8 Q;  4BXL A;  4D6T E;  2KP8 A;  2HPC B;  1R5L A;  2ZT9 D;  3AE1 C;  3TGU G;  3W68 A;  2QJP C;  1SQX J;  1VQ8 P;  2KYV A;  1SVF A;  2H88 C;  3I56 P;  1U57 A;  3SWF A;  3RL0 g;  5BVZ A;  1JM0 A;  1LTI C;  3MP7 B;  2GM4 A;  1NKZ B;  4L74 A;  2YO2 A;  1FOS F;  1PP9 E;  2WPV B;  4L75 A;  1KB9 D;  4H13 D;  3TF5 A;  3S9O A;  1HH0 A;  1FS0 E;  3L74 J;  1BE3 G;  2ZXX A;  1KQL A;  4IFM A;  4W7Y A;  4DCK A;  1N86 C;  1BSN A;  3P8C E;  4O9B A;  2PFX A;  3V6I A;  2OYH A;  1SQQ E;  3IF4 A;  1IK7 A;  2R44 A;  2FYU E;  4C46 A;  1OMI A;  3H1I E;  1N2D C;  1JNM A;  4XE5 B;  3WUT A;  2IDB A;  1NU1 K;  1NKN A;  1J1D B;  1MUU A;  3FWN A;  4WWI A;  3Q5P A;  3KXD A;  5L8R J;  3G9R A;  2RH0 A;  3M0A A;  4EIJ A;  2JHH C;  1Z3S A;  2QM8 A;  2XV5 A;  4H0L B;  3RL0 B;  1N86 A;  2GY7 A;  1BSH A;  1KOR A;  1GD2 E;  5H2F H;  3I5C A;  2OGU A;  1ZLL A;  2FFD A;  1SQP D;  2L5G B;  5AVX B;  2V7Q J;  3A0B E;  3FXE A;  3K5B A;  3R2P A;  1EC5 A;  1WRG A;  2XKM A;  1PPJ D;  1IJD B;  3MUD C;  2FXP A;  4U7J A;  1N8R Q;  2Q9I B;  3Q2Y A;  1A02 J;  5CCG A;  1E79 H;  3BAT A;  2FKW B;  3O6Q B;  1SP4 A;  2K88 A;  4CPG A;  2IBZ G;  2QJY C;  1AJY A;  3H32 B;  3L70 E;  1J1E B;  2BCC G;  1FZF C;  1ZP0 C;  1PL5 A;  5APV A;  1HJ0 A;  1K8A Q;  1S2E A;  1S9K D;  1M1J C;  4PD4 H;  3MUD A;  1BGY E;  4PD4 E;  4GOF A;  3L37 A;  4R4M A;  5AVU B;  2NRG A;  3H1K G;  2C0W A;  1S1C X;  2E74 C;  1X0T A;  2FXM A;  1FZF A;  4YTP C;  1MV8 A;  1W2E A;  3PRJ A;  1K9M Q;  1T8Z A;  2W90 A;  1IZN B;  1P84 H;  1YTZ T;  5AVT B;  1NVO A;  4UB8 H;  1OW6 A;  2P7J A;  3H1L D;  1GL2 B;  1JY3 P;  1P84 E;  1FZG B;  4ZNC A;  4UB8 E;  1BDC A;  2GUS A;  1JC9 A;  1M1J A;  2H8P D;  3CWB G;  2R32 A;  2YXR B;  2WWW A;  4H0L D;  3RL0 D;  3V4Q A;  4AQR D;  1LTJ C;  2C0X A;  5AVZ B;  2H43 A;  3CXH E;  1L0L K;  4RO0 A;  1JUN A;  3GF3 A;  4H0L C;  3RL0 C;  2N1T B;  2IBZ I;  1UII A;  3RK3 C;  3AEB C;  2J64 A;  2XNX C;  3KQG A;  3MZW B;  1T2K D;  2QRX A;  4I6M C;  3BVH B;  1JTH B;  1MKM A;  3V2N A;  1FOS E;  2O3J A;  2ZFC A;  2YO3 A;  4JYB A;  2WSF H;  3IFM A;  1NTZ K;  1Y47 A;  3FWL A;  5KLV D;  1OW8 A;  1G2C A;  1S3J A;  2J0G A;  1LTJ A;  1NTZ G;  3CCJ P;  3MGN A;  4YPC A;  1NTM E;  2Q9I C;  2ZVO B;  1GU5 A;  1N7L A;  1FZA B;  4D6T D;  2KNC A;  4N6J A;  5M1B A;  2K9J B;  3H1H G;  3L71 G;  1X79 B;  2E75 B;  1SLQ A;  2WT7 A;  3H1L J;  2Y0C A;  2XNX A;  1L0N K;  2BAS A;  2C9L Y;  1J1E C;  2J5Z A;  1MFZ A;  2OYI C;  1L0N G;  1OWA A;  2A06 G;  3BRV B;  1NTK K;  1NHL A;  2ZYD A;  1HVV A;  3HD7 B;  3LW5 J;  1NTK G;  3E1I B;  5E79 H;  5CJ0 A;  1PFI A;  3PLN A;  4HH2 A;  4BWN A;  5E79 E;  2J3F D;  2JR8 A;  2Y9Y A;  3P8C D;  5AVR B;  2QVA A;  4IFD K;  1SQQ D;  1BCC G;  1VF5 C;  2PP6 A;  5CCH D;  4N78 E;  4PV1 D;  4WY4 A;  1YIJ P;  2FYU D;  3SSU A;  2JWD A;  4K35 A;  2Y0D A;  3H1I D;  1Y9B A;  4IL6 H;  1FZD A;  4R4L A;  1GL2 D;  2OYI A;  2D2C B;  5CCH C;  1LTG C;  2KLV A;  2QA4 P;  5DJU B;  5KLV J;  1M7L A;  4IL6 E;  3H1J E;  4KHX A;  2N9B A;  4U3F D;  1GDT A;  4RKU J;  3NMD A;  4TLF A;  1GL2 C;  1QLE D;  4GOE A;  4D6T J;  1SQP E;  1S4X A;  1EDJ A;  3A0H H;  2N1T D;  2O01 N;  4DOJ A;  3IAO A;  3CCE P;  3A0H E;  3HTK A;  3L72 G;  1JCD A;  4BRY B;  3C1L A;  2W6B A;  2E76 B;  1PP9 J;  5EFW B;  3BCC E;  1TU3 F;  5AVS B;  3CX5 H;  1NU1 E;  2NPS A;  2IZ1 A;  1SQB G;  5GTI H;  2WQY C;  1E5W A;  2KSJ A;  3CX5 E;  3NFQ A;  2AXT H;  2I8D A;  3BVH C;  5APQ A;  1OVU A;  2Z4E A;  4KJM A;  1SQQ J;  1NJI Q;  2ZT9 B;  2J59 M;  2FYU J;  3L70 D;  3QH9 A;  4YXD C;  2QM7 A;  3H1I J;  4K3A A;  2LR2 A;  2E75 D;  2Q3E A;  2YXQ B;  3G6E P;  1FZA C;  4AYC A;  1LTB C;  1ZME C;  3D6Y A;  1SQV K;  1SQX G;  1RQU A;  4DZO A;  4JZC A;  3HD7 D;  5KKZ B;  1K04 A;  2AEM A;  3OJA B;  1H88 A;  1HBW A;  2CPB A;  3TSI A;  3MD0 A;  1BGY D;  1KYO I;  4PD4 D;  1FAV A;  2HR3 A;  1N7S C;  3CD6 P;  3L74 G;  2M3E A;  1JCC A;  1NYH A;  1Q90 D;  3CCR P;  2Q5U A;  1HWT C;  2FIB A;  1KIL E;  1FZB C;  5KJ7 C;  5APS A;  2B87 B;  3KHU A;  2D2C D;  3L75 D;  4XA4 A;  4JF7 A;  1X9V A;  3L73 E;  1P84 D;  2W83 C;  4Z1M H;  1LWU B;  3D6Z A;  2R5D A;  3B71 A;  1OX3 A;  2ITA A;  3GMA A;  1H8A A;  2D2C C;  3L70 J;  1N7S A;  2J3G A;  1VQL P;  2YKQ A;  2IYO A;  2Q3I A;  2KXP B;  1ZV8 A;  5KTB A;  2OAR A;  1FZB A;  5KJ7 A;  3M9H A;  2E76 D;  1FDO A;  5CHX A;  1SFC A;  1YHQ P;  1OZH A;  3V2Q A;  1LT1 A;  3M06 A;  1BGY J;  4PJ0 H;  2WVR A;  2E76 C;  1FJK A;  1KN7 A;  1EQ7 A;  3AE4 C;  1LGH B;  4JYO X;  3AE9 C;  4PJ0 E;  2M5A A;  3HE5 B;  1R8E A;  2J1G A;  1JEK A;  3S1K A;  2P67 A;  2J3U A;  1URQ B;  1L0L E;  1NTM D;  3UIA A;  3AEG C;  3CPW O;  4GDO A;  1PV3 A;  2LXC B;  3F89 A;  3L75 J;  1LT9 A;  2ZT9 C;  4Y28 J;  4OGQ B;  2J0H A;  1RE4 B;  3AEF C;  3HUS B;  1FJP A;  1AQ5 A;  1AFO A;  3H6P A;  1GK4 A;  2OYO A;  4HKZ H;  3VMY A;  2H89 C;  1VQO P;  1YBK A;  3HE4 A;  2ZYA A;  1R5S A;  2KB7 P;  4H13 C;  3V2P A;  5KKZ C;  4XFJ A;  4M7F A;  1T3J A;  3CC4 P;  4C7N A;  3FXD A;  5APW A;  4LLH A;  3M9B A;  1LNQ A;  4N78 D;  3TGU D;  3A3Y B;  3KZI H;  4W7Z A;  5KLI C;  1KIL B;  1ZR4 A;  2AEJ A;  4U3F E;  3KZI E;  1H0T A;  4C7R A;  3TNU B;  1J2J B;  2NZ2 A;  2XU6 A;  3H1J D;  1M56 D;  2WSF J;  1BE3 D;  1NTM J;  2JDI H;  1VQM P;  5H2F E;  1K05 A;  1XTC C;  4RES B;  3PP5 A;  3T97 B;  1USD A;  1L4A B;  2WPS A;  1IFI A;  1OVR A;  5AW9 B;  3P8M C;  1AQT A;  2ZJS E;  1GW3 A;  1RF0 C;  1UIX A;  2LKM A;  1IFN A;  3BCC D;  3CLQ A;  3IN6 A;  2WTY A;  3R4Y A;  1NU1 D;  3VYI A;  2W6A A;  2HOD B;  1HTL C;  3CX5 D;  3GW6 A;  1HGZ A;  1FDM A;  2KS1 A;  5AVY B;  3AE7 C;  2HLO B;  1EZV G;  1S5L H;  1QL2 A;  1URQ D;  3W67 A;  4NYT A;  1S5L E;  1LTA C;  1EXI A;  2J61 A;  2HPC C;  3F5H A;  1OFC X;  1URQ C;  2R5B A;  1AVO A;  4OGQ D;  1RF0 A;  5AW4 B;  5AVV B;  2FBW C;  3H1J J;  5APU A;  3TK1 A;  2KUB A;  3JC2 2;  3NXS A;  5DJT B;  2J0Y A;  2HG5 D;  3H1L G;  3B5N B;  1PZQ A;  4LGD E;  3FX0 A;  3P32 A;  4OGQ C;  4Y99 B;  3HUS C;  1SQP J;  2E43 A;  1GW4 A;  2GUV A;  2PGD A;  2IBZ D;  3EFG A;  2A45 H;  5APY A;  4PV1 B;  3H25 A;  1W2B O;  2O01 H;  4NPF X;  1LP1 B;  2I1J A;  3L75 E;  1S72 P;  1KZU B;  1KIL D;  1JY3 N;  3BCC J;  4WVZ A;  3VMA A;  1NU1 J;  4I7Z B;  5APX A;  1JY2 N;  1USE A;  3L73 D;  2YKP A;  1SQV E;  1JY2 P;  3Q1M A;  1RQV A;  2P1J A;  1J1D C;  1FZC B;  1IFM A;  3M0D C;  2IFM A;  2Q1K A;  5KLV G;  5BU5 A;  1IO4 A;  1AVY A;  2W8Z A;  1N73 B;  3PJS K;  3ITK A;  3CCM P;  1L4A D;  4W80 A;  5GTH H;  1EZV I;  2E5T A;  4D6T G;  1ZW0 A;  4H44 B;  1VL2 A;  2BEQ D;  3EFF K;  2PRR A;  1L4A C;  4GOD A;  1T2K C;  3JCU H;  4L76 A;  1RE3 B;  2WSE H;  1PP9 G;  2WSC H;  1YIT P;  2JWA A;  2KLU A;  3II6 A;  2HOD C;  4AUW A;  1L0L D;  3SFE C;  1X8Y A;  3H32 C;  5AVQ B;  4JQ0 D;  1SQQ G;  2HLO C;  1RF1 B;  4WBA A;  2FYU G;  4EYY Q;  3HRN A;  3L73 J;  1IC2 A;  4HJG H;  3H1I G;  3S4R A;  2WSS H;  1XTG B;  1VQ9 P;  3B5N D;  2LXB A;  1CI6 B;  2ZXE B;  1T3U A;  4EOT A;  3U1C A;  4HYT B;  3CCS P;  3VOP A;  2Q9I A;  3B5N C;  3O6Q A;  4Y99 C;  3TGU E;  2YIU B;  2YMK A;  3A5T A;  3H32 A;  3GHG B;  1GU4 A;  2QG4 A;  2O1K A;  2B89 A;  1JMM A;  3H1H D;  2B9B A;  2OTK E;  4JPZ B;  4PV1 C;  1FZE B;  1FU1 A;  3EWK A;  1GK6 A;  2W27 A;  2JHI F;  3PHL A;  1BE3 E;  5B66 H;  1FZG C;  2IX7 C;  1NTK D;  1DD3 A;  3PH0 A;  4EDF A;  1Z3U A;  1Q86 Q;  2AEF A;  3CCU P;  3L36 A;  4JYC A;  1L0L J;  1YJ9 P;  2FYZ A;  3O8Z A;  2OTL P;  1VQ6 P;  3RBX A;  1M57 D;  3GG2 A;  2QSI A;  1BCC D;  4H44 D;  3L70 G;  1DD4 A;  2KOG A;  3CL3 D;  2N1T C;  4ZKU A;  2ZYG A;  3VN0 A;  1SQB K;  5CCH A;  2N9Y B;  1QVG O;  4H44 C;  4MN4 C;  4IFF A;  5GTI E;  5KAI H;  1GL2 A;  3CC2 P;  2JKV A;  1G1I A;  1FZG A;  2AXT E;  3Q5S A;  3V2R A;  1PIX A;  1FC2 C;  5KAI E;  3WMM 0;  2V4H A;  5TIS H;  2OYH B;  1BGY G;  4UB6 H;  1KQS O;  1NH4 A;  1RE3 C;  5TIS E;  4R9J A;  3H1H J;  5BU8 B;  4UB6 E;  3I55 P;  1SQX K;  1DH3 A;  1VQK P;  2N1T A;  1YJN P;  2POH A;  1QGK B;  4U3F J;  2E75 C;  1OIP A;  1DEB A;  2R3S A;  1OW7 A;  4DT0 A;  2Q7C A;  2MKV A;  3BVH A;  1JTH A;  2YMY A;  2FYN B;  3HD7 C;  1N86 B;  2IBZ E;  1YYC A;  2XZR A;  4JBZ A;  3E1I C;  2JHM F;  2FFD B;  2BCC E;  1DIP A;  4QMA A;  1YQ4 C;  3AE8 C;  2WNP F;  1LJ2 A;  3SFD C;  3C8V A;  1RHZ B;  2GA1 A;  2M0B A;  3N4X A;  4I2L C;  1FZA A;  5AW1 B;  1M8O B;  2L91 A;  1SFC D;  2K9J A;  3VMZ A;  2B88 A;  3EQ2 A;  2JHK F;  3AE6 C;  1NAF A;  1AA0 A;  1Q82 Q;  1VQN P;  3CI9 A;  3Q5R A;  3V4W A;  2M3B A;  1ZXG A;  2WZ7 A;  1SQV D;  1LTT C;  1OVV A;  1ZRT E;  3HD7 A;  3VTP C;  1BDD A;  3H1K E;  1NAY A;  1JO5 A;  2JEE A;  2CK3 H;  3RK3 E;  1VPC A;  1NTM G;  4NPE A;  2IZ0 A;  5C39 A;  1NWQ A;  4ASW A;  4N3Y B;  3CWB E;  1DEE G;  1YI2 P;  3IR9 A;  3D70 A;  4GT1 A;  2K37 A;  1G1J A;  4R9T A;  3C9I A;  2Q6Q A;  2IYP A;  1P84 I;  1U7J A;  1FZF B;  3B8E B;  3CMA P;  1KQG B;  1JOC A;  3GLM A;  2O01 J;  2OYH C;  1X22 A;  2WMM A;  3CXH I;  1HF9 A;  2OTJ P;  3AE5 C;  4BRY A;  1SQV J;  1M1J B;  3BAS A;  1K73 Q;  2KK7 A;  1NGM B;  1OXZ A;  1NTZ E;  4DJG A;  2H43 B;  1HUC A;  3H1J G;  4ZKP A;  2JP3 A;  1CZQ A;  1QL1 A;  4M3L A;  2WPR A;  2E74 B;  3WUV A;  1SQP K;  2FYN C;  4B86 A;  3U59 A;  1VDF A;  2FY8 A;  3H1H E;  3L71 E;  1SQP G;  5K5G B;  1LTS C;  2FFD C;  3FGA D;  1L0N E;  2J5U A;  1YQ3 C;  2A06 E;  2J2P A;  4OVN F;  1GZL A;  1PPJ G;  1NTK E;  5CCG D;  3BCC G;  3P7K A;  1H89 A;  1G2C B;  1LTJ B;  1NU1 G;  3E1R A;  1LWU C;  2WSE J;  2OQQ A;  2WSC J;  2KZI A;  1KB9 I;  2W6J H;  1EDI A;  3KYQ A;  1A02 F;  3RGU A;  3G4S P;  5CCG C;  1BCC E;  3N7N A;  4IL6 X;  2I1K A;  2KNC B;  2J3O A;  1ZOY C;  2J60 A;  3ABV C;  5CJ4 A;  3RK3 B;  1YJW P;  2WT7 B;  1KD1 Q;  2XNX B;  1KYO H;  3A0B H;  1EXJ A;  1KMI Z;  1WT6 A;  5AW3 B;  1KYO E;  5B5E H;  4L73 A;  2B87 A;  2Z5I A;  3AE3 C;  1HGV A;  5B5E E;  1DX7 A;  3L35 A;  1KV4 A;  1LWU A;  1EDL A;  2SPZ A;  3QWO C;  3TGU J;  3MTU E;  4WB4 A;  2WPQ A;  3TYY A;  1QEX A;  2KZJ A;  3BRT B;  1VQ7 P;  2JO1 A;  3AE2 C;  4YXW H;  3L72 E;  4WY4 B;  1FDI A;  3SWY A;  4IOI H;  1FIC A;  4ASV A;  4OH8 B;  3V5B A;  1ZR2 A;  2OYI B;  1KFM A;  2PAJ A;  1SQB E;  1Q81 Q;  1BE3 J;  1RE4 C;  3M9Q A;  2M8R A;  3L73 G;  2H7H A;  2QJK B;  1GMJ A;  5AW0 B;  4I1L A;  2E74 D;  1PGJ A;  2ZAE B;  1EZV D;  3HE5 A;  3OW2 O;  1VF5 B;  2BCC D;  1T6A A;  3HTK B;  5TJH A;  2H43 C;  5AW2 B;  2HPC A;  3CX5 I;  3MIW A;  4EI2 A;  1VQ4 P;  1URQ A;  2K9Y A;  3GF7 A;  1SQX E;  1ZN5 A;  2Y0E A;  2NPS B;  2G8Y A;  1PGO A;  1KIL C;  5KLV K;  1CSB A;  1RE4 A;  3A7O A;  3HUS A;  1CW5 A;  2Z4E B;  1ZRT D;  4EPU A;  3CME P;  3G3Z A;  3A2A A;  1HJB A;  2K1A A;  3L74 E;  3H1K D;  3CXH H;  2WIT A;  3MHV A;  3RK3 D;  5GTH E;  1AV1 A;  3OA7 A;  1L0L G;  3M91 A;  3CCL P;  2G3A A;  3CCQ P;  3WU2 H;  1M1K Q;  3AEE C;  2J58 A;  2ZVN B;  4OWF A;  3WU2 E;  1KIL A;  1IK9 A;  1MZ9 A;  1L2P A;  3CWB D;  3JCU E;  3M0D A;  1RH5 B;  4GIF A;  1PGP A;  2RKL A;  3TNU A;  5KAF H;  1IFD A;  5CBO A;  2BCC J;  2KIK A;  1IFP A;  5KAF E;  2VRS A;  1SQQ K;  3AEA C;  3D71 A;  2XDJ A;  1SS1 A;  4WY4 D;  2E5Y A;  2FYU K;  1QX8 A;  3FIB A;  3T97 A;  3OAK A;  2O1J A;  2V7Q H;  3NTN A;  1L4A A;  2JHL F;  3CCV P;  4WY4 C;  3LIE A;  1KB9 H;  5AW6 B;  2IFN A;  1KB9 E;  4U3F G;  1PGQ A;  3WUU A;  3CC7 P;  3H1K J;  1NTZ D;  3AEC C;  1PP9 D;  1VQP P;  2HOD A;  2XND H;  4HB1 A;  1N7S B;  5AW7 B;  1FBM A;  2YNY A;  1VF5 D;  4GKG A;  2QJK C;  2HLO A;  3AED C;  2D39 A;  3L71 D;  1FZB B;  2P58 A;  5CBN A;  1WMK A;  1SFC B;  2Y9Z A;  2FXO A;  1MFT A;  2NPS D;  2KI7 B;  5APT A;  1L0N D;  3CWB J;  3RK2 B;  4M7H A;  2A06 D;  3TDK A;  1KFN A;  2BEZ F;  4I7Z C;  2M5A B;  5B66 E;  2YKO A;  2NPS C;  2E42 A;  3B5N A;  1FZC C;  2P10 A;  1W5C E;  1EDK A;  1NOH A;  3USS A;  2J3F A; 
#chains in the Genus database with same CATH homology
 2C9N Y;  2Z4E C;  1XTC C;  4RES B;  3PP5 A;  1N73 C;  1VPC A;  3RL0 C;  2N1T B;  1L4A B;  2WPS A;  1LT9 B;  1IFI A;  1FID A;  5AW9 B;  3P8M C;  3RK3 C;  2J64 A;  1IFJ A;  2XNX C;  1GW3 A;  3KQG A;  1T2K D;  1NO4 A;  1RF0 C;  1NWQ A;  4I6M C;  2LKM A;  4N3Y B;  1IFN A;  3BVH B;  1JTH B;  3CLQ A;  3V2N A;  1FOS E;  2WTY A;  2ZFC A;  3IR9 A;  2YO3 A;  3HE4 B;  4GT1 A;  4JYB A;  3VYI A;  2W6A A;  2WSF H;  2HOD B;  1HTL C;  3IFM A;  1G1J A;  1NTZ K;  1HGZ A;  5CMZ A;  4R9T A;  1FDM A;  1G2C A;  3C9I A;  5AVY B;  1FZC A;  2J0G A;  1LTJ A;  4C7N B;  3MGN A;  2HLO B;  1QL2 A;  1JY3 O;  1URQ D;  1FZF B;  2Q9I C;  1RY3 A;  3B8E B;  4NYT A;  1GU5 A;  1N7L A;  1FZA B;  1N73 A;  1LTA C;  1JOC A;  4N6J A;  2JJL A;  2OYH C;  2J61 A;  2HPC C;  1JY2 O;  5AW5 B;  1X79 B;  1SLQ A;  2WT7 A;  1URQ C;  2R5B A;  2A45 G;  2XNX A;  1RF1 C;  1L0N K;  2BAS A;  2C9L Y;  1J1E C;  2J5Z A;  1RF0 A;  5AW4 B;  5AVV B;  1MFZ A;  1S9K E;  2OYI C;  3BAS A;  1M1J B;  1OWA A;  3BRV B;  5APU A;  5AVW B;  3NXS A;  1NTK K;  2Z5H A;  1NHL A;  3TK1 A;  2HG5 D;  2J0Y A;  3B5N B;  1HVV A;  4LGD E;  3HD7 B;  1OXZ A;  3P32 A;  3E1I B;  4Y99 B;  5CJ0 A;  1HUC A;  3KDP B;  1PFI A;  4ZKP A;  3KPE A;  1N7S D;  2H43 B;  2HFE D;  3HUS C;  4HH2 A;  1RE3 A;  1CZQ A;  1QL1 A;  2E43 A;  4M3L A;  1GW4 A;  2J3F D;  2WPR A;  2GUV A;  3VMX A;  1SQP K;  3EFG A;  2A45 H;  4B86 A;  2HYN A;  3U59 A;  1VDF A;  3P8C D;  5APY A;  5AVR B;  4IFD K;  5KJ7 D;  2PP6 A;  2O01 H;  5CCH D;  1LTS C;  4N78 E;  2I1J A;  4WY4 A;  2FFD C;  1KZU B;  3GHG C;  1KIL D;  3RK2 D;  1JY3 N;  1RF1 A;  2J2P A;  1FZD A;  1GL2 D;  2CPS A;  1GZL A;  2OYI A;  5CCH C;  1FZE C;  5APX A;  2R3C A;  1SFC C;  1LTG C;  2KLV A;  1JY2 N;  1M7L A;  5CCG D;  2YKP A;  1JY2 P;  5AW8 B;  3VP9 A;  2P1J A;  4KHX A;  3LW5 H;  2N9B A;  3P7K A;  1G2C B;  1J1D C;  3RK2 C;  1IFM A;  1H89 A;  1FZC B;  1GDT A;  3E1I A;  1LTJ B;  1CI6 A;  1LWU C;  2MJZ A;  3NMD A;  3M0D C;  1GL2 C;  2IFM A;  1NTM K;  5BU5 A;  3KYQ A;  1A02 F;  1IO4 A;  5CCG C;  3N7N A;  4ZFG A;  1N73 B;  2I1K A;  1Z56 A;  3LID A;  2P2U A;  2J3O A;  2J61 B;  2J60 A;  2N1T D;  1L4A D;  2IPP A;  4W80 A;  4DOJ A;  5CJ4 A;  3RK3 B;  3HTK A;  3L4F A;  2WT7 B;  2XNX B;  4LC1 A;  1RF0 B;  1JCD A;  3GHG A;  1FIB A;  1WT6 A;  2W6B A;  5AW3 B;  3U1A A;  1L4A C;  1LT9 C;  2Z5I A;  5AVS B;  1FZE A;  1HGV A;  1YTZ I;  2NPS A;  2A45 I;  1T2K C;  1E5W A;  2KSJ A;  3NFQ A;  1DX7 A;  3L35 A;  1RE3 B;  2WSE H;  1LWU A;  2WSC H;  1GTW A;  3BVH C;  5APQ A;  3VP8 A;  3II6 A;  2Z4E A;  3MTU E;  4WB4 A;  2WPQ A;  2HOD C;  3TYY A;  3BRT B;  4AUW A;  2KP8 A;  2HPC B;  4WY4 B;  2J59 M;  3SWY A;  1X8Y A;  3H32 C;  1FIC A;  5AVQ B;  2QM7 A;  2HLO C;  1RF1 B;  2KYV A;  1SVF A;  4OH8 B;  3V5B A;  4WBA A;  1ZR2 A;  2OYI B;  1KFM A;  3SWF A;  1FZA C;  2PAJ A;  4AYC A;  1LTB C;  3HRN A;  5BVZ A;  1IC2 A;  1LTI C;  2GM4 A;  1NKZ B;  1SQV K;  1XTG B;  4DZO A;  2YO2 A;  3B5N D;  1FOS F;  4JZC A;  3HD7 D;  1CI6 B;  1RE4 C;  3OJA B;  2ZXE B;  1T3U A;  3M9Q A;  1H88 A;  1HBW A;  2M8R A;  4EOT A;  1HH0 A;  3U1C A;  2H7H A;  2CPB A;  4HYT B;  3TSI A;  3MD0 A;  5AW0 B;  1KQL A;  3VOP A;  1FAV A;  4IFM A;  4I1L A;  2Q9I A;  4W7Y A;  3B5N C;  1N86 C;  1N7S C;  3HE5 A;  3P8C E;  4O9B A;  3HTK B;  4Y99 C;  2H43 C;  2OYH A;  5AW2 B;  2HPC A;  1JCC A;  3A5T A;  3MIW A;  3H32 A;  1URQ A;  2Q5U A;  3GHG B;  1GU4 A;  1HWT C;  2FIB A;  2O1K A;  1JMM A;  4C46 A;  1FZB C;  5KJ7 C;  5APS A;  1N2D C;  1JNM A;  1ZN5 A;  4XE5 B;  1FU1 A;  1FZE B;  2NPS B;  1NU1 K;  4XA4 A;  1GK6 A;  1NKN A;  1KIL C;  4JF7 A;  2W27 A;  1J1D B;  1X9V A;  1MUU A;  2JHI F;  5KLV K;  1LWU B;  1CSB A;  1RE4 A;  3A7O A;  2R5D A;  3HUS A;  1FZG C;  1H8A A;  3M0A A;  2IX7 C;  4EIJ A;  1CW5 A;  2Z4E B;  2JHH C;  1Z3S A;  2QM8 A;  1Z3U A;  2XV5 A;  4EPU A;  3G3Z A;  3RL0 B;  3L36 A;  3A2A A;  1HJB A;  4JYC A;  1N86 A;  2GY7 A;  2FYZ A;  3O8Z A;  1N7S A;  2J3G A;  1GD2 E;  2WIT A;  3I5C A;  2YKQ A;  1ZLL A;  2FFD A;  3RK3 D;  2Q3I A;  2L5G B;  3OA7 A;  3M91 A;  5AVX B;  2KOG A;  1ZV8 A;  5KTB A;  3CL3 D;  2OAR A;  2N1T C;  1FZB A;  4ZKU A;  5KJ7 A;  3M9H A;  3VN0 A;  1SQB K;  5CCH A;  5CHX A;  1SFC A;  2J58 A;  3R2P A;  1KIL A;  1IK9 A;  1MZ9 A;  1WRG A;  2XKM A;  3V2Q A;  4IFF A;  3M06 A;  3M0D A;  1IJD B;  1GL2 A;  1FJK A;  4GIF A;  3TNU A;  1G1I A;  1FZG A;  2Q9I B;  1EQ7 A;  1IFD A;  1LGH B;  3V2R A;  4JYO X;  1A02 J;  5CCG A;  3WMM 0;  3BAT A;  2FKW B;  3HE5 B;  2VRS A;  1SP4 A;  2J1G A;  2OYH B;  1SQQ K;  1NH4 A;  2P67 A;  1RE3 C;  3H32 B;  2J3U A;  2XDJ A;  1URQ B;  4WY4 D;  3UIA A;  4R9J A;  5BU8 B;  1J1E B;  1FZF C;  2FYU K;  3FIB A;  3T97 A;  3OAK A;  1SQX K;  2O1J A;  3NTN A;  1DH3 A;  2N1T A;  1L4A A;  1LT9 A;  2POH A;  2JHL F;  5APV A;  4WY4 C;  3LIE A;  1DEB A;  2J0H A;  5AW6 B;  1RE4 B;  2IFN A;  1S9K D;  3HUS B;  1FJP A;  2Q7C A;  1AQ5 A;  1M1J C;  3BVH A;  3MUD A;  1AFO A;  1JTH A;  2YMY A;  3H6P A;  1GK4 A;  3VMY A;  3HE4 A;  3HD7 C;  1N86 B;  2HOD A;  1YYC A;  1N7S B;  2XZR A;  3E1I C;  5AW7 B;  2KB7 P;  3L37 A;  3V2P A;  1FBM A;  5AVU B;  4M7F A;  2JHM F;  2YNY A;  4GKG A;  2FFD B;  1T3J A;  4C7N A;  2C0W A;  2HLO A;  2WNP F;  2D39 A;  5APW A;  4LLH A;  2FXM A;  1FZF A;  1MV8 A;  1W2E A;  3M9B A;  1FZB B;  3N4X A;  4I2L C;  1FZA A;  4N78 D;  5AW1 B;  1SFC B;  3A3Y B;  1T8Z A;  4W7Z A;  1SFC D;  2NPS D;  1YTZ T;  5AVT B;  1KIL B;  5APT A;  3RK2 B;  3VMZ A;  4M7H A;  1ZR4 A;  3EQ2 A;  2JHK F;  1NAF A;  2P7J A;  4C7R A;  1GL2 B;  1JY3 P;  3CI9 A;  3TNU B;  1J2J B;  1KFN A;  1FZG B;  2GUS A;  3V4W A;  2M3B A;  1JC9 A;  1M1J A;  2XU6 A;  2WZ7 A;  2H8P D;  2YKO A;  2NPS C;  2R32 A;  1LTT C;  2E42 A;  2WWW A;  3B5N A;  3HD7 A;  3RL0 D;  3V4Q A;  3VTP C;  4AQR D;  1FZC C;  1LTJ C;  2C0X A;  5AVZ B;  2H43 A;  1L0L K;  1NOH A;  1JO5 A;  2J3F A;  2JEE A;  1JUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...