3HUSC

Crystal structure of recombinant gamma n308k fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
291
Chain Sequence
DSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHKGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Impaired protofibril formation in fibrinogen gammaN308K is due to altered D:D and "A:a" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 75
structure length 291
sequence length 291
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3husC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3husC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3husC03
2WNPF 4R9JA 1JY3P 2J3FA 2OYIC 3H32C 1FZBC 2Q9IB 2H43B 1RF1C 2XNXC 4JZCA 1T3UA 2Z4EA 2OYHC 1N73C 2HODA 2J0HA 1FZGB 1LWUA 1RE3B 4ZFGA 3E1IC 1FZCA 1FZAB 2JHKF 2JHIF 3BVHB 1LT9B 2FFDC 2FFDA 1FIDA 2HPCC 1M1JC 2OYIA 2J3FD 2GY7A 1FZFC 1JY2N 1LTJC 2XNXA 2FIBA 1JY2O 2Z4EB 2OYHA 2HODB 2HLOC 2A45H 1LWUB 1N86A 1Z3SA 1FZCB 3E1IA 4M7FA 2J5ZA 2FFDB 2J61A 2HPCA 2Q9IC 2OYIB 1FIBA 2H43C 1RE4C 1RF0A 3FIBA 4EPUA 1FZFA 2XNXB 2J3UA 1FZEC 2OYHB 1FZGC 3H32A 1RE3C 1FZBA 2J0YA 2HLOA 4M7HA 1N86B 3E1IB 3BVHC 1RF1A 1Z3UA 2JHLF 1N73A 3HUSC 2J61B 2JHHC 4JYOX 3GHGC 2HPCB 1JY3N 2J0GA 1RF0B 1FZDA 1JY3O 1RE4A 1FZFB 2A45G 1W2EA 1FZEA 2J1GA 4R9TA 3H32B 1M1JA 1FZBB 1JY2P 1FZCC 2HLOB 2JHMF 1JC9A 1RF1B 1LTJA 1N73B 3HUSA 1FZAC 3GHGA 2A45I 1RE4B 2J3OA 1LT9C 1FZEB 2Q9IA 1M1JB 2H43A 1FICA 1N86C 2Z4EC 1LTJB 2J2PA 2J60A 2HODC 4NYTA 1LWUC 1FZGA 1RE3A 3HUSB 1RF0C 3GHGB 2J3GA 1FZAA 2D39A 3BVHA 2J64A 1LT9A
chains in the Genus database with same CATH superfamily
2OYIC 1RF1C 2D2CC 4I6MC 5TISH 1FDOA 1BDDA 3L72E 1HTLC 3OW2O 3W67A 1QLED 3SWYA 4IL6E 1FU1A 1Q82Q 1SQXE 3UIAA 2UWJE 1FZFC 4N3YB 1NTKK 1AVOA 2FIBA 2Z4EB 3K5BA 2FYNB 5APXA 3A2AA 2N1TB 2O01N 4GT1A 2ZT9B 1EXIA 3M0DA 3V4WA 2IBZE 5CHXA 2WPSA 1P84I 2IZ1A 4L75A 1L0LG 3H1HD 1BCCD 3CXHI 1BE3J 4PD4I 3H1JG 1RF1A 2Q1KA 2WSEJ 3TSIA 1SQQD 2J0GA 2JJLA 3L75E 1DEEG 2KYVA 3HD7D 4KHXA 1YTZT 1ZW0A 3GLMA 2A06G 3A3YB 3AE5C 2ZT9C 3FXDA 1IK9A 5KAIE 3WU2H 2GM4A 5AVWB 2J3OA 1M90Q 4YXWH 3L36A 4KJMA 4O9BA 2W8ZA 4AQRD 1SQQK 1ZV8A 2KI7B 3D70A 2FYUJ 3PH0A 2Q3EA 2QM7A 1DH3A 2YIUB 1KB9D 2H43B 3VP8A 3U59A 1NVOA 1IFDA 2Z4EA 1VQNP 3D71A 3CWBD 3CCJP 2N1TA 3B4SA 3HE5B 1EDKA 1VPCA 1L4AC 2E74C 4QMAA 1KYOE 1SQBG 4PV1C 2A45H 1YYCA 3JCUH 3RK2D 2R44A 2H43C 4H0LD 3AE3C 2OYHB 2I8DA 4ZKPA 1IJDB 4C46A 2JDIH 2H88C 2WITA 2BASA 4PJ0E 2WSEH 2P7JA 3VMYA 2Y9ZA 3VTPC 2WWWA 3BRTB 1PL5A 1S72P 4M3LA 3TGUE 3V4QA 1YIJP 3USSA 3AE7C 1HH0A 3C9IA 2H43A 1W5CE 2FY8A 3EWKA 4IFMA 3MP7B 1SQXK 2POHA 2R3CA 3B5ND 3HE5A 3P8CE 4R9JA 2YKOA 3CC2P 2KUBA 2XNXC 1PPJG 3H1LD 2P2UA 1T3UA 3PTZA 1JB0J 3M91A 2E5YA 1JY2N 2JO1A 1HVVA 2OYHA 5KJ7D 3KXDA 5CCGC 2FFDB 5CCHA 1NTMJ 3II6A 1NTZE 1GD2E 2V4HA 3EFGA 1G1IA 2E75D 1Q81Q 3S1KA 4H44B 1K05A 2Y9YA 3FWNA 2XKMA 2BCCG 1RQUA 4JBZA 4WVZA 3RK3D 3VMAA 1EZVE 1IC2A 1HJ0A 1RF0B 1DEBA 1VQ4P 2QJYC 1PZQA 3BCCJ 2ITAA 2YMYA 2WPRA 2QSIA 5KKZB 1LTBC 1VQ8P 4GODA 1NTKJ 2YMKA 3L73G 2P67A 1URQC 2HG5D 1LT9C 1KILD 2Q5UA 4H44C 4XE5B 2XNDH 5CCGA 4NPDA 5E79H 4AUWA 3O6QB 5DJTB 4Y99B 1RF0C 5APUA 1P84H 1NAFA 4U3FJ 3CXHH 5KKZC 4PD4H 2QIWA 3A5TA 2IBZI 1NU1E 4EIJA 3L71G 2FFDA 2OYOA 1OVVA 2GY7A 3H1HJ 3PP5A 1YI2P 1ZOYC 1JY2O 5CJ0A 3SWFA 2L5GB 5APWA 2PFXA 1L0NG 3AE2C 2QJKC 3G9RA 1SQQJ 1FIBA 1RE4C 1BCCG 1RF0A 3FIBA 3P32A 1S5LE 3V5BA 1K9MQ 1IFPA 4B86A 1J1EB 4UB8E 3CPWO 1N86B 3RBZA 4ASWA 3SFEC 2CPBA 2R5DA 3D6YA 2J61B 2HPCB 1JY3N 1OX3A 2Y0CA 5AW7B 3KQGA 3CC4P 2Q6QA 2C9LY 4DZOA 2HYNA 3O6QA 1OMIA 2ZVOB 4EDFA 5AW9B 2NRGA 1OVUA 2IFNA 1MZ9A 1PGJA 2KNCB 1NWQA 1N86C 2E5TA 4W80A 1SQPE 2GUVA 4AYCA 3L73E 1KYOI 1AA0A 1VQ9P 2D39A 3BRVB 4WY4D 3H25A 2WSFJ 3L70E 1H8AA 1KQSO 3CWBG 1NTZK 1ZMEC 1G1JA 3RL0D 2P58A 2OTJP 3BVHB 1NKNA 1JEKA 1GW4A 3RL0g 4JYCA 1NAYA 2NPSD 4YPCA 2JP3A 3L72J 1CI6B 3JSVC 1N86A 5CJ4A 3L71E 1SFCC 2W27A 5BVZA 2J61A 1SQXJ 2HPCA 3H1KG 4JPZB 4PD4D 1Z56A 3VN0A 1SQVG 5H2FH 4H13B 2J58A 3BVHC 1L0NE 2DW3A 1VF5B 3G6EP 1AFOA 1JY3O 1EC5A 4OWFA 3FGAD 1GL2C 2KNCA 2G3AA 3QH9A 4XFJA 3SSUA 2HLOB 3B71A 4JYBA 2M5AB 3L75J 2IZ0A 3R2PA 1N73B 1SS1A 2K37A 1M8OB 3KYQA 3CCMP 2E76C 1NU1K 2N9YB 4H13C 1BGYE 1FS0E 1H89A 2AXCA 1NTMD 1VQ6P 1J1DB 1PP9G 1OXZA 1JMBA 2KZJA 3BVHA 3V2PA 1GMJA 3H1LG 1Y47A 1MKMA 2KLUA 4UB6H 3L74G 2ZYGA 2K9YA 1LTTC 1N73C 1K73Q 1CI6A 2J0HA 3BCCD 2WSFH 1U7JA 3IR9A 1LT1A 1MV8A 2Q7CA 3E7KA 5CMZA 1EZVI 1SQPD 3S4RA 2HODB 1RHZB 3A0HE 1YJNP 2NZ2A 4C7NB 1AJYA 3U1CA 3AE1C 1FZCB 5AW5B 1X0TA 3CCQP 3L70D 4IL6H 1X79B 3AE4C 4U3FD 3OA7A 2HLOA 2IPPA 2M5AA 4TLFA 3E1RA 1N73A 3CD6P 3H6PA 2JHHC 3GMAA 2WVRA 1FZDA 1SQPK 1L4AD 1USDA 5TISE 4DT0A 2A45G 1EQ7A 2E74D 1N2DC 1LJ2A 1FZCC 3H1ID 4PV1D 5B66E 4JQ0D 5AW6B 2QRXA 2XDJA 3A0BE 2JKVA 1Q90D 3IFMA 2W6AA 1ZRTE 2Z4EC 3OAKA 1LTJB 1BE3G 2FYNC 3TGUJ 2N1TC 3GHGB 5KAIH 1SLQA 2J3FA 4D6TE 1VQMP 4R4MA 5KAFE 3GF7A 1Q7YQ 2HODA 3RGUA 2E42A 4C7NA 1FZCA 5APSA 3TYYA 1OVRA 2Y0EA 3SFDC 1HJBA 1KD1Q 1L0NK 3Q5RA 1S5LX 5KLVE 1LTJC 3AEEC 1LTSC 1FC2C 4Z1MH 2W83C 3R4YA 3CL3D 1LWUB 1N7SD 5C39A 5AVYB 1VQOP 2FYUG 3GG2A 3TF5A 3FX0A 2OARA 3PHLA 3HRNA 3VMXA 1KYOH 3B8EB 3E1IB 2C0WA 3CI9A 1NTZJ 1XTCC 3HD7B 2IYOA 1QGKB 3CX5E 1GZLA 2IX7C 5AVRB 1Y8AA 2YIUC 4RO0A 1FZBB 4LC1A 3V2QA 2M3EA 1EXJA 3AEFC 1JC9A 1LTJA 3CCVP 3I5CA 2P1JA 1OIPA 3GHGA 3L72D 1RQVA 4WBAA 3GW6A 1FZEB 4PJ0H 1SQXD 5APVA 3NMDA 4U7JA 4I2LC 1L0LE 3HD7C 3BATA 3H1JE 1ZR4A 1LP1B 1FZBC 2IBZD 3KZIE 2SPZA 3NFQA 2OYHC 2A06E 2WPVB 1LWUA 3P8MC 5K5GB 1FZAB 3MD0A 2WT7B 2R5BA 5CCHC 1URQD 3WUTA 3L75D 3KDPB 1ZRTD 1JMMA 1NU1J 4C7RA 1KMIZ 3AECC 3RK2B 1GW3A 3E1IA 1OW8A 3EQ2A 4H0LB 3HD7A 1FDMA 1KQFB 3I55P 1VQPP 1FZBA 2FXPA 4M7HA 2R3SA 2YXQB 5KTBA 1USEA 1A02F 4JYOX 4YTPC 1FZEA 2AEJA 3Q2YA 1K04A 3MGNA 1SQBE 1EDJA 3ITKA 1NTMG 1LP1A 4JF7A 3LIEA 1KYOD 2CPSA 3WUVA 3B5NB 1VL2A 5KLVK 4I7ZB 3HUSB 1FZAA 2FFDC 2WT7A 2I1JA 2M0BA 4MN4C 4OVNF 2AEFA 3BCCG 1SQPJ 1ZXGA 2WMMA 3L73J 3VOPA 2KB7P 1NTKG 2QE7H 2K88A 3A7OA 4EOTA 1GK4A 1GDTA 3L70J 1FIDA 1YBKA 1HF9A 3CCUP 3L37A 1S2EA 1L0LD 4RJTA 3B5NC 1HUCA 4DCKA 3L35A 3WMM0 2KK7A 5APYA 3H1JD 4N78E 4BRYB 2XV5A 3CLQA 2E75B 4U3FG 3TGUD 3FWLA 4EPUA 3PJSK 3H1IJ 2W6JH 3MZWB 1PPJE 3CXHE 3RK3B 5GTIE 4Y99C 1FBMA 2AEMA 2O01J 1L0LK 4LGDE 2Z5HA 3P8CD 2ZJSE 1W2EA 3H1HG 4ASVA 1L0NJ 2C9NY 1AVYA 1A02J 2H7HA 2KSJA 4UB8H 1BDCA 1VDFA 1DD4A 4BWNA 1FJKA 3B5NA 2ZVNB 3HUSA 1HGVA 2E75C 1SFCD 1KILB 1SQQG 3TNUB 1OFCX 1JCDA 5AVUB 1GU5A 3KPEA 3RK3C 4EI2A 2WZ7A 1AV1A 2YXRB 3C8VA 4NYTA 2GUSA 1VQ7P 3FXEA 3ABVC 2BCCE 3LW5J 1KFNA 5DJUB 5AW0B 1BGYJ 1J2JB 1LGHB 3LIDA 1YJ9P 1NTZD 1T2KC 1GL2D 2OTKE 1J1EC 5KLIB 2K9JA 5KJ7A 1KILC 4ZFGA 5AVQB 2KXPB 4BRYA 2HPCC 1EZVD 4OH8B 2PP6A 2E76D 1N7LA 1NJIQ 1MFTA 3CX5I 2AXTH 2ZFCA 3M0AA 4L74A 1PFIA 1SQBK 1PGPA 1GTWA 4OGQD 5BU8B 2IFMA 3S9OA 1NHLA 1CW5A 1G2CB 1VQKP 1KILA 2YO3A 3TNUA 4RKUJ 3G71P 1IFMA 1T3JA 2J1GA 4R9TA 2O01H 1JY2P 3MIWA 2W6BA 3L72G 5GTHH 1TU3F 3CMEP 1SVFA 3WUUA 5AW4B 1NU1D 2P10A 2D2CD 1SQXG 3RBXA 2B89A 1PGOA 1BCCE 1WT6A 2B87B 2LR2A 3CCLP 2J60A 1SP4A 2IBZG 2J3GA 4WY4B 1SQQE 2KSEA 3HE4B 5M1BA 1OWAA 2KOGA 3RL0B 3CC7P 2QJPB 3L75G 1VF5C 4D6TJ 1UIIA 2RKLA 1ZP0C 2KS1B 4IFDK 2NPSB 4K35A 2WTYA 3U1AA 2HLOC 5B5EE 5BU5A 2QEXP 2BCCD 3SWKA 2N1TD 2ZT9D 5KLVJ 1G2CA 2OYIB 1KB9E 2H89C 1KC8Q 1JTHB 2QJPC 2J5UA 2QA4P 1CZQA 3CWBE 1J1DC 1VQLP 2JHLF 3L73D 1YJWP 1Q2NA 2NPSC 1T8ZA 3AE8C 2G8YA 1AQTA 2ZXXA 3CCSP 1FZFB 3ZDMA 3Q5SA 4GIFA 2B87A 1VQ5P 1YHQP 2WSCJ 4HB1A 1NO4A 3V2NA 2BEZF 3IF4A 2C0XA 4WY4A 1LTAC 2B88A 1W2BO 1MUUA 2RN0A 2W90A 3H1KE 1FICA 3HE4A 4W7ZA 2HODC 1SQVE 1OW6A 3CMAP 5APTA 1EDLA 3L71D 3VP9A 5B66H 1M7LA 2WNPF 1JY3P 2KS1A 2Q9IB 1M57D 3A0BH 1L0LJ 2NPSA 2JWAA 3H1JJ 1JNMA 1IO4A 3AEBC 3MHVA 1L0ND 2YNYA 1WMKA 2OYIA 3QWOC 1E5WA 3N7NA 3TK1A 1JUNA 1JTHA 5KAFH 2FXMA 2HR3A 3TGUG 1KQLA 1PP9E 2Q9IC 1X22A 1IFIA 1LNQA 3H1LE 1FZFA 1BGYD 2IDBA 3L74E 1DX7A 3WU2E 3HTKB 2LKMA 3IAOA 5AVSB 3GHGC 2Q3IA 1L4AB 2QG4A 1MFZA 5CCHD 2E74B 1Y9BA 4ZMDA 1H0TB 2JWDA 3CCEP 1FOSE 3H32B 4PV1B 2Z5IA 4ZNCA 2CK3H 4I1LA 3KHUA 4GDOA 5L8RJ 5AVXB 2ZYAA 2WSCH 3PRJA 3CX5H 2Q9IA 1M1JB 1SQBJ 4L76A 2Y0DA 2BEQD 1UIXA 5CBNA 1LWUC 3P7KA 3G4SP 3RK3E 1NTZG 5TJHA 2J64A 3M9BA 3VMZA 3H32C 3AE6C 1IFJA 5CCGD 3C1LA 1KV4A 3I56P 3T97B 1EZVG 3JCUE 3CCRP 3E1IC 1ZN5A 4RESB 2QVAA 1D7MA 1JCCA 1KILE 1M1JC 3H1KD 4EYYQ 1KZUB 1N7SB 1SQVD 1X9VA 3KZIH 2MKVA 3M9QA 2LXBA 2RMZA 3HTKA 1BE3E 1QEXA 1L4AA 2M8RA 2XNXB 2J3UA 1FZEC 1H0TA 3H32A 4H44D 1ZLLA 2HFED 1S9KE 1XTGB 1AQ5A 1OZHA 1SQVK 3M06A 1N7SC 3EFFK 4D6TD 5AW3B 4ZKUA 1M1JA 1NU1G 2MJZA 1OW7A 1LTIC 1E79H 1PP9D 1FZAC 1GK6A 1EDIA 2FYUE 2WSSH 4GOEA 4LLHA 2FXOA 1JOCA 1LTGC 3NTNA 3L74D 5KLVD 4BXLA 2FKWB 1PIXA 2J2PA 3T97A 3MTUE 3RK2C 3F89A 1R8EA 4XA4A 2QJYB 2H8PD 4H0LC 2KIKA 3M9HA 1FAVA 1YQ4C 1N7SA 1KQGB 1PV3A 1KB9I 2BCCJ 1FZGB 4HYTB 1NYHA 1JO5A 1URQB 2JHIF 5AW8B 1LT9B 3N4XA 1DD3A 3CX5D 2XNXA 1HWTC 2FBWC 4DOJA 1FE6A 2N9BA 2J5ZA 2GA1A 2OTLP 2QM8A 2YO2A 4Y28J 1K8AQ 1T2KD 1SQPG 1FZGC 5CBOA 2KP8A 2XU6A 2K9JB 1Z3UA 1BSHA 4I7ZC 3HUSC 1Q86Q 3AEDC 3L70G 1N8RQ 5E79E 1QVGO 1X8YA 2K3RA 1BE3D 4IL6X 5APQA 4A7PA 2QJKB 2A06D 3L71J 1P84E 4L73A 5GTIH 3Q5PA 1RE4B 4PD4E 5AW1B 1PGQA 4CPGA 3NXSA 3O8ZA 3H1IG 4DJGA 2L91A 5KJ7C 1S9KD 2KLVA 1S5LH 1FZGA 4TT3H 2KZIA 1URQA 1FDIA 1LT9A 1BCCJ 1L2PA 5AVTB 1JM0A 3GF3A 1HBWA 1QX8A 1QL1A 1RH5B 1IFNA 1RE3B 5AW2B 2O1KA 2JHKF 1BSNA 2OQQA 2FYUD 2E43A 3VYIA 2WPQA 4N6JA 1S1CX 1NTME 3OJAB 4M7FA 1SQBD 5EFWB 3W68A 1M1KQ 2FYZA 3IN6A 2IYPA 1IK7A 1KN7A 1NH4A 4YXDC 1BGYG 2M3BA 1QVFO 1RE3C 3BCCE 2FYUK 1KFMA 2YKPA 1CSBA 4H13D 2O3JA 1QL2A 4WWIA 1NTKE 1VF5D 1RE4A 1IZNB 1H88A 1DIPA 1KORA 3CWBJ 3AE9C 4WB4A 2OGUA 3JC22 1HGZA 1FOSF 5KLIC 1NGMB 1WRGA 3Q1MA 1SFCB 3Q3DA 2A45I 3L4FA 3G3ZA 4U3FE 2AXTE 2V7QJ 1GU4A 2J59M 4HH2A 1RE3A 3MUDC 3D6ZA 2O1JA 2WQYC 4N78D 3H1KJ 1GL2B 2JR8A 1SQVJ 2JEEA 3H1IE 3AEGC 4JZCA 4KT0J 1KTMA 2PGDA 3H1HE 1P84D 2B9BA 2I1KA 1U7MA 2PRRA 3V6IA 4IFFA 1PPJD 3CXHD 2E76B 5GTHE 2XZRA 2J3FD 5H2FE 3V2RA 1U57A 1Z3SA 3LW5H 2ZYDA 4HJGH 2YKQA 3MUDA 1M56D 4OGQB 1ZR2A 1YQ3C 1NKZB 2J0YA 4GKGA 1YITP 1PP9J 1R5LA 5B5EH 5AVZB 4NPFX 1SFCA 4D6TG 2VRSA 2K1AA 3H1LJ 4WY4C 1R5SA 5AVVB 2LXCB 2ZAEB 1KB9H 4IOIH 3L74J 3F5HA 2RH0A 3AEAC 3PLNA 2ZXEB 4W7YA 1S4XA 2JHMF 1YTZI 3RL0C 1RF1B 2D2CB 4R4LA 4K3AA 3BASA 4NPEA 3A0HH 4OGQC 5KLVG 3TDKA 4UB6E 1GL2A 1T6AA 2PAJA 4GOFA 1NOHA 1S3JA 1NTKD 3M0DC 1RY3A 1NTMK 2R32A 1FJPA 2V7QH 4HKZH
chains in the Genus database with same CATH topology
3BRVB 4WY4D 3VMZA 2OYIC 3H32C 2I1JA 1IFJA 5CCGD 1H8AA 1RF1C 3VOPA 1NTZK 2KB7P 4I6MC 1G1JA 3RL0D 3A7OA 3E1IC 1ZN5A 4RESB 4EOTA 1HTLC 1GK4A 3BVHB 3SWYA 1GDTA 1JCCA 1NKNA 1FIDA 1FU1A 1M1JC 1KZUB 3UIAA 1FZFC 1GW4A 3L37A 1NTKK 4N3YB 4JYCA 1N7SB 2NPSD 2FIBA 3B5NC 2Z4EB 1X9VA 1HUCA 1CI6B 3M9QA 3L35A 5APXA 3A2AA 3WMM0 1N86A 2N1TB 5CJ4A 4GT1A 5APYA 1SFCC 2W27A 3HTKA 4N78E 5BVZA 2J61A 2XV5A 2HPCA 1L4AA 3M0DA 3V4WA 3CLQA 5CHXA 2WPSA 4EPUA 2M8RA 2XNXB 1Z56A 2J3UA 1FZEC 3VN0A 3H32A 2J58A 3RK3B 3BVHC 1RF1A 1ZLLA 2HFED 1S9KE 1XTGB 1AQ5A 4Y99C 1FBMA 3TSIA 2J0GA 2JJLA 1AFOA 1L0LK 1JY3O 1SQVK 4LGDE 2Z5HA 2KYVA 3HD7D 3M06A 3P8CD 1YTZT 1N7SC 4KHXA 1GL2C 1W2EA 5AW3B 4ZKUA 2C9NY 1A02J 1M1JA 2H7HA 2KSJA 3A3YB 2HLOB 2MJZA 4JYBA 1VDFA 1LTIC 1IK9A 1FJKA 3R2PA 3B5NA 1N73B 2GM4A 5AVWB 3HUSA 1HGVA 1FZAC 1SFCD 1KILB 1GK6A 3KYQA 2J3OA 3TNUB 2J64A 1NU1K 1JCDA 3L36A 4LLHA 1JOCA 1LTGC 3NTNA 3KPEA 5AVUB 4O9BA 1GU5A 1H89A 3RK3C 2FKWB 2WZ7A 2J2PA 1J1DB 4AQRD 1SQQK 4NYTA 3T97A 1ZV8A 3MTUE 3RK2C 1OXZA 2GUSA 3BVHA 3V2PA 1KFNA 4XA4A 5AW0B 1J2JB 2H8PD 1LGHB 3LIDA 2QM7A 1DH3A 3M9HA 1T2KC 2H43B 3VP8A 1GL2D 3U59A 1FAVA 1IFDA 1J1EC 1N7SA 1LTTC 2Z4EA 5KJ7A 1N73C 1CI6A 2J0HA 1FZGB 1KILC 2WSFH 4HYTB 2N1TA 4ZFGA 1JO5A 1URQB 5AVQB 2JHIF 3HE5B 5AW8B 1LT9B 1VPCA 3IR9A 2HPCC 1MV8A 1L4AC 4OH8B 2PP6A 3N4XA 2Q7CA 5CMZA 2XNXA 1HWTC 1N7LA 2HODB 2A45H 4DOJA 4C7NB 3U1CA 1FZCB 5AW5B 2N9BA 1YYCA 2ZFCA 3RK2D 2J5ZA 3M0AA 2H43C 1PFIA 1SQBK 1X79B 2QM8A 2YO2A 1GTWA 1T2KD 2OYHB 1FZGC 3OA7A 2HLOA 5BU8B 2KP8A 2IFMA 2IPPA 2XU6A 1IJDB 4ZKPA 4C46A 1Z3UA 1N73A 3H6PA 3HUSC 2JHHC 1NHLA 1CW5A 1G2CB 1KILA 2YO3A 1FZDA 1SQPK 2WITA 3TNUA 1L4AD 2BASA 2A45G 1EQ7A 1X8YA 2WSEH 2P7JA 1N2DC 1IFMA 3VMYA 1T3JA 2J1GA 4R9TA 2O01H 1JY2P 1FZCC 3MIWA 2W6BA 3VTPC 5APQA 1SVFA 2WWWA 5AW4B 3BRTB 5AW6B 4M3LA 1RE4B 3V4QA 2XDJA 5AW1B 1HH0A 3C9IA 1WT6A 2H43A 3IFMA 2W6AA 3NXSA 3O8ZA 2Z4EC 3OAKA 1LTJB 5KJ7C 1S9KD 2J60A 2KLVA 4IFMA 1SQXK 1SP4A 2N1TC 2POHA 1FZGA 3GHGB 2J3GA 2R3CA 4WY4B 1URQA 3B5ND 3HE5A 1SLQA 1LT9A 3P8CE 4R9JA 5AVTB 2J3FA 2YKOA 1HBWA 3HE4B 1OWAA 2XNXC 1QL1A 2KOGA 2P2UA 1T3UA 3RL0B 2HODA 2E42A 1IFNA 1RE3B 5AW2B 4C7NA 1FZCA 5APSA 3TYYA 2O1KA 2JHKF 2E43A 3VYIA 2WPQA 1HJBA 1L0NK 4IFDK 4N6JA 2NPSB 3M91A 1JY2N 1LTJC 1LTSC 2WTYA 1HVVA 2OYHA 3U1AA 2HLOC 3CL3D 3OJAB 1LWUB 1N7SD 5KJ7D 5BU5A 5AVYB 4M7FA 2N1TD 5CCGC 2FFDB 2FYZA 5CCHA 1G2CA 3II6A 2OYIB 1GD2E 1NH4A 2OARA 3EFGA 1G1IA 2M3BA 1JTHB 3HRNA 3VMXA 3B8EB 1RE3C 1CZQA 2FYUK 2YKPA 1KFMA 2XKMA 3E1IB 1J1DC 1CSBA 2C0WA 3CI9A 1QL2A 2JHLF 1XTCC 3RK3D 1IC2A 3HD7B 2NPSC 1T8ZA 1RF0B 1RE4A 1DEBA 1H88A 1GZLA 1FZFB 2YMYA 2IX7C 2WPRA 5AVRB 4WB4A 4GIFA 1FZBB 4LC1A 3V2QA 1HGZA 1LTBC 1FOSF 1JC9A 1LTJA 1WRGA 3V2NA 1NO4A 1SFCB 3I5CA 2P1JA 2P67A 3GHGA 1URQC 2C0XA 4WY4A 1LTAC 2A45I 2HG5D 1LT9C 1MUUA 1KILD 2Q5UA 3L4FA 4XE5B 4WBAA 5CCGA 3G3ZA 1FZEB 1FICA 5APVA 3HE4A 3NMDA 4AUWA 4W7ZA 1GU4A 2J59M 4I2LC 2HODC 4HH2A 3HD7C 4Y99B 5APTA 1RE3A 1RF0C 5APUA 2O1JA 3VP9A 3BATA 1NAFA 4N78D 1M7LA 2WNPF 1JY3P 1ZR4A 1GL2B 1FZBC 2Q9IB 3A5TA 2NPSA 2JEEA 4JZCA 3NFQA 2OYHC 2I1KA 1LWUA 4IFFA 4EIJA 1JNMA 1IO4A 3P8MC 1FZAB 3MD0A 2WT7B 2R5BA 5CCHC 2YNYA 2FFDA 1URQD 2OYIA 1E5WA 2XZRA 3N7NA 2J3FD 2GY7A 3TK1A 3KDPB 1JUNA 1JMMA 3PP5A 3V2RA 4C7RA 1JY2O 1JTHA 5CJ0A 3SWFA 2FXMA 2L5GB 5APWA 3RK2B 1Z3SA 1GW3A 3E1IA 3LW5H 1KQLA 3EQ2A 2Q9IC 3HD7A 1FIBA 1RE4C 2YKQA 3MUDA 1RF0A 1FDMA 3FIBA 3P32A 3V5BA 1IFIA 1FZFA 4B86A 1J1EB 1ZR2A 1NKZB 1FZBA 2J0YA 4GKGA 4M7HA 1DX7A 1N86B 2CPBA 2R5DA 5AVZB 3HTKB 1SFCA 2LKMA 5KTBA 1A02F 2J61B 4JYOX 3GHGC 2Q3IA 1JY3N 1L4AB 2VRSA 5AVSB 4WY4C 2HPCB 1MFZA 5CCHD 5AVVB 5AW7B 3KQGA 1FZEA 1FOSE 3H32B 2C9LY 4DZOA 2ZXEB 2HYNA 4W7YA 2JHMF 2Z5IA 1YTZI 3RL0C 1RF1B 3MGNA 4I1LA 5AW9B 3BASA 5AVXB 2WSCH 2IFNA 1MZ9A 1GL2A 2Q9IA 2PAJA 1M1JB 1NOHA 4JF7A 1NWQA 1N86C 3LIEA 4W80A 2CPSA 3B5NB 1LWUC 3P7KA 5KLVK 2GUVA 1RY3A 3M0DC 4AYCA 3HUSB 1NTMK 2R32A 1FZAA 1FJPA 2D39A 2FFDC 2WT7A 3M9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNP F;  4R9J A;  1JY3 P;  2J3F A;  2OYI C;  3H32 C;  1FZB C;  2Q9I B;  2H43 B;  1RF1 C;  2XNX C;  4JZC A;  1T3U A;  2Z4E A;  2OYH C;  1N73 C;  2HOD A;  2J0H A;  1FZG B;  1LWU A;  1RE3 B;  4ZFG A;  3E1I C;  1FZC A;  1FZA B;  2JHK F;  2JHI F;  3BVH B;  1LT9 B;  2FFD C;  2FFD A;  1FID A;  2HPC C;  1M1J C;  2OYI A;  2J3F D;  2GY7 A;  1FZF C;  1JY2 N;  1LTJ C;  2XNX A;  2FIB A;  1JY2 O;  2Z4E B;  2OYH A;  2HOD B;  2HLO C;  2A45 H;  1LWU B;  1N86 A;  1Z3S A;  1FZC B;  3E1I A;  4M7F A;  2J5Z A;  2FFD B;  2J61 A;  2HPC A;  2Q9I C;  2OYI B;  1FIB A;  2H43 C;  1RE4 C;  1RF0 A;  3FIB A;  4EPU A;  1FZF A;  2XNX B;  2J3U A;  1FZE C;  2OYH B;  1FZG C;  3H32 A;  1RE3 C;  1FZB A;  2J0Y A;  2HLO A;  4M7H A;  1N86 B;  3E1I B;  3BVH C;  1RF1 A;  1Z3U A;  2JHL F;  1N73 A;  3HUS C;  2J61 B;  2JHH C;  4JYO X;  3GHG C;  2HPC B;  1JY3 N;  2J0G A;  1RF0 B;  1FZD A;  1JY3 O;  1RE4 A;  1FZF B;  2A45 G;  1W2E A;  1FZE A;  2J1G A;  4R9T A;  3H32 B;  1M1J A;  1FZB B;  1JY2 P;  1FZC C;  2HLO B;  2JHM F;  1JC9 A;  1RF1 B;  1LTJ A;  1N73 B;  3HUS A;  1FZA C;  3GHG A;  2A45 I;  1RE4 B;  2J3O A;  1LT9 C;  1FZE B;  2Q9I A;  1M1J B;  2H43 A;  1FIC A;  1N86 C;  2Z4E C;  1LTJ B;  2J2P A;  2J60 A;  2HOD C;  4NYT A;  1LWU C;  1FZG A;  1RE3 A;  3HUS B;  1RF0 C;  3GHG B;  2J3G A;  1FZA A;  2D39 A;  3BVH A;  2J64 A;  1LT9 A; 
#chains in the Genus database with same CATH topology
 2OYI C;  1RF1 C;  2D2C C;  4I6M C;  5TIS H;  1FDO A;  1BDD A;  3L72 E;  1HTL C;  3OW2 O;  3W67 A;  1QLE D;  3SWY A;  4IL6 E;  1FU1 A;  1Q82 Q;  1SQX E;  3UIA A;  2UWJ E;  1FZF C;  4N3Y B;  1NTK K;  1AVO A;  2FIB A;  2Z4E B;  3K5B A;  2FYN B;  5APX A;  3A2A A;  2N1T B;  2O01 N;  4GT1 A;  2ZT9 B;  1EXI A;  3M0D A;  3V4W A;  2IBZ E;  5CHX A;  2WPS A;  1P84 I;  2IZ1 A;  4L75 A;  1L0L G;  3H1H D;  1BCC D;  3CXH I;  1BE3 J;  4PD4 I;  3H1J G;  1RF1 A;  2Q1K A;  2WSE J;  3TSI A;  1SQQ D;  2J0G A;  2JJL A;  3L75 E;  1DEE G;  2KYV A;  3HD7 D;  4KHX A;  1YTZ T;  1ZW0 A;  3GLM A;  2A06 G;  3A3Y B;  3AE5 C;  2ZT9 C;  3FXD A;  1IK9 A;  5KAI E;  3WU2 H;  2GM4 A;  5AVW B;  2J3O A;  1M90 Q;  4YXW H;  3L36 A;  4KJM A;  4O9B A;  2W8Z A;  4AQR D;  1SQQ K;  1ZV8 A;  2KI7 B;  3D70 A;  2FYU J;  3PH0 A;  2Q3E A;  2QM7 A;  1DH3 A;  2YIU B;  1KB9 D;  2H43 B;  3VP8 A;  3U59 A;  1NVO A;  1IFD A;  2Z4E A;  1VQN P;  3D71 A;  3CWB D;  3CCJ P;  2N1T A;  3B4S A;  3HE5 B;  1EDK A;  1VPC A;  1L4A C;  2E74 C;  4QMA A;  1KYO E;  1SQB G;  4PV1 C;  2A45 H;  1YYC A;  3JCU H;  3RK2 D;  2R44 A;  2H43 C;  4H0L D;  3AE3 C;  2OYH B;  2I8D A;  4ZKP A;  1IJD B;  4C46 A;  2JDI H;  2H88 C;  2WIT A;  2BAS A;  4PJ0 E;  2WSE H;  2P7J A;  3VMY A;  2Y9Z A;  3VTP C;  2WWW A;  3BRT B;  1PL5 A;  1S72 P;  4M3L A;  3TGU E;  3V4Q A;  1YIJ P;  3USS A;  3AE7 C;  1HH0 A;  3C9I A;  2H43 A;  1W5C E;  2FY8 A;  3EWK A;  4IFM A;  3MP7 B;  1SQX K;  2POH A;  2R3C A;  3B5N D;  3HE5 A;  3P8C E;  4R9J A;  2YKO A;  3CC2 P;  2KUB A;  2XNX C;  1PPJ G;  3H1L D;  2P2U A;  1T3U A;  3PTZ A;  1JB0 J;  3M91 A;  2E5Y A;  1JY2 N;  2JO1 A;  1HVV A;  2OYH A;  5KJ7 D;  3KXD A;  5CCG C;  2FFD B;  5CCH A;  1NTM J;  3II6 A;  1NTZ E;  1GD2 E;  2V4H A;  3EFG A;  1G1I A;  2E75 D;  1Q81 Q;  3S1K A;  4H44 B;  1K05 A;  2Y9Y A;  3FWN A;  2XKM A;  2BCC G;  1RQU A;  4JBZ A;  4WVZ A;  3RK3 D;  3VMA A;  1EZV E;  1IC2 A;  1HJ0 A;  1RF0 B;  1DEB A;  1VQ4 P;  2QJY C;  1PZQ A;  3BCC J;  2ITA A;  2YMY A;  2WPR A;  2QSI A;  5KKZ B;  1LTB C;  1VQ8 P;  4GOD A;  1NTK J;  2YMK A;  3L73 G;  2P67 A;  1URQ C;  2HG5 D;  1LT9 C;  1KIL D;  2Q5U A;  4H44 C;  4XE5 B;  2XND H;  5CCG A;  4NPD A;  5E79 H;  4AUW A;  3O6Q B;  5DJT B;  4Y99 B;  1RF0 C;  5APU A;  1P84 H;  1NAF A;  4U3F J;  3CXH H;  5KKZ C;  4PD4 H;  2QIW A;  3A5T A;  2IBZ I;  1NU1 E;  4EIJ A;  3L71 G;  2FFD A;  2OYO A;  1OVV A;  2GY7 A;  3H1H J;  3PP5 A;  1YI2 P;  1ZOY C;  1JY2 O;  5CJ0 A;  3SWF A;  2L5G B;  5APW A;  2PFX A;  1L0N G;  3AE2 C;  2QJK C;  3G9R A;  1SQQ J;  1FIB A;  1RE4 C;  1BCC G;  1RF0 A;  3FIB A;  3P32 A;  1S5L E;  3V5B A;  1K9M Q;  1IFP A;  4B86 A;  1J1E B;  4UB8 E;  3CPW O;  1N86 B;  3RBZ A;  4ASW A;  3SFE C;  2CPB A;  2R5D A;  3D6Y A;  2J61 B;  2HPC B;  1JY3 N;  1OX3 A;  2Y0C A;  5AW7 B;  3KQG A;  3CC4 P;  2Q6Q A;  2C9L Y;  4DZO A;  2HYN A;  3O6Q A;  1OMI A;  2ZVO B;  4EDF A;  5AW9 B;  2NRG A;  1OVU A;  2IFN A;  1MZ9 A;  1PGJ A;  2KNC B;  1NWQ A;  1N86 C;  2E5T A;  4W80 A;  1SQP E;  2GUV A;  4AYC A;  3L73 E;  1KYO I;  1AA0 A;  1VQ9 P;  2D39 A;  3BRV B;  4WY4 D;  3H25 A;  2WSF J;  3L70 E;  1H8A A;  1KQS O;  3CWB G;  1NTZ K;  1ZME C;  1G1J A;  3RL0 D;  2P58 A;  2OTJ P;  3BVH B;  1NKN A;  1JEK A;  1GW4 A;  3RL0 g;  4JYC A;  1NAY A;  2NPS D;  4YPC A;  2JP3 A;  3L72 J;  1CI6 B;  3JSV C;  1N86 A;  5CJ4 A;  3L71 E;  1SFC C;  2W27 A;  5BVZ A;  2J61 A;  1SQX J;  2HPC A;  3H1K G;  4JPZ B;  4PD4 D;  1Z56 A;  3VN0 A;  1SQV G;  5H2F H;  4H13 B;  2J58 A;  3BVH C;  1L0N E;  2DW3 A;  1VF5 B;  3G6E P;  1AFO A;  1JY3 O;  1EC5 A;  4OWF A;  3FGA D;  1GL2 C;  2KNC A;  2G3A A;  3QH9 A;  4XFJ A;  3SSU A;  2HLO B;  3B71 A;  4JYB A;  2M5A B;  3L75 J;  2IZ0 A;  3R2P A;  1N73 B;  1SS1 A;  2K37 A;  1M8O B;  3KYQ A;  3CCM P;  2E76 C;  1NU1 K;  2N9Y B;  4H13 C;  1BGY E;  1FS0 E;  1H89 A;  2AXC A;  1NTM D;  1VQ6 P;  1J1D B;  1PP9 G;  1OXZ A;  1JMB A;  2KZJ A;  3BVH A;  3V2P A;  1GMJ A;  3H1L G;  1Y47 A;  1MKM A;  2KLU A;  4UB6 H;  3L74 G;  2ZYG A;  2K9Y A;  1LTT C;  1N73 C;  1K73 Q;  1CI6 A;  2J0H A;  3BCC D;  2WSF H;  1U7J A;  3IR9 A;  1LT1 A;  1MV8 A;  2Q7C A;  3E7K A;  5CMZ A;  1EZV I;  1SQP D;  3S4R A;  2HOD B;  1RHZ B;  3A0H E;  1YJN P;  2NZ2 A;  4C7N B;  1AJY A;  3U1C A;  3AE1 C;  1FZC B;  5AW5 B;  1X0T A;  3CCQ P;  3L70 D;  4IL6 H;  1X79 B;  3AE4 C;  4U3F D;  3OA7 A;  2HLO A;  2IPP A;  2M5A A;  4TLF A;  3E1R A;  1N73 A;  3CD6 P;  3H6P A;  2JHH C;  3GMA A;  2WVR A;  1FZD A;  1SQP K;  1L4A D;  1USD A;  5TIS E;  4DT0 A;  2A45 G;  1EQ7 A;  2E74 D;  1N2D C;  1LJ2 A;  1FZC C;  3H1I D;  4PV1 D;  5B66 E;  4JQ0 D;  5AW6 B;  2QRX A;  2XDJ A;  3A0B E;  2JKV A;  1Q90 D;  3IFM A;  2W6A A;  1ZRT E;  2Z4E C;  3OAK A;  1LTJ B;  1BE3 G;  2FYN C;  3TGU J;  2N1T C;  3GHG B;  5KAI H;  1SLQ A;  2J3F A;  4D6T E;  1VQM P;  4R4M A;  5KAF E;  3GF7 A;  1Q7Y Q;  2HOD A;  3RGU A;  2E42 A;  4C7N A;  1FZC A;  5APS A;  3TYY A;  1OVR A;  2Y0E A;  3SFD C;  1HJB A;  1KD1 Q;  1L0N K;  3Q5R A;  1S5L X;  5KLV E;  1LTJ C;  3AEE C;  1LTS C;  1FC2 C;  4Z1M H;  2W83 C;  3R4Y A;  3CL3 D;  1LWU B;  1N7S D;  5C39 A;  5AVY B;  1VQO P;  2FYU G;  3GG2 A;  3TF5 A;  3FX0 A;  2OAR A;  3PHL A;  3HRN A;  3VMX A;  1KYO H;  3B8E B;  3E1I B;  2C0W A;  3CI9 A;  1NTZ J;  1XTC C;  3HD7 B;  2IYO A;  1QGK B;  3CX5 E;  1GZL A;  2IX7 C;  5AVR B;  1Y8A A;  2YIU C;  4RO0 A;  1FZB B;  4LC1 A;  3V2Q A;  2M3E A;  1EXJ A;  3AEF C;  1JC9 A;  1LTJ A;  3CCV P;  3I5C A;  2P1J A;  1OIP A;  3GHG A;  3L72 D;  1RQV A;  4WBA A;  3GW6 A;  1FZE B;  4PJ0 H;  1SQX D;  5APV A;  3NMD A;  4U7J A;  4I2L C;  1L0L E;  3HD7 C;  3BAT A;  3H1J E;  1ZR4 A;  1LP1 B;  1FZB C;  2IBZ D;  3KZI E;  2SPZ A;  3NFQ A;  2OYH C;  2A06 E;  2WPV B;  1LWU A;  3P8M C;  5K5G B;  1FZA B;  3MD0 A;  2WT7 B;  2R5B A;  5CCH C;  1URQ D;  3WUT A;  3L75 D;  3KDP B;  1ZRT D;  1JMM A;  1NU1 J;  4C7R A;  1KMI Z;  3AEC C;  3RK2 B;  1GW3 A;  3E1I A;  1OW8 A;  3EQ2 A;  4H0L B;  3HD7 A;  1FDM A;  1KQF B;  3I55 P;  1VQP P;  1FZB A;  2FXP A;  4M7H A;  2R3S A;  2YXQ B;  5KTB A;  1USE A;  1A02 F;  4JYO X;  4YTP C;  1FZE A;  2AEJ A;  3Q2Y A;  1K04 A;  3MGN A;  1SQB E;  1EDJ A;  3ITK A;  1NTM G;  1LP1 A;  4JF7 A;  3LIE A;  1KYO D;  2CPS A;  3WUV A;  3B5N B;  1VL2 A;  5KLV K;  4I7Z B;  3HUS B;  1FZA A;  2FFD C;  2WT7 A;  2I1J A;  2M0B A;  4MN4 C;  4OVN F;  2AEF A;  3BCC G;  1SQP J;  1ZXG A;  2WMM A;  3L73 J;  3VOP A;  2KB7 P;  1NTK G;  2QE7 H;  2K88 A;  3A7O A;  4EOT A;  1GK4 A;  1GDT A;  3L70 J;  1FID A;  1YBK A;  1HF9 A;  3CCU P;  3L37 A;  1S2E A;  1L0L D;  4RJT A;  3B5N C;  1HUC A;  4DCK A;  3L35 A;  3WMM 0;  2KK7 A;  5APY A;  3H1J D;  4N78 E;  4BRY B;  2XV5 A;  3CLQ A;  2E75 B;  4U3F G;  3TGU D;  3FWL A;  4EPU A;  3PJS K;  3H1I J;  2W6J H;  3MZW B;  1PPJ E;  3CXH E;  3RK3 B;  5GTI E;  4Y99 C;  1FBM A;  2AEM A;  2O01 J;  1L0L K;  4LGD E;  2Z5H A;  3P8C D;  2ZJS E;  1W2E A;  3H1H G;  4ASV A;  1L0N J;  2C9N Y;  1AVY A;  1A02 J;  2H7H A;  2KSJ A;  4UB8 H;  1BDC A;  1VDF A;  1DD4 A;  4BWN A;  1FJK A;  3B5N A;  2ZVN B;  3HUS A;  1HGV A;  2E75 C;  1SFC D;  1KIL B;  1SQQ G;  3TNU B;  1OFC X;  1JCD A;  5AVU B;  1GU5 A;  3KPE A;  3RK3 C;  4EI2 A;  2WZ7 A;  1AV1 A;  2YXR B;  3C8V A;  4NYT A;  2GUS A;  1VQ7 P;  3FXE A;  3ABV C;  2BCC E;  3LW5 J;  1KFN A;  5DJU B;  5AW0 B;  1BGY J;  1J2J B;  1LGH B;  3LID A;  1YJ9 P;  1NTZ D;  1T2K C;  1GL2 D;  2OTK E;  1J1E C;  5KLI B;  2K9J A;  5KJ7 A;  1KIL C;  4ZFG A;  5AVQ B;  2KXP B;  4BRY A;  2HPC C;  1EZV D;  4OH8 B;  2PP6 A;  2E76 D;  1N7L A;  1NJI Q;  1MFT A;  3CX5 I;  2AXT H;  2ZFC A;  3M0A A;  4L74 A;  1PFI A;  1SQB K;  1PGP A;  1GTW A;  4OGQ D;  5BU8 B;  2IFM A;  3S9O A;  1NHL A;  1CW5 A;  1G2C B;  1VQK P;  1KIL A;  2YO3 A;  3TNU A;  4RKU J;  3G71 P;  1IFM A;  1T3J A;  2J1G A;  4R9T A;  2O01 H;  1JY2 P;  3MIW A;  2W6B A;  3L72 G;  5GTH H;  1TU3 F;  3CME P;  1SVF A;  3WUU A;  5AW4 B;  1NU1 D;  2P10 A;  2D2C D;  1SQX G;  3RBX A;  2B89 A;  1PGO A;  1BCC E;  1WT6 A;  2B87 B;  2LR2 A;  3CCL P;  2J60 A;  1SP4 A;  2IBZ G;  2J3G A;  4WY4 B;  1SQQ E;  2KSE A;  3HE4 B;  5M1B A;  1OWA A;  2KOG A;  3RL0 B;  3CC7 P;  2QJP B;  3L75 G;  1VF5 C;  4D6T J;  1UII A;  2RKL A;  1ZP0 C;  2KS1 B;  4IFD K;  2NPS B;  4K35 A;  2WTY A;  3U1A A;  2HLO C;  5B5E E;  5BU5 A;  2QEX P;  2BCC D;  3SWK A;  2N1T D;  2ZT9 D;  5KLV J;  1G2C A;  2OYI B;  1KB9 E;  2H89 C;  1KC8 Q;  1JTH B;  2QJP C;  2J5U A;  2QA4 P;  1CZQ A;  3CWB E;  1J1D C;  1VQL P;  2JHL F;  3L73 D;  1YJW P;  1Q2N A;  2NPS C;  1T8Z A;  3AE8 C;  2G8Y A;  1AQT A;  2ZXX A;  3CCS P;  1FZF B;  3ZDM A;  3Q5S A;  4GIF A;  2B87 A;  1VQ5 P;  1YHQ P;  2WSC J;  4HB1 A;  1NO4 A;  3V2N A;  2BEZ F;  3IF4 A;  2C0X A;  4WY4 A;  1LTA C;  2B88 A;  1W2B O;  1MUU A;  2RN0 A;  2W90 A;  3H1K E;  1FIC A;  3HE4 A;  4W7Z A;  2HOD C;  1SQV E;  1OW6 A;  3CMA P;  5APT A;  1EDL A;  3L71 D;  3VP9 A;  5B66 H;  1M7L A;  2WNP F;  1JY3 P;  2KS1 A;  2Q9I B;  1M57 D;  3A0B H;  1L0L J;  2NPS A;  2JWA A;  3H1J J;  1JNM A;  1IO4 A;  3AEB C;  3MHV A;  1L0N D;  2YNY A;  1WMK A;  2OYI A;  3QWO C;  1E5W A;  3N7N A;  3TK1 A;  1JUN A;  1JTH A;  5KAF H;  2FXM A;  2HR3 A;  3TGU G;  1KQL A;  1PP9 E;  2Q9I C;  1X22 A;  1IFI A;  1LNQ A;  3H1L E;  1FZF A;  1BGY D;  2IDB A;  3L74 E;  1DX7 A;  3WU2 E;  3HTK B;  2LKM A;  3IAO A;  5AVS B;  3GHG C;  2Q3I A;  1L4A B;  2QG4 A;  1MFZ A;  5CCH D;  2E74 B;  1Y9B A;  4ZMD A;  1H0T B;  2JWD A;  3CCE P;  1FOS E;  3H32 B;  4PV1 B;  2Z5I A;  4ZNC A;  2CK3 H;  4I1L A;  3KHU A;  4GDO A;  5L8R J;  5AVX B;  2ZYA A;  2WSC H;  3PRJ A;  3CX5 H;  2Q9I A;  1M1J B;  1SQB J;  4L76 A;  2Y0D A;  2BEQ D;  1UIX A;  5CBN A;  1LWU C;  3P7K A;  3G4S P;  3RK3 E;  1NTZ G;  5TJH A;  2J64 A;  3M9B A;  3VMZ A;  3H32 C;  3AE6 C;  1IFJ A;  5CCG D;  3C1L A;  1KV4 A;  3I56 P;  3T97 B;  1EZV G;  3JCU E;  3CCR P;  3E1I C;  1ZN5 A;  4RES B;  2QVA A;  1D7M A;  1JCC A;  1KIL E;  1M1J C;  3H1K D;  4EYY Q;  1KZU B;  1N7S B;  1SQV D;  1X9V A;  3KZI H;  2MKV A;  3M9Q A;  2LXB A;  2RMZ A;  3HTK A;  1BE3 E;  1QEX A;  1L4A A;  2M8R A;  2XNX B;  2J3U A;  1FZE C;  1H0T A;  3H32 A;  4H44 D;  1ZLL A;  2HFE D;  1S9K E;  1XTG B;  1AQ5 A;  1OZH A;  1SQV K;  3M06 A;  1N7S C;  3EFF K;  4D6T D;  5AW3 B;  4ZKU A;  1M1J A;  1NU1 G;  2MJZ A;  1OW7 A;  1LTI C;  1E79 H;  1PP9 D;  1FZA C;  1GK6 A;  1EDI A;  2FYU E;  2WSS H;  4GOE A;  4LLH A;  2FXO A;  1JOC A;  1LTG C;  3NTN A;  3L74 D;  5KLV D;  4BXL A;  2FKW B;  1PIX A;  2J2P A;  3T97 A;  3MTU E;  3RK2 C;  3F89 A;  1R8E A;  4XA4 A;  2QJY B;  2H8P D;  4H0L C;  2KIK A;  3M9H A;  1FAV A;  1YQ4 C;  1N7S A;  1KQG B;  1PV3 A;  1KB9 I;  2BCC J;  1FZG B;  4HYT B;  1NYH A;  1JO5 A;  1URQ B;  2JHI F;  5AW8 B;  1LT9 B;  3N4X A;  1DD3 A;  3CX5 D;  2XNX A;  1HWT C;  2FBW C;  4DOJ A;  1FE6 A;  2N9B A;  2J5Z A;  2GA1 A;  2OTL P;  2QM8 A;  2YO2 A;  4Y28 J;  1K8A Q;  1T2K D;  1SQP G;  1FZG C;  5CBO A;  2KP8 A;  2XU6 A;  2K9J B;  1Z3U A;  1BSH A;  4I7Z C;  3HUS C;  1Q86 Q;  3AED C;  3L70 G;  1N8R Q;  5E79 E;  1QVG O;  1X8Y A;  2K3R A;  1BE3 D;  4IL6 X;  5APQ A;  4A7P A;  2QJK B;  2A06 D;  3L71 J;  1P84 E;  4L73 A;  5GTI H;  3Q5P A;  1RE4 B;  4PD4 E;  5AW1 B;  1PGQ A;  4CPG A;  3NXS A;  3O8Z A;  3H1I G;  4DJG A;  2L91 A;  5KJ7 C;  1S9K D;  2KLV A;  1S5L H;  1FZG A;  4TT3 H;  2KZI A;  1URQ A;  1FDI A;  1LT9 A;  1BCC J;  1L2P A;  5AVT B;  1JM0 A;  3GF3 A;  1HBW A;  1QX8 A;  1QL1 A;  1RH5 B;  1IFN A;  1RE3 B;  5AW2 B;  2O1K A;  2JHK F;  1BSN A;  2OQQ A;  2FYU D;  2E43 A;  3VYI A;  2WPQ A;  4N6J A;  1S1C X;  1NTM E;  3OJA B;  4M7F A;  1SQB D;  5EFW B;  3W68 A;  1M1K Q;  2FYZ A;  3IN6 A;  2IYP A;  1IK7 A;  1KN7 A;  1NH4 A;  4YXD C;  1BGY G;  2M3B A;  1QVF O;  1RE3 C;  3BCC E;  2FYU K;  1KFM A;  2YKP A;  1CSB A;  4H13 D;  2O3J A;  1QL2 A;  4WWI A;  1NTK E;  1VF5 D;  1RE4 A;  1IZN B;  1H88 A;  1DIP A;  1KOR A;  3CWB J;  3AE9 C;  4WB4 A;  2OGU A;  3JC2 2;  1HGZ A;  1FOS F;  5KLI C;  1NGM B;  1WRG A;  3Q1M A;  1SFC B;  3Q3D A;  2A45 I;  3L4F A;  3G3Z A;  4U3F E;  2AXT E;  2V7Q J;  1GU4 A;  2J59 M;  4HH2 A;  1RE3 A;  3MUD C;  3D6Z A;  2O1J A;  2WQY C;  4N78 D;  3H1K J;  1GL2 B;  2JR8 A;  1SQV J;  2JEE A;  3H1I E;  3AEG C;  4JZC A;  4KT0 J;  1KTM A;  2PGD A;  3H1H E;  1P84 D;  2B9B A;  2I1K A;  1U7M A;  2PRR A;  3V6I A;  4IFF A;  1PPJ D;  3CXH D;  2E76 B;  5GTH E;  2XZR A;  2J3F D;  5H2F E;  3V2R A;  1U57 A;  1Z3S A;  3LW5 H;  2ZYD A;  4HJG H;  2YKQ A;  3MUD A;  1M56 D;  4OGQ B;  1ZR2 A;  1YQ3 C;  1NKZ B;  2J0Y A;  4GKG A;  1YIT P;  1PP9 J;  1R5L A;  5B5E H;  5AVZ B;  4NPF X;  1SFC A;  4D6T G;  2VRS A;  2K1A A;  3H1L J;  4WY4 C;  1R5S A;  5AVV B;  2LXC B;  2ZAE B;  1KB9 H;  4IOI H;  3L74 J;  3F5H A;  2RH0 A;  3AEA C;  3PLN A;  2ZXE B;  4W7Y A;  1S4X A;  2JHM F;  1YTZ I;  3RL0 C;  1RF1 B;  2D2C B;  4R4L A;  4K3A A;  3BAS A;  4NPE A;  3A0H H;  4OGQ C;  5KLV G;  3TDK A;  4UB6 E;  1GL2 A;  1T6A A;  2PAJ A;  4GOF A;  1NOH A;  1S3J A;  1NTK D;  3M0D C;  1RY3 A;  1NTM K;  2R32 A;  1FJP A;  2V7Q H;  4HKZ H; 
#chains in the Genus database with same CATH homology
 3BRV B;  4WY4 D;  3VMZ A;  2OYI C;  3H32 C;  2I1J A;  1IFJ A;  5CCG D;  1H8A A;  1RF1 C;  3VOP A;  1NTZ K;  2KB7 P;  4I6M C;  1G1J A;  3RL0 D;  3A7O A;  3E1I C;  1ZN5 A;  4RES B;  4EOT A;  1HTL C;  1GK4 A;  3BVH B;  3SWY A;  1GDT A;  1JCC A;  1NKN A;  1FID A;  1FU1 A;  1M1J C;  1KZU B;  3UIA A;  1FZF C;  1GW4 A;  3L37 A;  1NTK K;  4N3Y B;  4JYC A;  1N7S B;  2NPS D;  2FIB A;  3B5N C;  2Z4E B;  1X9V A;  1HUC A;  1CI6 B;  3M9Q A;  3L35 A;  5APX A;  3A2A A;  3WMM 0;  1N86 A;  2N1T B;  5CJ4 A;  4GT1 A;  5APY A;  1SFC C;  2W27 A;  3HTK A;  4N78 E;  5BVZ A;  2J61 A;  2XV5 A;  2HPC A;  1L4A A;  3M0D A;  3V4W A;  3CLQ A;  5CHX A;  2WPS A;  4EPU A;  2M8R A;  2XNX B;  1Z56 A;  2J3U A;  1FZE C;  3VN0 A;  3H32 A;  2J58 A;  3RK3 B;  3BVH C;  1RF1 A;  1ZLL A;  2HFE D;  1S9K E;  1XTG B;  1AQ5 A;  4Y99 C;  1FBM A;  3TSI A;  2J0G A;  2JJL A;  1AFO A;  1L0L K;  1JY3 O;  1SQV K;  4LGD E;  2Z5H A;  2KYV A;  3HD7 D;  3M06 A;  3P8C D;  1YTZ T;  1N7S C;  4KHX A;  1GL2 C;  1W2E A;  5AW3 B;  4ZKU A;  2C9N Y;  1A02 J;  1M1J A;  2H7H A;  2KSJ A;  3A3Y B;  2HLO B;  2MJZ A;  4JYB A;  1VDF A;  1LTI C;  1IK9 A;  1FJK A;  3R2P A;  3B5N A;  1N73 B;  2GM4 A;  5AVW B;  3HUS A;  1HGV A;  1FZA C;  1SFC D;  1KIL B;  1GK6 A;  3KYQ A;  2J3O A;  3TNU B;  2J64 A;  1NU1 K;  1JCD A;  3L36 A;  4LLH A;  1JOC A;  1LTG C;  3NTN A;  3KPE A;  5AVU B;  4O9B A;  1GU5 A;  1H89 A;  3RK3 C;  2FKW B;  2WZ7 A;  2J2P A;  1J1D B;  4AQR D;  1SQQ K;  4NYT A;  3T97 A;  1ZV8 A;  3MTU E;  3RK2 C;  1OXZ A;  2GUS A;  3BVH A;  3V2P A;  1KFN A;  4XA4 A;  5AW0 B;  1J2J B;  2H8P D;  1LGH B;  3LID A;  2QM7 A;  1DH3 A;  3M9H A;  1T2K C;  2H43 B;  3VP8 A;  1GL2 D;  3U59 A;  1FAV A;  1IFD A;  1J1E C;  1N7S A;  1LTT C;  2Z4E A;  5KJ7 A;  1N73 C;  1CI6 A;  2J0H A;  1FZG B;  1KIL C;  2WSF H;  4HYT B;  2N1T A;  4ZFG A;  1JO5 A;  1URQ B;  5AVQ B;  2JHI F;  3HE5 B;  5AW8 B;  1LT9 B;  1VPC A;  3IR9 A;  2HPC C;  1MV8 A;  1L4A C;  4OH8 B;  2PP6 A;  3N4X A;  2Q7C A;  5CMZ A;  2XNX A;  1HWT C;  1N7L A;  2HOD B;  2A45 H;  4DOJ A;  4C7N B;  3U1C A;  1FZC B;  5AW5 B;  2N9B A;  1YYC A;  2ZFC A;  3RK2 D;  2J5Z A;  3M0A A;  2H43 C;  1PFI A;  1SQB K;  1X79 B;  2QM8 A;  2YO2 A;  1GTW A;  1T2K D;  2OYH B;  1FZG C;  3OA7 A;  2HLO A;  5BU8 B;  2KP8 A;  2IFM A;  2IPP A;  2XU6 A;  1IJD B;  4ZKP A;  4C46 A;  1Z3U A;  1N73 A;  3H6P A;  3HUS C;  2JHH C;  1NHL A;  1CW5 A;  1G2C B;  1KIL A;  2YO3 A;  1FZD A;  1SQP K;  2WIT A;  3TNU A;  1L4A D;  2BAS A;  2A45 G;  1EQ7 A;  1X8Y A;  2WSE H;  2P7J A;  1N2D C;  1IFM A;  3VMY A;  1T3J A;  2J1G A;  4R9T A;  2O01 H;  1JY2 P;  1FZC C;  3MIW A;  2W6B A;  3VTP C;  5APQ A;  1SVF A;  2WWW A;  5AW4 B;  3BRT B;  5AW6 B;  4M3L A;  1RE4 B;  3V4Q A;  2XDJ A;  5AW1 B;  1HH0 A;  3C9I A;  1WT6 A;  2H43 A;  3IFM A;  2W6A A;  3NXS A;  3O8Z A;  2Z4E C;  3OAK A;  1LTJ B;  5KJ7 C;  1S9K D;  2J60 A;  2KLV A;  4IFM A;  1SQX K;  1SP4 A;  2N1T C;  2POH A;  1FZG A;  3GHG B;  2J3G A;  2R3C A;  4WY4 B;  1URQ A;  3B5N D;  3HE5 A;  1SLQ A;  1LT9 A;  3P8C E;  4R9J A;  5AVT B;  2J3F A;  2YKO A;  1HBW A;  3HE4 B;  1OWA A;  2XNX C;  1QL1 A;  2KOG A;  2P2U A;  1T3U A;  3RL0 B;  2HOD A;  2E42 A;  1IFN A;  1RE3 B;  5AW2 B;  4C7N A;  1FZC A;  5APS A;  3TYY A;  2O1K A;  2JHK F;  2E43 A;  3VYI A;  2WPQ A;  1HJB A;  1L0N K;  4IFD K;  4N6J A;  2NPS B;  3M91 A;  1JY2 N;  1LTJ C;  1LTS C;  2WTY A;  1HVV A;  2OYH A;  3U1A A;  2HLO C;  3CL3 D;  3OJA B;  1LWU B;  1N7S D;  5KJ7 D;  5BU5 A;  5AVY B;  4M7F A;  2N1T D;  5CCG C;  2FFD B;  2FYZ A;  5CCH A;  1G2C A;  3II6 A;  2OYI B;  1GD2 E;  1NH4 A;  2OAR A;  3EFG A;  1G1I A;  2M3B A;  1JTH B;  3HRN A;  3VMX A;  3B8E B;  1RE3 C;  1CZQ A;  2FYU K;  2YKP A;  1KFM A;  2XKM A;  3E1I B;  1J1D C;  1CSB A;  2C0W A;  3CI9 A;  1QL2 A;  2JHL F;  1XTC C;  3RK3 D;  1IC2 A;  3HD7 B;  2NPS C;  1T8Z A;  1RF0 B;  1RE4 A;  1DEB A;  1H88 A;  1GZL A;  1FZF B;  2YMY A;  2IX7 C;  2WPR A;  5AVR B;  4WB4 A;  4GIF A;  1FZB B;  4LC1 A;  3V2Q A;  1HGZ A;  1LTB C;  1FOS F;  1JC9 A;  1LTJ A;  1WRG A;  3V2N A;  1NO4 A;  1SFC B;  3I5C A;  2P1J A;  2P67 A;  3GHG A;  1URQ C;  2C0X A;  4WY4 A;  1LTA C;  2A45 I;  2HG5 D;  1LT9 C;  1MUU A;  1KIL D;  2Q5U A;  3L4F A;  4XE5 B;  4WBA A;  5CCG A;  3G3Z A;  1FZE B;  1FIC A;  5APV A;  3HE4 A;  3NMD A;  4AUW A;  4W7Z A;  1GU4 A;  2J59 M;  4I2L C;  2HOD C;  4HH2 A;  3HD7 C;  4Y99 B;  5APT A;  1RE3 A;  1RF0 C;  5APU A;  2O1J A;  3VP9 A;  3BAT A;  1NAF A;  4N78 D;  1M7L A;  2WNP F;  1JY3 P;  1ZR4 A;  1GL2 B;  1FZB C;  2Q9I B;  3A5T A;  2NPS A;  2JEE A;  4JZC A;  3NFQ A;  2OYH C;  2I1K A;  1LWU A;  4IFF A;  4EIJ A;  1JNM A;  1IO4 A;  3P8M C;  1FZA B;  3MD0 A;  2WT7 B;  2R5B A;  5CCH C;  2YNY A;  2FFD A;  1URQ D;  2OYI A;  1E5W A;  2XZR A;  3N7N A;  2J3F D;  2GY7 A;  3TK1 A;  3KDP B;  1JUN A;  1JMM A;  3PP5 A;  3V2R A;  4C7R A;  1JY2 O;  1JTH A;  5CJ0 A;  3SWF A;  2FXM A;  2L5G B;  5APW A;  3RK2 B;  1Z3S A;  1GW3 A;  3E1I A;  3LW5 H;  1KQL A;  3EQ2 A;  2Q9I C;  3HD7 A;  1FIB A;  1RE4 C;  2YKQ A;  3MUD A;  1RF0 A;  1FDM A;  3FIB A;  3P32 A;  3V5B A;  1IFI A;  1FZF A;  4B86 A;  1J1E B;  1ZR2 A;  1NKZ B;  1FZB A;  2J0Y A;  4GKG A;  4M7H A;  1DX7 A;  1N86 B;  2CPB A;  2R5D A;  5AVZ B;  3HTK B;  1SFC A;  2LKM A;  5KTB A;  1A02 F;  2J61 B;  4JYO X;  3GHG C;  2Q3I A;  1JY3 N;  1L4A B;  2VRS A;  5AVS B;  4WY4 C;  2HPC B;  1MFZ A;  5CCH D;  5AVV B;  5AW7 B;  3KQG A;  1FZE A;  1FOS E;  3H32 B;  2C9L Y;  4DZO A;  2ZXE B;  2HYN A;  4W7Y A;  2JHM F;  2Z5I A;  1YTZ I;  3RL0 C;  1RF1 B;  3MGN A;  4I1L A;  5AW9 B;  3BAS A;  5AVX B;  2WSC H;  2IFN A;  1MZ9 A;  1GL2 A;  2Q9I A;  2PAJ A;  1M1J B;  1NOH A;  4JF7 A;  1NWQ A;  1N86 C;  3LIE A;  4W80 A;  2CPS A;  3B5N B;  1LWU C;  3P7K A;  5KLV K;  2GUV A;  1RY3 A;  3M0D C;  4AYC A;  3HUS B;  1NTM K;  2R32 A;  1FZA A;  1FJP A;  2D39 A;  2FFD C;  2WT7 A;  3M9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...