3HUSC

Crystal structure of recombinant gamma n308k fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
291
Chain Sequence
DSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHKGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impaired protofibril formation in fibrinogen gammaN308K is due to altered D:D and "A:a" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 75
structure length 291
sequence length 291
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3husC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3husC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3husC03
1RF0A 1FZAC 1T3UA 2JHMF 3HUSA 1LT9C 1LT9B 2OYHB 4M7HA 3BVHB 2Z4EA 1N86A 3HUSB 1LTJA 3H32B 2JHIF 2J64A 3E1IA 2Q9IA 1FZFB 1FZCA 2J3FD 1FZFC 3HUSC 1FIDA 2J3FA 1FZBA 3BVHC 2OYHC 2Z4EC 1RF1B 1JC9A 1FZGA 2HPCA 4R9JA 1LTJC 1FZAB 1JY3P 2J3OA 2J0GA 1RF0C 2HODB 1N86B 1JY3O 2A45G 2OYHA 1FICA 2HLOB 2A45H 1FZFA 2J61B 2FFDC 2J1GA 2J2PA 2H43B 1M1JC 3E1IC 2HLOA 2Q9IC 2OYIB 1N73B 1FZCB 2H43A 4M7FA 1FZBB 4JZCA 2HPCC 1FZGC 2XNXB 1RF1A 3GHGC 1FZEB 1RE4B 1W2EA 1RE3C 1FZDA 3BVHA 2HODA 3GHGB 1FZEA 1RE4A 2HPCB 1M1JA 1FZGB 1FZAA 2D39A 2FIBA 4JYOX 2J61A 1LWUB 1JY2P 4ZFGA 2OYIC 2H43C 3FIBA 2FFDA 1LWUC 2J3UA 4NYTA 4R9TA 2HLOC 1RE3A 2J0YA 2JHHC 2JHLF 2WNPF 1JY3N 2J60A 2OYIA 1LT9A 2HODC 1N86C 1RF0B 1RE3B 1RE4C 1Z3SA 1FZEC 1LTJB 3H32A 2J0HA 3GHGA 2XNXC 1RF1C 2Z4EB 2GY7A 1FIBA 1FZBC 1JY2O 1FZCC 1N73C 1LWUA 2J3GA 3E1IB 2Q9IB 1M1JB 2J5ZA 2FFDB 2JHKF 1N73A 4EPUA 2A45I 1Z3UA 1JY2N 3H32C 2XNXA
chains in the Genus database with same CATH superfamily
2E76C 3PRJA 1X9VA 3SFEC 3Q5PA 3CXHD 1FZFB 2BEZF 1XTCC 2E74D 2N1TD 4M3LA 5CCHA 3UIAA 5AW1B 2E76B 3H1JD 3H1JE 2QM8A 1IZNB 4IL6E 1EDIA 2IFMA 3TGUE 3TF5A 1NTZE 4QMAA 4W7YA 1S1CX 1VL2A 3FXDA 1NTZG 3LIEA 3PTZA 1M1KQ 3K5BA 3CX5H 2LXBA 4C7NA 2R3SA 1W2EA 3WUTA 2ZVNB 2WPSA 1BCCJ 3VTPC 4PJ0H 3ZDMA 3VMZA 2W27A 5H2FE 3B5ND 3RK3E 3AEEC 2XDJA 3H1JJ 3U1CA 3A0BH 2HODC 4GOFA 1RE3B 5AVWB 1SQVG 2KB7P 2WWWA 4PV1D 1Q86Q 3G3ZA 2B87B 1FZBC 3GMAA 2XV5A 1LT1A 2E75C 1URQB 2WMMA 3HD7B 1L0NG 2W6BA 3FXEA 1Y47A 4Z1MH 1Z3UA 1PL5A 3GF3A 4WY4A 5APQA 1QVFO 3A7OA 2RH0A 3BVHB 1FJPA 2J5UA 1KILC 1LTJA 3H32B 3B8EB 1VQPP 5EFWB 3FWNA 3L72J 1X0TA 4C46A 1FIDA 1VF5C 2QJYB 1JTHA 1JM0A 5DJTB 5APSA 3P8CE 3R2PA 2OYHA 3R4YA 3TYYA 1CI6B 1NH4A 1NGMB 2Q3IA 3AE9C 1SVFA 3KZIE 3M0DA 1YQ3C 3L37A 3RK3B 1NWQA 3RBZA 2QSIA 1EC5A 4YTPC 1VQLP 3L71G 2FYUK 3TDKA 3CCLP 1SFCA 3KPEA 3L71J 5CBOA 2KSJA 1KYOI 1N7SB 3KDPB 2Z5HA 3F89A 3D6YA 2IBZE 1MFZA 3OAKA 3H1KD 3CWBJ 5AW8B 2RMZA 1M57D 4H13B 2ZAEB 1FDMA 1FE6A 2JJLA 4B86A 2JDIH 5KLIC 1AVYA 2M0BA 1JY2N 1L2PA 4XE5B 4I7ZC 3AEAC 2P10A 2SPZA 2IX7C 2FKWB 3CXHI 5E79E 1OZHA 1N86A 1SQBG 3L74J 4N78E 3F5HA 2JHIF 2J64A 3WU2E 4OGQB 1GL2A 5KKZC 2J3FD 1EZVE 3W67A 3VP9A 1NU1J 1OX3A 1RHZB 4A7PA 3P7KA 1K05A 2QJKC 5B5EE 3VN0A 5CJ0A 2E5TA 2JO1A 1AJYA 1LTSC 3L73J 3EWKA 2A06D 5KLVG 2OYIB 1GL2B 2H43A 1IFPA 1EDKA 1RE4B 3M9QA 2KZIA 3U1AA 1FZEA 3CXHE 3H1KJ 1HWTC 3H1HG 2V7QJ 4IOIH 2LR2A 1QVGO 3Q5RA 5CCHD 2ZYDA 5AVTB 2FFDA 1OVVA 1ZLLA 2IZ1A 4C7RA 1URQD 1HJ0A 3OW2O 1JMBA 1BE3E 3H1LJ 1T2KD 3GLMA 1RF1C 3T97A 3CPWO 3H1HD 1YHQP 1RQUA 4JYCA 3CXHH 5BU5A 1NO4A 1G1IA 1GZLA 1M8OB 2AXTE 1KD1Q 3A2AA 5DJUB 3WMM0 4U3FE 3E1IA 3NXSA 2P1JA 5GTIH 2M8RA 1SQPE 3TK1A 1SQVJ 2OYHC 2QG4A 2KI7B 2A45G 2Z5IA 4GT1A 2FXOA 1KN7A 1Z56A 5KLVK 1M1JC 2WSCH 2WSFH 1K04A 3H25A 2M3BA 3TNUA 2PP6A 2GUSA 3H1HE 3RL0g 2ZXEB 1FZEB 3BVHA 3T97B 2E5YA 2D39A 1YQ4C 3L72G 1LWUB 2FBWC 4L74A 5AVYB 1KFNA 2E76D 1YTZT 1SQBK 1TU3F 2K9JB 2J0YA 1QGKB 1IFDA 2ZYGA 2L91A 2IZ0A 2K1AA 1S5LE 1L4AD 1KYOD 2QJPB 4ZKUA 1GL2C 2IYOA 3TGUD 1KQLA 3G71P 3E1IB 2HR3A 2J5ZA 3QH9A 2FFDB 3V2PA 1S5LX 3AEFC 1P84H 2J58A 1KC8Q 1JMMA 1L0NE 1FS0E 1SQQG 3HUSB 1NTKK 2FYUE 4W7ZA 2M3EA 1MKMA 3RK3D 1OFCX 2W6AA 1WMKA 4H44D 4OGQC 2K9JA 1QL1A 2P2UA 3TGUG 2E75B 3HUSC 2WT7B 3I5CA 1G1JA 1NYHA 2O3JA 1L0LK 4N78D 1YJNP 3SFDC 2J3OA 1IK9A 3M9BA 2QM7A 3HTKB 1VQKP 1N7SD 2J59M 2FFDC 3EFFK 5APYA 3E1IC 1L0NJ 3CX5I 3MIWA 3U59A 3FGAD 3H1KG 2AEMA 5KLVE 4IFFA 1ZXGA 3D70A 3NFQA 1ZRTE 2I8DA 5APXA 3CC2P 1SQXE 5KAIH 2OYIC 2W83C 1GTWA 2J3UA 3D71A 3NMDA 3L70D 3IR9A 1SFCB 3PLNA 3VMXA 1FU1A 1N2DC 5TISH 3E7KA 4LC1A 1KFMA 3B5NB 5CCGC 2XNXC 1FIBA 1P84I 2N9BA 1SQQD 3CWBG 2WSCJ 2WSFJ 3OJAB 5AW3B 1PPJE 5AW4B 4EPUA 3I55P 3CX5E 3PJSK 2YXRB 1LT9C 2OYHB 2O1KA 4R4MA 4NPEA 2Z4EA 2A06G 3M91A 1OWAA 2D2CD 5AW9B 4MN4C 2R44A 2AXCA 3VMAA 1OMIA 1N8RQ 2NPSA 1KILE 2R32A 5KAFE 3GF7A 1ZR2A 2Z4EC 3D6ZA 2NZ2A 1DH3A 1FZAB 2KUBA 4Y99B 2H89C 1FICA 1NTMK 1DD3A 2XKMA 2NPSC 2J2PA 3CCQP 2W8ZA 2Q9IC 2HLOA 3BCCE 2CPSA 1LP1B 1T8ZA 4OVNF 3HD7D 3CI9A 1JOCA 5AVZB 4C7NB 3AE4C 3L75E 1HTLC 1FAVA 3L74E 1BE3G 2H43C 1KYOH 4IFMA 5AVQB 3EFGA 1FDIA 1L0LE 2KXPB 1BDDA 3TSIA 1BGYD 1VQNP 3O8ZA 2RN0A 1QL2A 4HYTB 1ZRTD 3AEDC 4R4LA 2BEQD 1AVOA 4PD4H 1SQQJ 4GIFA 2E43A 1J2JB 3H32C 2XNXA 1NTZJ 2K9YA 5CCGA 1YBKA 1KORA 2YKPA 3V4WA 1M90Q 1KQGB 5AW0B 1A02J 5AVVB 2POHA 2BCCJ 1BGYG 2FYUJ 3KYQA 1NTKJ 1SQBE 1YIJP 1MFTA 1XTGB 3H6PA 1H89A 3ITKA 1J1EC 2E42A 4WB4A 3AECC 1AQ5A 3S4RA 2HPCA 3L74D 1JY3P 4I7ZB 1RF0C 3LIDA 3RBXA 4GOEA 5KTBA 1ZW0A 2J1GA 1CSBA 2YKQA 2ZT9B 1KB9H 3A0BE 1JCCA 4IL6H 4M7FA 1AQTA 2HPCC 2R5BA 3MZWB 4KJMA 3L74G 3CWBD 4GDOA 2HPCB 1KYOE 1M1JA 2FIBA 1L4AC 4OWFA 3TGUJ 1PGOA 1KB9D 2JHHC 1PP9G 3L71D 2M5AB 1G2CA 1JTHB 3EQ2A 1ZR4A 1RF0B 5GTHE 4H44B 1NKZB 5KJ7A 3N7NA 2FYUD 2Q1KA 3S9OA 2O01H 1VQ5P 1LTAC 2B89A 1NU1K 4H0LC 5KAIE 1NTZD 1EDJA 4I2LC 3GG2A 1M7LA 1K73Q 2YIUC 3H1HJ 4BRYB 1GL2D 2OQQA 1SQXK 3AEBC 4I1LA 1HGVA 1HF9A 4HJGH 4IFDK 1GU4A 3G4SP 1VQ8P 3NTNA 1BGYJ 1U7MA 2KOGA 2L5GB 3BVHC 4ZMDA 2N1TA 4U3FD 1E79H 1KB9E 2KIKA 1S5LH 2Q6QA 2H43B 2WPQA 1N73B 5M1BA 5CMZA 3L72E 4WY4B 1RF1A 2C9LY 1PIXA 1VQ4P 1NAFA 4PD4I 3H1ID 4BRYA 1NTMD 2PRRA 3BASA 1URQA 1JB0J 3L70J 3A3YB 2NPSB 4O9BA 1EXJA 1LTIC 2D2CB 3KXDA 1LT9A 1VQ6P 1FBMA 5CCHC 4D6TE 2Z4EB 1Q90D 2CPBA 4DOJA 4DT0A 2ITAA 2J3GA 1ZMEC 5GTHH 1YI2P 3BATA 3JCUH 1NTMJ 3N4XA 1L0ND 4D6TG 1J1DC 1CZQA 2G3AA 4LGDE 2KP8A 1RF0A 2YIUB 4ASWA 1UIXA 2JR8A 1S2EA 4PD4D 2I1JA 2E75D 1SFCD 1NTKG 1T2KC 1GMJA 1K8AQ 2JKVA 4YPCA 4EYYQ 1DEEG 3IAOA 4OGQD 1G2CB 3B5NC 3WU2H 1EQ7A 1A02F 1ZV8A 1FDOA 1LTGC 1NTKD 2HLOB 3JC22 2J61B 2BCCD 3S1KA 2GA1A 1JEKA 1FZCB 3B4SA 3B71A 4YXDC 4JZCA 2LKMA 3MGNA 2HG5D 3Q1MA 3H1KE 1KTMA 2FYZA 2K37A 4N3YB 3RK2B 4ZFGA 1BCCG 3AE7C 2Y9ZA 3H1LD 3CCUP 2Q5UA 1EZVD 2XNDH 2YMYA 3SWYA 1LJ2A 2B88A 5H2FH 2KLUA 1L0LG 2Q9IB 3Q3DA 2IBZG 2MKVA 1SS1A 1L0LJ 1LTBC 1NOHA 4UB6E 1FZAC 4UB8H 4ZNCA 3HUSA 3BRVB 2W90A 3QWOC 2YO3A 3KHUA 2IBZD 4PD4E 1AFOA 1SQQE 3V2NA 1LGHB 2XZRA 3W68A 4AYCA 1NU1D 1BGYE 3V6IA 1AV1A 2J0GA 3BCCG 5TJHA 3CC4P 4DCKA 3AE1C 1FZFA 2R3CA 1IFMA 1GDTA 2V4HA 3O6QA 3WUVA 1NU1E 1Q82Q 2AXTH 2V7QH 1YJ9P 4JBZA 4HH2A 1BSNA 5KLVD 4Y28J 5APWA 3B5NA 1SQPJ 1S72P 1LNQA 3MHVA 2J61A 3VYIA 3A5TA 2KNCA 4PV1C 3H1IE 4EI2A 2P67A 1NVOA 4Y99C 3H1IG 1PZQA 1SQVD 3PH0A 4L73A 1T3JA 1IFIA 3II6A 3CD6P 1KILD 1CI6A 3Q5SA 1IFNA 3CCMP 2JP3A 5AW7B 1SQVK 1IO4A 2OYOA 1HGZA 2O1JA 4I6MC 1BSHA 1R5LA 2FYNB 3CCRP 4U3FG 1T3UA 2JHMF 1LT9B 3CCSP 4M7HA 1AA0A 1J1EB 2WQYC 3HRNA 2O01J 1SQPG 3BCCD 3AEGC 2C0WA 3CC7P 3FWLA 1NTZK 1FZBA 3JSVC 2E74C 1RF1B 1JC9A 3GW6A 1BCCD 1LTJC 2ZT9D 1VPCA 2FXPA 1OVRA 2Y9YA 2ZVOB 1JUNA 3L73G 1HJBA 3RGUA 2QJPC 3L71E 1BCCE 2AEJA 1ZOYC 1PPJD 3HTKA 2HFED 2RKLA 4WVZA 1FJKA 4R9TA 1Y8AA 1W2BO 2DW3A 1RQVA 1P84D 2OYIA 3V5BA 2YKOA 2YNYA 1FZEC 1LTJB 3H32A 2J0HA 2N9YB 4TLFA 1BDCA 2E74B 1PGPA 1PPJG 1LWUA 5B66H 5L8RJ 3M0AA 3HE4A 4DJGA 1M1JB 1OXZA 3G6EP 1EDLA 2LXCB 2JHKF 3RL0C 3USSA 1PFIA 1DD4A 1PV3A 2ZFCA 4KT0J 3KZIH 2IYPA 2Q7CA 1KZUB 1P84E 2OGUA 1NTME 1X22A 3MUDA 5C39A 1MV8A 1DIPA 2GUVA 2OTJP 3SWKA 3M06A 1QEXA 1VF5D 3L72D 3V2RA 2PGDA 4GODA 3E1RA 1OW7A 1VQ9P 3RK2D 3M0DC 2BASA 1W5CE 1K9MQ 1KMIZ 1N86B 1YJWP 2KZJA 4RESB 5KAFH 4L76A 4PV1B 3KQGA 4JPZB 2AEFA 2YMKA 1YTZI 4L75A 2XU6A 1KQFB 2CK3H 1VQMP 2XNXB 3FX0A 1HUCA 1SFCC 4JYOX 1JY2P 2OARA 1GW3A 4NYTA 3C8VA 3AE2C 1R8EA 2C0XA 1N86C 1Q81Q 4UB8E 3L35A 3C9IA 3M9HA 3P8MC 4K3AA 2QEXP 3AE3C 1N73A 2H8PD 2FY8A 1ZP0C 2QJKB 2N1TB 3HE4B 4WY4D 3RL0B 4AUWA 1FZCA 1OIPA 3HD7C 2WITA 1KQSO 2N1TC 1D7MA 4H0LD 2P7JA 1KILA 2VRSA 2HODB 3L73E 1JY3O 4ZKPA 1SQPD 3ABVC 1U57A 5KLIB 1S9KE 2KSEA 2QIWA 3CMEP 3MUDC 1IC2A 2B9BA 3L75G 3HE5B 4JQ0D 1H0TA 3P32A 5CBNA 3C1LA 1YITP 1PP9E 1HVVA 2IBZI 1NHLA 3O6QB 4NPDA 1LWUC 2JWDA 1QLED 5GTIE 1FOSE 1RH5B 2ZYAA 1BE3D 2Q3EA 3CL3D 4TT3H 2G8YA 1IFJA 1FOSF 1GW4A 5CJ4A 2WZ7A 1Q7YQ 1USDA 3A0HH 2ZXXA 2NRGA 5AVUB 1L0LD 2WVRA 2KLVA 3VOPA 2ZJSE 1H88A 3OA7A 4XFJA 5KJ7C 4N6JA 2PFXA 1EZVI 2BCCG 3SWFA 2QJYC 1RY3A 1VF5B 3AE5C 4U3FJ 2FYNC 3L70G 1BE3J 3L73D 4DZOA 3H1LE 2A06E 4XA4A 1IK7A 1Q2NA 1KILB 2J3FA 3H1LG 1N7SA 4IL6X 3IF4A 1FZGA 2FXMA 1EZVG 1WRGA 1NU1G 1N7SC 3SSUA 1QX8A 2KYVA 4RJTA 1L4AA 1JCDA 4LLHA 4WWIA 3CCVP 4D6TJ 2KS1A 1OW6A 4HKZH 5AW5B 2JEEA 1CW5A 4PJ0E 2HODA 3RK3C 5BVZA 3JCUE 1KB9I 1H8AA 2C9NY 1GD2E 1S3JA 3FIBA 1SP4A 1RE3A 1U7JA 1SLQA 3CX5D 1SQXG 2Y0CA 3BRTB 1L0NK 5AVRB 1IJDB 2WPVB 1RE4C 1PGJA 2NPSD 2GY7A 5B5EH 2WTYA 3IFMA 1FZCC 3LW5J 5TISE 1OW8A 2OTKE 3VMYA 1GU5A 5KJ7D 2WSSH 1LP1A 3VP8A 3MP7B 1SQBD 1NTMG 3L70E 4H13D 3RL0D 1WT6A 1USEA 3MD0A 4RO0A 1VQ7P 1SQXD 1S9KD 1SQPK 4EDFA 4KHXA 4YXWH 2Q9IA 1OVUA 4H0LB 1KV4A 5KKZB 3PHLA 3H1JG 1FZFC 2QVAA 3BCCJ 5AVSB 1SQXJ 1NJIQ 4R9JA 2O01N 1PP9D 4U7JA 1HH0A 3CCEP 2K88A 1Y9BA 2A45H 2KK7A 3L75J 3HD7A 5B66E 4JF7A 2KS1B 1X79B 4H13C 4HB1A 1X8YA 3AE6C 1L4AB 1MUUA 2H88C 4K35A 3GHGC 5E79H 4W80A 1FZDA 1HBWA 3GHGB 1PGQA 5AVXB 5APUA 2D2CC 3L75D 5APTA 3V4QA 5APVA 2QE7H 2ZT9C 2IPPA 4BXLA 1PP9J 1S4XA 3PP5A 4EIJA 2HLOC 1JY3N 2J60A 4AQRD 1YYCA 2IFNA 1LTTC 2W6JH 4WY4C 4OH8B 1H0TB 2UWJE 1N73C 5CCGD 5KLVJ 2KNCB 2JWAA 2H7HA 2BCCE 5K5GB 3TNUB 2GM4A 5CHXA 1NTKE 1SQBJ 3HE5A 2YO2A 3L4FA 1MZ9A 1GK6A 2WPRA 4JYBA 1JO5A 2HYNA 1VDFA 1J1DB 2WT7A 3L36A 1E5WA 2WSEH 3A0HE 1ZN5A 2FYUG 2I1KA 1DX7A 1SQQK 3H1IJ 2B87A 1JNMA 5BU8B 3LW5H 4BWNA 1URQC 2P58A 2OTLP 3CLQA 3MTUE 4ASVA 3I56P 1FZBB 1FZGC 4H44C 1UIIA 4D6TD 4CPGA 1RE3C 1NKNA 3WUUA 2K3RA 1EXIA 1FC2C 1RE4A 1FZGB 2PAJA 1FZAA 1NAYA 1DEBA 4WBAA 3RK2C 1SQVE 3G9RA 2IDBA 3AE8C 2WSEJ 1M56D 2JHLF 2YXQB 5AW2B 2QRXA 3CMAP 1VQOP 2WNPF 3CCJP 4GKGA 4EOTA 1GK4A 2R5DA 1Z3SA 3CWBE 3V2QA 3GHGA 4RKUJ 1N7LA 1JY2O 5AW6B 2QA4P 3P8CD 3IN6A 2MJZA 4NPFX 1R5SA 2Y0EA 4UB6H 1T6AA 2A45I 2Y0DA 2M5AA 3Q2YA
chains in the Genus database with same CATH topology
1RF0A 1X9VA 2N1TB 2I1JA 3HUSB 1SFCD 1NTKK 4W7ZA 3HE4B 4WY4D 3RL0B 1T2KC 4AUWA 1FZFB 1FZCA 3RK3D 2W6AA 3HD7C 1XTCC 1QL1A 2N1TD 2P2UA 2WITA 4M3LA 3HUSC 5CCHA 2WT7B 3UIAA 3I5CA 2N1TC 1G1JA 5AW1B 1G2CB 1L0LK 2P7JA 4N78D 3B5NC 1EQ7A 1KILA 2QM8A 1A02F 1ZV8A 2J3OA 2VRSA 1IK9A 2HODB 3M9BA 2IFMA 1JY3O 4ZKPA 1LTGC 2QM7A 3HTKB 1S9KE 4W7YA 2HLOB 1N7SD 2J59M 2J61B 2FFDC 5APYA 3E1IC 1IC2A 1FZCB 3MIWA 3LIEA 4JZCA 3U59A 2LKMA 3HE5B 4C7NA 1W2EA 3MGNA 4IFFA 3P32A 2HG5D 3NFQA 2WPSA 5APXA 3VTPC 1HVVA 3VMZA 2FYZA 2W27A 4N3YB 3RK2B 4ZFGA 2OYIC 1NHLA 1GTWA 3B5ND 2J3UA 1LWUC 2XDJA 3NMDA 3IR9A 1SFCB 3U1CA 2Q5UA 1FOSE 2HODC 3VMXA 1RE3B 2YMYA 1FU1A 1N2DC 5AVWB 2KB7P 4LC1A 1KFMA 2WWWA 3B5NB 3CL3D 5CCGC 3G3ZA 3SWYA 2XNXC 1FIBA 1FZBC 1IFJA 1FOSF 2XV5A 1GW4A 5CJ4A 2N9BA 2WZ7A 1URQB 2Q9IB 3HD7B 2W6BA 3OJAB 5AVUB 5AW3B 5AW4B 2KLVA 1LTBC 3VOPA 4EPUA 1NOHA 1Z3UA 1H88A 3OA7A 5KJ7C 4WY4A 1FZAC 4N6JA 5APQA 3HUSA 1LT9C 3BRVB 3A7OA 2OYHB 2O1KA 3BVHB 3SWFA 2Z4EA 1RY3A 1FJPA 3M91A 1KILC 1OWAA 1LTJA 3H32B 5AW9B 3B8EB 2YO3A 4DZOA 1AFOA 3V2NA 4XA4A 2NPSA 1LGHB 2XZRA 2R32A 4C46A 1KILB 1FIDA 2J3FA 4AYCA 1JTHA 1ZR2A 1N7SA 2Z4EC 1FZGA 1DH3A 1FZAB 2FXMA 1WRGA 2J0GA 4Y99B 5APSA 3P8CE 1N7SC 3R2PA 2OYHA 3TYYA 1FICA 2KYVA 1NTMK 1CI6B 1FZFA 2XKMA 1NH4A 2NPSC 2J2PA 2R3CA 1L4AA 1IFMA 2Q3IA 2Q9IC 2HLOA 1GDTA 1JCDA 2CPSA 4LLHA 1SVFA 1T8ZA 3M0DA 3L37A 5AW5B 3HD7D 4HH2A 3RK3B 1NWQA 5APWA 3CI9A 2JEEA 1CW5A 5BVZA 2HODA 1JOCA 3RK3C 3B5NA 5AVZB 4C7NB 1H8AA 1HTLC 1FAVA 2J61A 2FYUK 3VYIA 3A5TA 2C9NY 1GD2E 1SFCA 3KPEA 2H43C 3FIBA 4IFMA 1SP4A 2P67A 2KSJA 1RE3A 1SLQA 5AVQB 1N7SB 3EFGA 3KDPB 3BRTB 1L0NK 4Y99C 5AVRB 1IJDB 3TSIA 1RE4C 2Z5HA 1MFZA 3O8ZA 3OAKA 2NPSD 1T3JA 1IFIA 3II6A 2GY7A 1QL2A 4HYTB 2WTYA 3IFMA 1KILD 5AW8B 1FZCC 1CI6A 1IFNA 3VMYA 1FDMA 5AW7B 1GU5A 1SQVK 2JJLA 1IO4A 5KJ7D 1HGZA 2O1JA 4I6MC 4B86A 4GIFA 3VP8A 2E43A 1J2JB 1JY2N 2XNXA 4XE5B 5CCGA 3H32C 3RL0D 1T3UA 1WT6A 2JHMF 3MD0A 2IX7C 1LT9B 2FKWB 4M7HA 2YKPA 3V4WA 1N86A 4N78E 1J1EB 5AW0B 1S9KD 3HRNA 1A02J 1SQPK 5AVVB 2JHIF 2J64A 4KHXA 2POHA 2Q9IA 1GL2A 2C0WA 2J3FD 1FZFC 3KYQA 1XTGB 3H6PA 1NTZK 1H89A 1J1EC 3VP9A 4WB4A 2E42A 1FZBA 5AVSB 1AQ5A 1RF1B 1JC9A 3P7KA 2HPCA 4R9JA 1LTJC 1JY3P 3VN0A 5CJ0A 1RF0C 3LIDA 1VPCA 1LTSC 1HH0A 5KTBA 2A45H 2J1GA 1CSBA 3HD7A 1JUNA 4JF7A 2YKQA 1X79B 2OYIB 1X8YA 1HJBA 1JCCA 1GL2B 2H43A 1L4AB 1MUUA 4M7FA 2HPCC 2R5BA 3GHGC 1RE4B 4W80A 3M9QA 1FZDA 1HBWA 3GHGB 5AVXB 3U1AA 5APUA 1FZEA 2HPCB 1M1JA 5APTA 1HWTC 2FIBA 3V4QA 1L4AC 5APVA 2IPPA 3HTKA 5CCHD 2HFED 5AVTB 2FFDA 3PP5A 1FJKA 1ZLLA 4R9TA 4EIJA 2HLOC 2JHHC 1JY3N 4C7RA 4AQRD 2OYIA 2J60A 1G2CA 3V5BA 1YYCA 1URQD 1JTHB 2IFNA 1LTTC 3EQ2A 2YKOA 1ZR4A 1RF0B 2YNYA 1FZEC 1LTJB 3H32A 2J0HA 4WY4C 1T2KD 4OH8B 1NKZB 1RF1C 3T97A 5KJ7A 3N7NA 2O01H 1N73C 1LWUA 5CCGD 4JYCA 3M0AA 3HE4A 1M1JB 1OXZA 1LTAC 5BU5A 2H7HA 2JHKF 1NU1K 1NO4A 3RL0C 3TNUB 2GM4A 5CHXA 1PFIA 1G1IA 1GZLA 4I2LC 2ZFCA 3HE5A 1M7LA 2YO2A 3L4FA 1MZ9A 1GK6A 2WPRA 4JYBA 2Q7CA 1GL2D 3A2AA 1KZUB 3WMM0 1SQXK 3E1IA 3MUDA 1JO5A 2HYNA 3NXSA 1VDFA 1J1DB 1MV8A 4I1LA 1HGVA 4IFDK 2GUVA 1GU4A 2P1JA 2WT7A 3L36A 1E5WA 3M06A 2WSEH 1ZN5A 2M8RA 2KOGA 3NTNA 3V2RA 2I1KA 2L5GB 3TK1A 1DX7A 3BVHC 2OYHC 3RK2D 3M0DC 2BASA 1SQQK 1N86B 2N1TA 2A45G 2Z5IA 4GT1A 1JNMA 5BU8B 3LW5H 4RESB 1Z56A 5KLVK 2H43B 1M1JC 2WSCH 2WSFH 1URQC 2WPQA 3CLQA 3KQGA 2M3BA 3MTUE 3TNUA 1N73B 2PP6A 1YTZI 2GUSA 2XU6A 1FZBB 5CMZA 1FZGC 2XNXB 4WY4B 1RF1A 2C9LY 2ZXEB 1FZEB 1NAFA 1RE3C 1NKNA 3BVHA 1HUCA 1RE4A 1SFCC 1FZGB 2PAJA 1FZAA 2D39A 4JYOX 1LWUB 3BASA 5AVYB 1JY2P 1URQA 1KFNA 1DEBA 2OARA 4WBAA 3A3YB 3RK2C 1GW3A 1YTZT 2NPSB 4NYTA 1SQBK 4O9BA 2J0YA 1LTIC 2JHLF 5AW2B 2WNPF 1LT9A 2C0XA 1IFDA 4GKGA 4EOTA 1GK4A 1N86C 2R5DA 1Z3SA 1FBMA 3V2QA 3L35A 3C9IA 3GHGA 3M9HA 5CCHC 3P8MC 2Z4EB 4DOJA 2CPBA 1L4AD 1JY2O 1N7LA 5AW6B 4ZKUA 1GL2C 1KQLA 2J3GA 3P8CD 3E1IB 2J5ZA 3BATA 2MJZA 3N4XA 2FFDB 1J1DC 1N73A 1CZQA 3V2PA 2A45I 4LGDE 2KP8A 2H8PD 2J58A 1JMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 A;  1FZA C;  1T3U A;  2JHM F;  3HUS A;  1LT9 C;  1LT9 B;  2OYH B;  4M7H A;  3BVH B;  2Z4E A;  1N86 A;  3HUS B;  1LTJ A;  3H32 B;  2JHI F;  2J64 A;  3E1I A;  2Q9I A;  1FZF B;  1FZC A;  2J3F D;  1FZF C;  3HUS C;  1FID A;  2J3F A;  1FZB A;  3BVH C;  2OYH C;  2Z4E C;  1RF1 B;  1JC9 A;  1FZG A;  2HPC A;  4R9J A;  1LTJ C;  1FZA B;  1JY3 P;  2J3O A;  2J0G A;  1RF0 C;  2HOD B;  1N86 B;  1JY3 O;  2A45 G;  2OYH A;  1FIC A;  2HLO B;  2A45 H;  1FZF A;  2J61 B;  2FFD C;  2J1G A;  2J2P A;  2H43 B;  1M1J C;  3E1I C;  2HLO A;  2Q9I C;  2OYI B;  1N73 B;  1FZC B;  2H43 A;  4M7F A;  1FZB B;  4JZC A;  2HPC C;  1FZG C;  2XNX B;  1RF1 A;  3GHG C;  1FZE B;  1RE4 B;  1W2E A;  1RE3 C;  1FZD A;  3BVH A;  2HOD A;  3GHG B;  1FZE A;  1RE4 A;  2HPC B;  1M1J A;  1FZG B;  1FZA A;  2D39 A;  2FIB A;  4JYO X;  2J61 A;  1LWU B;  1JY2 P;  4ZFG A;  2OYI C;  2H43 C;  3FIB A;  2FFD A;  1LWU C;  2J3U A;  4NYT A;  4R9T A;  2HLO C;  1RE3 A;  2J0Y A;  2JHH C;  2JHL F;  2WNP F;  1JY3 N;  2J60 A;  2OYI A;  1LT9 A;  2HOD C;  1N86 C;  1RF0 B;  1RE3 B;  1RE4 C;  1Z3S A;  1FZE C;  1LTJ B;  3H32 A;  2J0H A;  3GHG A;  2XNX C;  1RF1 C;  2Z4E B;  2GY7 A;  1FIB A;  1FZB C;  1JY2 O;  1FZC C;  1N73 C;  1LWU A;  2J3G A;  3E1I B;  2Q9I B;  1M1J B;  2J5Z A;  2FFD B;  2JHK F;  1N73 A;  4EPU A;  2A45 I;  1Z3U A;  1JY2 N;  3H32 C;  2XNX A; 
#chains in the Genus database with same CATH topology
 2E76 C;  3PRJ A;  1X9V A;  3SFE C;  3Q5P A;  3CXH D;  1FZF B;  2BEZ F;  1XTC C;  2E74 D;  2N1T D;  4M3L A;  5CCH A;  3UIA A;  5AW1 B;  2E76 B;  3H1J D;  3H1J E;  2QM8 A;  1IZN B;  4IL6 E;  1EDI A;  2IFM A;  3TGU E;  3TF5 A;  1NTZ E;  4QMA A;  4W7Y A;  1S1C X;  1VL2 A;  3FXD A;  1NTZ G;  3LIE A;  3PTZ A;  1M1K Q;  3K5B A;  3CX5 H;  2LXB A;  4C7N A;  2R3S A;  1W2E A;  3WUT A;  2ZVN B;  2WPS A;  1BCC J;  3VTP C;  4PJ0 H;  3ZDM A;  3VMZ A;  2W27 A;  5H2F E;  3B5N D;  3RK3 E;  3AEE C;  2XDJ A;  3H1J J;  3U1C A;  3A0B H;  2HOD C;  4GOF A;  1RE3 B;  5AVW B;  1SQV G;  2KB7 P;  2WWW A;  4PV1 D;  1Q86 Q;  3G3Z A;  2B87 B;  1FZB C;  3GMA A;  2XV5 A;  1LT1 A;  2E75 C;  1URQ B;  2WMM A;  3HD7 B;  1L0N G;  2W6B A;  3FXE A;  1Y47 A;  4Z1M H;  1Z3U A;  1PL5 A;  3GF3 A;  4WY4 A;  5APQ A;  1QVF O;  3A7O A;  2RH0 A;  3BVH B;  1FJP A;  2J5U A;  1KIL C;  1LTJ A;  3H32 B;  3B8E B;  1VQP P;  5EFW B;  3FWN A;  3L72 J;  1X0T A;  4C46 A;  1FID A;  1VF5 C;  2QJY B;  1JTH A;  1JM0 A;  5DJT B;  5APS A;  3P8C E;  3R2P A;  2OYH A;  3R4Y A;  3TYY A;  1CI6 B;  1NH4 A;  1NGM B;  2Q3I A;  3AE9 C;  1SVF A;  3KZI E;  3M0D A;  1YQ3 C;  3L37 A;  3RK3 B;  1NWQ A;  3RBZ A;  2QSI A;  1EC5 A;  4YTP C;  1VQL P;  3L71 G;  2FYU K;  3TDK A;  3CCL P;  1SFC A;  3KPE A;  3L71 J;  5CBO A;  2KSJ A;  1KYO I;  1N7S B;  3KDP B;  2Z5H A;  3F89 A;  3D6Y A;  2IBZ E;  1MFZ A;  3OAK A;  3H1K D;  3CWB J;  5AW8 B;  2RMZ A;  1M57 D;  4H13 B;  2ZAE B;  1FDM A;  1FE6 A;  2JJL A;  4B86 A;  2JDI H;  5KLI C;  1AVY A;  2M0B A;  1JY2 N;  1L2P A;  4XE5 B;  4I7Z C;  3AEA C;  2P10 A;  2SPZ A;  2IX7 C;  2FKW B;  3CXH I;  5E79 E;  1OZH A;  1N86 A;  1SQB G;  3L74 J;  4N78 E;  3F5H A;  2JHI F;  2J64 A;  3WU2 E;  4OGQ B;  1GL2 A;  5KKZ C;  2J3F D;  1EZV E;  3W67 A;  3VP9 A;  1NU1 J;  1OX3 A;  1RHZ B;  4A7P A;  3P7K A;  1K05 A;  2QJK C;  5B5E E;  3VN0 A;  5CJ0 A;  2E5T A;  2JO1 A;  1AJY A;  1LTS C;  3L73 J;  3EWK A;  2A06 D;  5KLV G;  2OYI B;  1GL2 B;  2H43 A;  1IFP A;  1EDK A;  1RE4 B;  3M9Q A;  2KZI A;  3U1A A;  1FZE A;  3CXH E;  3H1K J;  1HWT C;  3H1H G;  2V7Q J;  4IOI H;  2LR2 A;  1QVG O;  3Q5R A;  5CCH D;  2ZYD A;  5AVT B;  2FFD A;  1OVV A;  1ZLL A;  2IZ1 A;  4C7R A;  1URQ D;  1HJ0 A;  3OW2 O;  1JMB A;  1BE3 E;  3H1L J;  1T2K D;  3GLM A;  1RF1 C;  3T97 A;  3CPW O;  3H1H D;  1YHQ P;  1RQU A;  4JYC A;  3CXH H;  5BU5 A;  1NO4 A;  1G1I A;  1GZL A;  1M8O B;  2AXT E;  1KD1 Q;  3A2A A;  5DJU B;  3WMM 0;  4U3F E;  3E1I A;  3NXS A;  2P1J A;  5GTI H;  2M8R A;  1SQP E;  3TK1 A;  1SQV J;  2OYH C;  2QG4 A;  2KI7 B;  2A45 G;  2Z5I A;  4GT1 A;  2FXO A;  1KN7 A;  1Z56 A;  5KLV K;  1M1J C;  2WSC H;  2WSF H;  1K04 A;  3H25 A;  2M3B A;  3TNU A;  2PP6 A;  2GUS A;  3H1H E;  3RL0 g;  2ZXE B;  1FZE B;  3BVH A;  3T97 B;  2E5Y A;  2D39 A;  1YQ4 C;  3L72 G;  1LWU B;  2FBW C;  4L74 A;  5AVY B;  1KFN A;  2E76 D;  1YTZ T;  1SQB K;  1TU3 F;  2K9J B;  2J0Y A;  1QGK B;  1IFD A;  2ZYG A;  2L91 A;  2IZ0 A;  2K1A A;  1S5L E;  1L4A D;  1KYO D;  2QJP B;  4ZKU A;  1GL2 C;  2IYO A;  3TGU D;  1KQL A;  3G71 P;  3E1I B;  2HR3 A;  2J5Z A;  3QH9 A;  2FFD B;  3V2P A;  1S5L X;  3AEF C;  1P84 H;  2J58 A;  1KC8 Q;  1JMM A;  1L0N E;  1FS0 E;  1SQQ G;  3HUS B;  1NTK K;  2FYU E;  4W7Z A;  2M3E A;  1MKM A;  3RK3 D;  1OFC X;  2W6A A;  1WMK A;  4H44 D;  4OGQ C;  2K9J A;  1QL1 A;  2P2U A;  3TGU G;  2E75 B;  3HUS C;  2WT7 B;  3I5C A;  1G1J A;  1NYH A;  2O3J A;  1L0L K;  4N78 D;  1YJN P;  3SFD C;  2J3O A;  1IK9 A;  3M9B A;  2QM7 A;  3HTK B;  1VQK P;  1N7S D;  2J59 M;  2FFD C;  3EFF K;  5APY A;  3E1I C;  1L0N J;  3CX5 I;  3MIW A;  3U59 A;  3FGA D;  3H1K G;  2AEM A;  5KLV E;  4IFF A;  1ZXG A;  3D70 A;  3NFQ A;  1ZRT E;  2I8D A;  5APX A;  3CC2 P;  1SQX E;  5KAI H;  2OYI C;  2W83 C;  1GTW A;  2J3U A;  3D71 A;  3NMD A;  3L70 D;  3IR9 A;  1SFC B;  3PLN A;  3VMX A;  1FU1 A;  1N2D C;  5TIS H;  3E7K A;  4LC1 A;  1KFM A;  3B5N B;  5CCG C;  2XNX C;  1FIB A;  1P84 I;  2N9B A;  1SQQ D;  3CWB G;  2WSC J;  2WSF J;  3OJA B;  5AW3 B;  1PPJ E;  5AW4 B;  4EPU A;  3I55 P;  3CX5 E;  3PJS K;  2YXR B;  1LT9 C;  2OYH B;  2O1K A;  4R4M A;  4NPE A;  2Z4E A;  2A06 G;  3M91 A;  1OWA A;  2D2C D;  5AW9 B;  4MN4 C;  2R44 A;  2AXC A;  3VMA A;  1OMI A;  1N8R Q;  2NPS A;  1KIL E;  2R32 A;  5KAF E;  3GF7 A;  1ZR2 A;  2Z4E C;  3D6Z A;  2NZ2 A;  1DH3 A;  1FZA B;  2KUB A;  4Y99 B;  2H89 C;  1FIC A;  1NTM K;  1DD3 A;  2XKM A;  2NPS C;  2J2P A;  3CCQ P;  2W8Z A;  2Q9I C;  2HLO A;  3BCC E;  2CPS A;  1LP1 B;  1T8Z A;  4OVN F;  3HD7 D;  3CI9 A;  1JOC A;  5AVZ B;  4C7N B;  3AE4 C;  3L75 E;  1HTL C;  1FAV A;  3L74 E;  1BE3 G;  2H43 C;  1KYO H;  4IFM A;  5AVQ B;  3EFG A;  1FDI A;  1L0L E;  2KXP B;  1BDD A;  3TSI A;  1BGY D;  1VQN P;  3O8Z A;  2RN0 A;  1QL2 A;  4HYT B;  1ZRT D;  3AED C;  4R4L A;  2BEQ D;  1AVO A;  4PD4 H;  1SQQ J;  4GIF A;  2E43 A;  1J2J B;  3H32 C;  2XNX A;  1NTZ J;  2K9Y A;  5CCG A;  1YBK A;  1KOR A;  2YKP A;  3V4W A;  1M90 Q;  1KQG B;  5AW0 B;  1A02 J;  5AVV B;  2POH A;  2BCC J;  1BGY G;  2FYU J;  3KYQ A;  1NTK J;  1SQB E;  1YIJ P;  1MFT A;  1XTG B;  3H6P A;  1H89 A;  3ITK A;  1J1E C;  2E42 A;  4WB4 A;  3AEC C;  1AQ5 A;  3S4R A;  2HPC A;  3L74 D;  1JY3 P;  4I7Z B;  1RF0 C;  3LID A;  3RBX A;  4GOE A;  5KTB A;  1ZW0 A;  2J1G A;  1CSB A;  2YKQ A;  2ZT9 B;  1KB9 H;  3A0B E;  1JCC A;  4IL6 H;  4M7F A;  1AQT A;  2HPC C;  2R5B A;  3MZW B;  4KJM A;  3L74 G;  3CWB D;  4GDO A;  2HPC B;  1KYO E;  1M1J A;  2FIB A;  1L4A C;  4OWF A;  3TGU J;  1PGO A;  1KB9 D;  2JHH C;  1PP9 G;  3L71 D;  2M5A B;  1G2C A;  1JTH B;  3EQ2 A;  1ZR4 A;  1RF0 B;  5GTH E;  4H44 B;  1NKZ B;  5KJ7 A;  3N7N A;  2FYU D;  2Q1K A;  3S9O A;  2O01 H;  1VQ5 P;  1LTA C;  2B89 A;  1NU1 K;  4H0L C;  5KAI E;  1NTZ D;  1EDJ A;  4I2L C;  3GG2 A;  1M7L A;  1K73 Q;  2YIU C;  3H1H J;  4BRY B;  1GL2 D;  2OQQ A;  1SQX K;  3AEB C;  4I1L A;  1HGV A;  1HF9 A;  4HJG H;  4IFD K;  1GU4 A;  3G4S P;  1VQ8 P;  3NTN A;  1BGY J;  1U7M A;  2KOG A;  2L5G B;  3BVH C;  4ZMD A;  2N1T A;  4U3F D;  1E79 H;  1KB9 E;  2KIK A;  1S5L H;  2Q6Q A;  2H43 B;  2WPQ A;  1N73 B;  5M1B A;  5CMZ A;  3L72 E;  4WY4 B;  1RF1 A;  2C9L Y;  1PIX A;  1VQ4 P;  1NAF A;  4PD4 I;  3H1I D;  4BRY A;  1NTM D;  2PRR A;  3BAS A;  1URQ A;  1JB0 J;  3L70 J;  3A3Y B;  2NPS B;  4O9B A;  1EXJ A;  1LTI C;  2D2C B;  3KXD A;  1LT9 A;  1VQ6 P;  1FBM A;  5CCH C;  4D6T E;  2Z4E B;  1Q90 D;  2CPB A;  4DOJ A;  4DT0 A;  2ITA A;  2J3G A;  1ZME C;  5GTH H;  1YI2 P;  3BAT A;  3JCU H;  1NTM J;  3N4X A;  1L0N D;  4D6T G;  1J1D C;  1CZQ A;  2G3A A;  4LGD E;  2KP8 A;  1RF0 A;  2YIU B;  4ASW A;  1UIX A;  2JR8 A;  1S2E A;  4PD4 D;  2I1J A;  2E75 D;  1SFC D;  1NTK G;  1T2K C;  1GMJ A;  1K8A Q;  2JKV A;  4YPC A;  4EYY Q;  1DEE G;  3IAO A;  4OGQ D;  1G2C B;  3B5N C;  3WU2 H;  1EQ7 A;  1A02 F;  1ZV8 A;  1FDO A;  1LTG C;  1NTK D;  2HLO B;  3JC2 2;  2J61 B;  2BCC D;  3S1K A;  2GA1 A;  1JEK A;  1FZC B;  3B4S A;  3B71 A;  4YXD C;  4JZC A;  2LKM A;  3MGN A;  2HG5 D;  3Q1M A;  3H1K E;  1KTM A;  2FYZ A;  2K37 A;  4N3Y B;  3RK2 B;  4ZFG A;  1BCC G;  3AE7 C;  2Y9Z A;  3H1L D;  3CCU P;  2Q5U A;  1EZV D;  2XND H;  2YMY A;  3SWY A;  1LJ2 A;  2B88 A;  5H2F H;  2KLU A;  1L0L G;  2Q9I B;  3Q3D A;  2IBZ G;  2MKV A;  1SS1 A;  1L0L J;  1LTB C;  1NOH A;  4UB6 E;  1FZA C;  4UB8 H;  4ZNC A;  3HUS A;  3BRV B;  2W90 A;  3QWO C;  2YO3 A;  3KHU A;  2IBZ D;  4PD4 E;  1AFO A;  1SQQ E;  3V2N A;  1LGH B;  2XZR A;  3W68 A;  4AYC A;  1NU1 D;  1BGY E;  3V6I A;  1AV1 A;  2J0G A;  3BCC G;  5TJH A;  3CC4 P;  4DCK A;  3AE1 C;  1FZF A;  2R3C A;  1IFM A;  1GDT A;  2V4H A;  3O6Q A;  3WUV A;  1NU1 E;  1Q82 Q;  2AXT H;  2V7Q H;  1YJ9 P;  4JBZ A;  4HH2 A;  1BSN A;  5KLV D;  4Y28 J;  5APW A;  3B5N A;  1SQP J;  1S72 P;  1LNQ A;  3MHV A;  2J61 A;  3VYI A;  3A5T A;  2KNC A;  4PV1 C;  3H1I E;  4EI2 A;  2P67 A;  1NVO A;  4Y99 C;  3H1I G;  1PZQ A;  1SQV D;  3PH0 A;  4L73 A;  1T3J A;  1IFI A;  3II6 A;  3CD6 P;  1KIL D;  1CI6 A;  3Q5S A;  1IFN A;  3CCM P;  2JP3 A;  5AW7 B;  1SQV K;  1IO4 A;  2OYO A;  1HGZ A;  2O1J A;  4I6M C;  1BSH A;  1R5L A;  2FYN B;  3CCR P;  4U3F G;  1T3U A;  2JHM F;  1LT9 B;  3CCS P;  4M7H A;  1AA0 A;  1J1E B;  2WQY C;  3HRN A;  2O01 J;  1SQP G;  3BCC D;  3AEG C;  2C0W A;  3CC7 P;  3FWL A;  1NTZ K;  1FZB A;  3JSV C;  2E74 C;  1RF1 B;  1JC9 A;  3GW6 A;  1BCC D;  1LTJ C;  2ZT9 D;  1VPC A;  2FXP A;  1OVR A;  2Y9Y A;  2ZVO B;  1JUN A;  3L73 G;  1HJB A;  3RGU A;  2QJP C;  3L71 E;  1BCC E;  2AEJ A;  1ZOY C;  1PPJ D;  3HTK A;  2HFE D;  2RKL A;  4WVZ A;  1FJK A;  4R9T A;  1Y8A A;  1W2B O;  2DW3 A;  1RQV A;  1P84 D;  2OYI A;  3V5B A;  2YKO A;  2YNY A;  1FZE C;  1LTJ B;  3H32 A;  2J0H A;  2N9Y B;  4TLF A;  1BDC A;  2E74 B;  1PGP A;  1PPJ G;  1LWU A;  5B66 H;  5L8R J;  3M0A A;  3HE4 A;  4DJG A;  1M1J B;  1OXZ A;  3G6E P;  1EDL A;  2LXC B;  2JHK F;  3RL0 C;  3USS A;  1PFI A;  1DD4 A;  1PV3 A;  2ZFC A;  4KT0 J;  3KZI H;  2IYP A;  2Q7C A;  1KZU B;  1P84 E;  2OGU A;  1NTM E;  1X22 A;  3MUD A;  5C39 A;  1MV8 A;  1DIP A;  2GUV A;  2OTJ P;  3SWK A;  3M06 A;  1QEX A;  1VF5 D;  3L72 D;  3V2R A;  2PGD A;  4GOD A;  3E1R A;  1OW7 A;  1VQ9 P;  3RK2 D;  3M0D C;  2BAS A;  1W5C E;  1K9M Q;  1KMI Z;  1N86 B;  1YJW P;  2KZJ A;  4RES B;  5KAF H;  4L76 A;  4PV1 B;  3KQG A;  4JPZ B;  2AEF A;  2YMK A;  1YTZ I;  4L75 A;  2XU6 A;  1KQF B;  2CK3 H;  1VQM P;  2XNX B;  3FX0 A;  1HUC A;  1SFC C;  4JYO X;  1JY2 P;  2OAR A;  1GW3 A;  4NYT A;  3C8V A;  3AE2 C;  1R8E A;  2C0X A;  1N86 C;  1Q81 Q;  4UB8 E;  3L35 A;  3C9I A;  3M9H A;  3P8M C;  4K3A A;  2QEX P;  3AE3 C;  1N73 A;  2H8P D;  2FY8 A;  1ZP0 C;  2QJK B;  2N1T B;  3HE4 B;  4WY4 D;  3RL0 B;  4AUW A;  1FZC A;  1OIP A;  3HD7 C;  2WIT A;  1KQS O;  2N1T C;  1D7M A;  4H0L D;  2P7J A;  1KIL A;  2VRS A;  2HOD B;  3L73 E;  1JY3 O;  4ZKP A;  1SQP D;  3ABV C;  1U57 A;  5KLI B;  1S9K E;  2KSE A;  2QIW A;  3CME P;  3MUD C;  1IC2 A;  2B9B A;  3L75 G;  3HE5 B;  4JQ0 D;  1H0T A;  3P32 A;  5CBN A;  3C1L A;  1YIT P;  1PP9 E;  1HVV A;  2IBZ I;  1NHL A;  3O6Q B;  4NPD A;  1LWU C;  2JWD A;  1QLE D;  5GTI E;  1FOS E;  1RH5 B;  2ZYA A;  1BE3 D;  2Q3E A;  3CL3 D;  4TT3 H;  2G8Y A;  1IFJ A;  1FOS F;  1GW4 A;  5CJ4 A;  2WZ7 A;  1Q7Y Q;  1USD A;  3A0H H;  2ZXX A;  2NRG A;  5AVU B;  1L0L D;  2WVR A;  2KLV A;  3VOP A;  2ZJS E;  1H88 A;  3OA7 A;  4XFJ A;  5KJ7 C;  4N6J A;  2PFX A;  1EZV I;  2BCC G;  3SWF A;  2QJY C;  1RY3 A;  1VF5 B;  3AE5 C;  4U3F J;  2FYN C;  3L70 G;  1BE3 J;  3L73 D;  4DZO A;  3H1L E;  2A06 E;  4XA4 A;  1IK7 A;  1Q2N A;  1KIL B;  2J3F A;  3H1L G;  1N7S A;  4IL6 X;  3IF4 A;  1FZG A;  2FXM A;  1EZV G;  1WRG A;  1NU1 G;  1N7S C;  3SSU A;  1QX8 A;  2KYV A;  4RJT A;  1L4A A;  1JCD A;  4LLH A;  4WWI A;  3CCV P;  4D6T J;  2KS1 A;  1OW6 A;  4HKZ H;  5AW5 B;  2JEE A;  1CW5 A;  4PJ0 E;  2HOD A;  3RK3 C;  5BVZ A;  3JCU E;  1KB9 I;  1H8A A;  2C9N Y;  1GD2 E;  1S3J A;  3FIB A;  1SP4 A;  1RE3 A;  1U7J A;  1SLQ A;  3CX5 D;  1SQX G;  2Y0C A;  3BRT B;  1L0N K;  5AVR B;  1IJD B;  2WPV B;  1RE4 C;  1PGJ A;  2NPS D;  2GY7 A;  5B5E H;  2WTY A;  3IFM A;  1FZC C;  3LW5 J;  5TIS E;  1OW8 A;  2OTK E;  3VMY A;  1GU5 A;  5KJ7 D;  2WSS H;  1LP1 A;  3VP8 A;  3MP7 B;  1SQB D;  1NTM G;  3L70 E;  4H13 D;  3RL0 D;  1WT6 A;  1USE A;  3MD0 A;  4RO0 A;  1VQ7 P;  1SQX D;  1S9K D;  1SQP K;  4EDF A;  4KHX A;  4YXW H;  2Q9I A;  1OVU A;  4H0L B;  1KV4 A;  5KKZ B;  3PHL A;  3H1J G;  1FZF C;  2QVA A;  3BCC J;  5AVS B;  1SQX J;  1NJI Q;  4R9J A;  2O01 N;  1PP9 D;  4U7J A;  1HH0 A;  3CCE P;  2K88 A;  1Y9B A;  2A45 H;  2KK7 A;  3L75 J;  3HD7 A;  5B66 E;  4JF7 A;  2KS1 B;  1X79 B;  4H13 C;  4HB1 A;  1X8Y A;  3AE6 C;  1L4A B;  1MUU A;  2H88 C;  4K35 A;  3GHG C;  5E79 H;  4W80 A;  1FZD A;  1HBW A;  3GHG B;  1PGQ A;  5AVX B;  5APU A;  2D2C C;  3L75 D;  5APT A;  3V4Q A;  5APV A;  2QE7 H;  2ZT9 C;  2IPP A;  4BXL A;  1PP9 J;  1S4X A;  3PP5 A;  4EIJ A;  2HLO C;  1JY3 N;  2J60 A;  4AQR D;  1YYC A;  2IFN A;  1LTT C;  2W6J H;  4WY4 C;  4OH8 B;  1H0T B;  2UWJ E;  1N73 C;  5CCG D;  5KLV J;  2KNC B;  2JWA A;  2H7H A;  2BCC E;  5K5G B;  3TNU B;  2GM4 A;  5CHX A;  1NTK E;  1SQB J;  3HE5 A;  2YO2 A;  3L4F A;  1MZ9 A;  1GK6 A;  2WPR A;  4JYB A;  1JO5 A;  2HYN A;  1VDF A;  1J1D B;  2WT7 A;  3L36 A;  1E5W A;  2WSE H;  3A0H E;  1ZN5 A;  2FYU G;  2I1K A;  1DX7 A;  1SQQ K;  3H1I J;  2B87 A;  1JNM A;  5BU8 B;  3LW5 H;  4BWN A;  1URQ C;  2P58 A;  2OTL P;  3CLQ A;  3MTU E;  4ASV A;  3I56 P;  1FZB B;  1FZG C;  4H44 C;  1UII A;  4D6T D;  4CPG A;  1RE3 C;  1NKN A;  3WUU A;  2K3R A;  1EXI A;  1FC2 C;  1RE4 A;  1FZG B;  2PAJ A;  1FZA A;  1NAY A;  1DEB A;  4WBA A;  3RK2 C;  1SQV E;  3G9R A;  2IDB A;  3AE8 C;  2WSE J;  1M56 D;  2JHL F;  2YXQ B;  5AW2 B;  2QRX A;  3CMA P;  1VQO P;  2WNP F;  3CCJ P;  4GKG A;  4EOT A;  1GK4 A;  2R5D A;  1Z3S A;  3CWB E;  3V2Q A;  3GHG A;  4RKU J;  1N7L A;  1JY2 O;  5AW6 B;  2QA4 P;  3P8C D;  3IN6 A;  2MJZ A;  4NPF X;  1R5S A;  2Y0E A;  4UB6 H;  1T6A A;  2A45 I;  2Y0D A;  2M5A A;  3Q2Y A; 
#chains in the Genus database with same CATH homology
 1RF0 A;  1X9V A;  2N1T B;  2I1J A;  3HUS B;  1SFC D;  1NTK K;  4W7Z A;  3HE4 B;  4WY4 D;  3RL0 B;  1T2K C;  4AUW A;  1FZF B;  1FZC A;  3RK3 D;  2W6A A;  3HD7 C;  1XTC C;  1QL1 A;  2N1T D;  2P2U A;  2WIT A;  4M3L A;  3HUS C;  5CCH A;  2WT7 B;  3UIA A;  3I5C A;  2N1T C;  1G1J A;  5AW1 B;  1G2C B;  1L0L K;  2P7J A;  4N78 D;  3B5N C;  1EQ7 A;  1KIL A;  2QM8 A;  1A02 F;  1ZV8 A;  2J3O A;  2VRS A;  1IK9 A;  2HOD B;  3M9B A;  2IFM A;  1JY3 O;  4ZKP A;  1LTG C;  2QM7 A;  3HTK B;  1S9K E;  4W7Y A;  2HLO B;  1N7S D;  2J59 M;  2J61 B;  2FFD C;  5APY A;  3E1I C;  1IC2 A;  1FZC B;  3MIW A;  3LIE A;  4JZC A;  3U59 A;  2LKM A;  3HE5 B;  4C7N A;  1W2E A;  3MGN A;  4IFF A;  3P32 A;  2HG5 D;  3NFQ A;  2WPS A;  5APX A;  3VTP C;  1HVV A;  3VMZ A;  2FYZ A;  2W27 A;  4N3Y B;  3RK2 B;  4ZFG A;  2OYI C;  1NHL A;  1GTW A;  3B5N D;  2J3U A;  1LWU C;  2XDJ A;  3NMD A;  3IR9 A;  1SFC B;  3U1C A;  2Q5U A;  1FOS E;  2HOD C;  3VMX A;  1RE3 B;  2YMY A;  1FU1 A;  1N2D C;  5AVW B;  2KB7 P;  4LC1 A;  1KFM A;  2WWW A;  3B5N B;  3CL3 D;  5CCG C;  3G3Z A;  3SWY A;  2XNX C;  1FIB A;  1FZB C;  1IFJ A;  1FOS F;  2XV5 A;  1GW4 A;  5CJ4 A;  2N9B A;  2WZ7 A;  1URQ B;  2Q9I B;  3HD7 B;  2W6B A;  3OJA B;  5AVU B;  5AW3 B;  5AW4 B;  2KLV A;  1LTB C;  3VOP A;  4EPU A;  1NOH A;  1Z3U A;  1H88 A;  3OA7 A;  5KJ7 C;  4WY4 A;  1FZA C;  4N6J A;  5APQ A;  3HUS A;  1LT9 C;  3BRV B;  3A7O A;  2OYH B;  2O1K A;  3BVH B;  3SWF A;  2Z4E A;  1RY3 A;  1FJP A;  3M91 A;  1KIL C;  1OWA A;  1LTJ A;  3H32 B;  5AW9 B;  3B8E B;  2YO3 A;  4DZO A;  1AFO A;  3V2N A;  4XA4 A;  2NPS A;  1LGH B;  2XZR A;  2R32 A;  4C46 A;  1KIL B;  1FID A;  2J3F A;  4AYC A;  1JTH A;  1ZR2 A;  1N7S A;  2Z4E C;  1FZG A;  1DH3 A;  1FZA B;  2FXM A;  1WRG A;  2J0G A;  4Y99 B;  5APS A;  3P8C E;  1N7S C;  3R2P A;  2OYH A;  3TYY A;  1FIC A;  2KYV A;  1NTM K;  1CI6 B;  1FZF A;  2XKM A;  1NH4 A;  2NPS C;  2J2P A;  2R3C A;  1L4A A;  1IFM A;  2Q3I A;  2Q9I C;  2HLO A;  1GDT A;  1JCD A;  2CPS A;  4LLH A;  1SVF A;  1T8Z A;  3M0D A;  3L37 A;  5AW5 B;  3HD7 D;  4HH2 A;  3RK3 B;  1NWQ A;  5APW A;  3CI9 A;  2JEE A;  1CW5 A;  5BVZ A;  2HOD A;  1JOC A;  3RK3 C;  3B5N A;  5AVZ B;  4C7N B;  1H8A A;  1HTL C;  1FAV A;  2J61 A;  2FYU K;  3VYI A;  3A5T A;  2C9N Y;  1GD2 E;  1SFC A;  3KPE A;  2H43 C;  3FIB A;  4IFM A;  1SP4 A;  2P67 A;  2KSJ A;  1RE3 A;  1SLQ A;  5AVQ B;  1N7S B;  3EFG A;  3KDP B;  3BRT B;  1L0N K;  4Y99 C;  5AVR B;  1IJD B;  3TSI A;  1RE4 C;  2Z5H A;  1MFZ A;  3O8Z A;  3OAK A;  2NPS D;  1T3J A;  1IFI A;  3II6 A;  2GY7 A;  1QL2 A;  4HYT B;  2WTY A;  3IFM A;  1KIL D;  5AW8 B;  1FZC C;  1CI6 A;  1IFN A;  3VMY A;  1FDM A;  5AW7 B;  1GU5 A;  1SQV K;  2JJL A;  1IO4 A;  5KJ7 D;  1HGZ A;  2O1J A;  4I6M C;  4B86 A;  4GIF A;  3VP8 A;  2E43 A;  1J2J B;  1JY2 N;  2XNX A;  4XE5 B;  5CCG A;  3H32 C;  3RL0 D;  1T3U A;  1WT6 A;  2JHM F;  3MD0 A;  2IX7 C;  1LT9 B;  2FKW B;  4M7H A;  2YKP A;  3V4W A;  1N86 A;  4N78 E;  1J1E B;  5AW0 B;  1S9K D;  3HRN A;  1A02 J;  1SQP K;  5AVV B;  2JHI F;  2J64 A;  4KHX A;  2POH A;  2Q9I A;  1GL2 A;  2C0W A;  2J3F D;  1FZF C;  3KYQ A;  1XTG B;  3H6P A;  1NTZ K;  1H89 A;  1J1E C;  3VP9 A;  4WB4 A;  2E42 A;  1FZB A;  5AVS B;  1AQ5 A;  1RF1 B;  1JC9 A;  3P7K A;  2HPC A;  4R9J A;  1LTJ C;  1JY3 P;  3VN0 A;  5CJ0 A;  1RF0 C;  3LID A;  1VPC A;  1LTS C;  1HH0 A;  5KTB A;  2A45 H;  2J1G A;  1CSB A;  3HD7 A;  1JUN A;  4JF7 A;  2YKQ A;  1X79 B;  2OYI B;  1X8Y A;  1HJB A;  1JCC A;  1GL2 B;  2H43 A;  1L4A B;  1MUU A;  4M7F A;  2HPC C;  2R5B A;  3GHG C;  1RE4 B;  4W80 A;  3M9Q A;  1FZD A;  1HBW A;  3GHG B;  5AVX B;  3U1A A;  5APU A;  1FZE A;  2HPC B;  1M1J A;  5APT A;  1HWT C;  2FIB A;  3V4Q A;  1L4A C;  5APV A;  2IPP A;  3HTK A;  5CCH D;  2HFE D;  5AVT B;  2FFD A;  3PP5 A;  1FJK A;  1ZLL A;  4R9T A;  4EIJ A;  2HLO C;  2JHH C;  1JY3 N;  4C7R A;  4AQR D;  2OYI A;  2J60 A;  1G2C A;  3V5B A;  1YYC A;  1URQ D;  1JTH B;  2IFN A;  1LTT C;  3EQ2 A;  2YKO A;  1ZR4 A;  1RF0 B;  2YNY A;  1FZE C;  1LTJ B;  3H32 A;  2J0H A;  4WY4 C;  1T2K D;  4OH8 B;  1NKZ B;  1RF1 C;  3T97 A;  5KJ7 A;  3N7N A;  2O01 H;  1N73 C;  1LWU A;  5CCG D;  4JYC A;  3M0A A;  3HE4 A;  1M1J B;  1OXZ A;  1LTA C;  5BU5 A;  2H7H A;  2JHK F;  1NU1 K;  1NO4 A;  3RL0 C;  3TNU B;  2GM4 A;  5CHX A;  1PFI A;  1G1I A;  1GZL A;  4I2L C;  2ZFC A;  3HE5 A;  1M7L A;  2YO2 A;  3L4F A;  1MZ9 A;  1GK6 A;  2WPR A;  4JYB A;  2Q7C A;  1GL2 D;  3A2A A;  1KZU B;  3WMM 0;  1SQX K;  3E1I A;  3MUD A;  1JO5 A;  2HYN A;  3NXS A;  1VDF A;  1J1D B;  1MV8 A;  4I1L A;  1HGV A;  4IFD K;  2GUV A;  1GU4 A;  2P1J A;  2WT7 A;  3L36 A;  1E5W A;  3M06 A;  2WSE H;  1ZN5 A;  2M8R A;  2KOG A;  3NTN A;  3V2R A;  2I1K A;  2L5G B;  3TK1 A;  1DX7 A;  3BVH C;  2OYH C;  3RK2 D;  3M0D C;  2BAS A;  1SQQ K;  1N86 B;  2N1T A;  2A45 G;  2Z5I A;  4GT1 A;  1JNM A;  5BU8 B;  3LW5 H;  4RES B;  1Z56 A;  5KLV K;  2H43 B;  1M1J C;  2WSC H;  2WSF H;  1URQ C;  2WPQ A;  3CLQ A;  3KQG A;  2M3B A;  3MTU E;  3TNU A;  1N73 B;  2PP6 A;  1YTZ I;  2GUS A;  2XU6 A;  1FZB B;  5CMZ A;  1FZG C;  2XNX B;  4WY4 B;  1RF1 A;  2C9L Y;  2ZXE B;  1FZE B;  1NAF A;  1RE3 C;  1NKN A;  3BVH A;  1HUC A;  1RE4 A;  1SFC C;  1FZG B;  2PAJ A;  1FZA A;  2D39 A;  4JYO X;  1LWU B;  3BAS A;  5AVY B;  1JY2 P;  1URQ A;  1KFN A;  1DEB A;  2OAR A;  4WBA A;  3A3Y B;  3RK2 C;  1GW3 A;  1YTZ T;  2NPS B;  4NYT A;  1SQB K;  4O9B A;  2J0Y A;  1LTI C;  2JHL F;  5AW2 B;  2WNP F;  1LT9 A;  2C0X A;  1IFD A;  4GKG A;  4EOT A;  1GK4 A;  1N86 C;  2R5D A;  1Z3S A;  1FBM A;  3V2Q A;  3L35 A;  3C9I A;  3GHG A;  3M9H A;  5CCH C;  3P8M C;  2Z4E B;  4DOJ A;  2CPB A;  1L4A D;  1JY2 O;  1N7L A;  5AW6 B;  4ZKU A;  1GL2 C;  1KQL A;  2J3G A;  3P8C D;  3E1I B;  2J5Z A;  3BAT A;  2MJZ A;  3N4X A;  2FFD B;  1J1D C;  1N73 A;  1CZQ A;  3V2P A;  2A45 I;  4LGD E;  2KP8 A;  2H8P D;  2J58 A;  1JMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...