3FIBA

Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound to calcium at ph 6.0: a further refinement of pdb entry 1fib, and differs from 1fib by the modelling of a cis peptide bond between residues k338 and c339
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
249
structure length
249
Chain Sequence
QIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN GAMMA CHAIN RESIDUES
publication title The primary fibrin polymerization pocket: three-dimensional structure of a 30-kDa C-terminal gamma chain fragment complexed with the peptide Gly-Pro-Arg-Pro.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood coagulation
total genus 79
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 1997-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3fibA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3fibA02
2J60A 3E1IC 2OYHB 4EPUA 1FZCC 2J0HA 4R9TA 2FFDC 2J3FD 1Z3SA 1FZFC 1RE3C 1LTJC 2HLOB 1FIBA 1N73B 1RF1B 1M1JC 2J0YA 4ZFGA 4M7FA 2OYHC 1RF0B 3HUSB 1LWUB 4R9JA 2HLOC 1N73C 3BVHB 1FZAB 2J0GA 1RF1C 1N86C 1Z3UA 2HPCC 2J61B 2J5ZA 1FZEB 2J2PA 2J64A 2H43B 2WNPF 3GHGC 2D39A 2J3GA 4NYTA 2Q9IB 3BVHC 1FZAC 2JHHC 2J3UA 2JHKF 2JHLF 1FZGB 1FZEC 2OYIB 2Z4EB 2JHMF 1FIDA 2XNXB 2H43C 1RE4B 4JZCA 1LT9B 1FZBB 2Q9IC 4M7HA 1RF0C 1JC9A 3HUSC 1LWUC 1FZGC 1M1JB 2Z4EC 2J61A 3H32B 1RE4C 1LT9C 2HODB 1FICA 1FZBC 1FZDA 2J1GA 2J3FA 3FIBA 3E1IB 1FZCB 2J3OA 2FFDB 2FIBA 2GY7A 1N86B 1FZFB 2HPCB 1RE3B 3H32C 1LTJB 2JHIF 2HODC 2OYIC 4JYOX 2XNXC
chains in the Genus database with same CATH superfamily
2J60A 3E1IC 2OYHB 4EPUA 1FZCC 2J0HA 4R9TA 2FFDC 2J3FD 1Z3SA 1FZFC 1RE3C 1LTJC 2HLOB 1FIBA 1N73B 1RF1B 1M1JC 2J0YA 4ZFGA 4M7FA 2OYHC 1RF0B 3GHGB 3HUSB 1LWUB 4R9JA 2HLOC 1N73C 3BVHB 1FZAB 2J0GA 1RF1C 1N86C 1Z3UA 2HPCC 2J61B 2J5ZA 1FZEB 2J2PA 2J64A 2H43B 2WNPF 3GHGC 2D39A 2J3GA 4NYTA 2Q9IB 3BVHC 1FZAC 2JHHC 2J3UA 2JHKF 2JHLF 1FZGB 1FZEC 2OYIB 2Z4EB 2JHMF 1FIDA 2XNXB 2H43C 1RE4B 4JZCA 1LT9B 1FZBB 2Q9IC 4M7HA 1RF0C 1JC9A 3HUSC 1LWUC 1FZGC 1M1JB 2Z4EC 2J61A 3H32B 1RE4C 1LT9C 2HODB 1FICA 1FZBC 1FZDA 2J1GA 2J3FA 3FIBA 3E1IB 1FZCB 2J3OA 2FFDB 2FIBA 2GY7A 1N86B 1FZFB 2HPCB 1RE3B 3H32C 1LTJB 2JHIF 2HODC 2OYIC 4JYOX 2XNXC
chains in the Genus database with same CATH topology
2J60A 3E1IC 2OYHB 4EPUA 1FZCC 2J0HA 4R9TA 2FFDC 2J3FD 1Z3SA 1FZFC 1RE3C 1LTJC 2HLOB 1FIBA 1N73B 1RF1B 1M1JC 2J0YA 4ZFGA 4M7FA 2OYHC 1RF0B 3HUSB 1LWUB 4R9JA 2HLOC 1N73C 3BVHB 1FZAB 2J0GA 1RF1C 1N86C 1Z3UA 2HPCC 2J61B 2J5ZA 1FZEB 2J2PA 2J64A 2H43B 2WNPF 3GHGC 2D39A 2J3GA 4NYTA 2Q9IB 3BVHC 1FZAC 2JHHC 2J3UA 2JHKF 2JHLF 1FZGB 1FZEC 2OYIB 2Z4EB 2JHMF 1FIDA 2XNXB 2H43C 1RE4B 4JZCA 1LT9B 1FZBB 2Q9IC 4M7HA 1RF0C 1JC9A 3HUSC 1LWUC 1FZGC 1M1JB 2Z4EC 2J61A 3H32B 1RE4C 1LT9C 2HODB 1FICA 1FZBC 1FZDA 2J1GA 2J3FA 3FIBA 3E1IB 1FZCB 2J3OA 2FFDB 2FIBA 2GY7A 1N86B 1FZFB 2HPCB 1RE3B 3H32C 1LTJB 2JHIF 2HODC 2OYIC 4JYOX 2XNXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J60 A;  3E1I C;  2OYH B;  4EPU A;  1FZC C;  2J0H A;  4R9T A;  2FFD C;  2J3F D;  1Z3S A;  1FZF C;  1RE3 C;  1LTJ C;  2HLO B;  1FIB A;  1N73 B;  1RF1 B;  1M1J C;  2J0Y A;  4ZFG A;  4M7F A;  2OYH C;  1RF0 B;  3HUS B;  1LWU B;  4R9J A;  2HLO C;  1N73 C;  3BVH B;  1FZA B;  2J0G A;  1RF1 C;  1N86 C;  1Z3U A;  2HPC C;  2J61 B;  2J5Z A;  1FZE B;  2J2P A;  2J64 A;  2H43 B;  2WNP F;  3GHG C;  2D39 A;  2J3G A;  4NYT A;  2Q9I B;  3BVH C;  1FZA C;  2JHH C;  2J3U A;  2JHK F;  2JHL F;  1FZG B;  1FZE C;  2OYI B;  2Z4E B;  2JHM F;  1FID A;  2XNX B;  2H43 C;  1RE4 B;  4JZC A;  1LT9 B;  1FZB B;  2Q9I C;  4M7H A;  1RF0 C;  1JC9 A;  3HUS C;  1LWU C;  1FZG C;  1M1J B;  2Z4E C;  2J61 A;  3H32 B;  1RE4 C;  1LT9 C;  2HOD B;  1FIC A;  1FZB C;  1FZD A;  2J1G A;  2J3F A;  3FIB A;  3E1I B;  1FZC B;  2J3O A;  2FFD B;  2FIB A;  2GY7 A;  1N86 B;  1FZF B;  2HPC B;  1RE3 B;  3H32 C;  1LTJ B;  2JHI F;  2HOD C;  2OYI C;  4JYO X;  2XNX C; 
#chains in the Genus database with same CATH topology
 2J60 A;  3E1I C;  2OYH B;  4EPU A;  1FZC C;  2J0H A;  4R9T A;  2FFD C;  2J3F D;  1Z3S A;  1FZF C;  1RE3 C;  1LTJ C;  2HLO B;  1FIB A;  1N73 B;  1RF1 B;  1M1J C;  2J0Y A;  4ZFG A;  4M7F A;  2OYH C;  1RF0 B;  3GHG B;  3HUS B;  1LWU B;  4R9J A;  2HLO C;  1N73 C;  3BVH B;  1FZA B;  2J0G A;  1RF1 C;  1N86 C;  1Z3U A;  2HPC C;  2J61 B;  2J5Z A;  1FZE B;  2J2P A;  2J64 A;  2H43 B;  2WNP F;  3GHG C;  2D39 A;  2J3G A;  4NYT A;  2Q9I B;  3BVH C;  1FZA C;  2JHH C;  2J3U A;  2JHK F;  2JHL F;  1FZG B;  1FZE C;  2OYI B;  2Z4E B;  2JHM F;  1FID A;  2XNX B;  2H43 C;  1RE4 B;  4JZC A;  1LT9 B;  1FZB B;  2Q9I C;  4M7H A;  1RF0 C;  1JC9 A;  3HUS C;  1LWU C;  1FZG C;  1M1J B;  2Z4E C;  2J61 A;  3H32 B;  1RE4 C;  1LT9 C;  2HOD B;  1FIC A;  1FZB C;  1FZD A;  2J1G A;  2J3F A;  3FIB A;  3E1I B;  1FZC B;  2J3O A;  2FFD B;  2FIB A;  2GY7 A;  1N86 B;  1FZF B;  2HPC B;  1RE3 B;  3H32 C;  1LTJ B;  2JHI F;  2HOD C;  2OYI C;  4JYO X;  2XNX C; 
#chains in the Genus database with same CATH homology
 2J60 A;  3E1I C;  2OYH B;  4EPU A;  1FZC C;  2J0H A;  4R9T A;  2FFD C;  2J3F D;  1Z3S A;  1FZF C;  1RE3 C;  1LTJ C;  2HLO B;  1FIB A;  1N73 B;  1RF1 B;  1M1J C;  2J0Y A;  4ZFG A;  4M7F A;  2OYH C;  1RF0 B;  3HUS B;  1LWU B;  4R9J A;  2HLO C;  1N73 C;  3BVH B;  1FZA B;  2J0G A;  1RF1 C;  1N86 C;  1Z3U A;  2HPC C;  2J61 B;  2J5Z A;  1FZE B;  2J2P A;  2J64 A;  2H43 B;  2WNP F;  3GHG C;  2D39 A;  2J3G A;  4NYT A;  2Q9I B;  3BVH C;  1FZA C;  2JHH C;  2J3U A;  2JHK F;  2JHL F;  1FZG B;  1FZE C;  2OYI B;  2Z4E B;  2JHM F;  1FID A;  2XNX B;  2H43 C;  1RE4 B;  4JZC A;  1LT9 B;  1FZB B;  2Q9I C;  4M7H A;  1RF0 C;  1JC9 A;  3HUS C;  1LWU C;  1FZG C;  1M1J B;  2Z4E C;  2J61 A;  3H32 B;  1RE4 C;  1LT9 C;  2HOD B;  1FIC A;  1FZB C;  1FZD A;  2J1G A;  2J3F A;  3FIB A;  3E1I B;  1FZC B;  2J3O A;  2FFD B;  2FIB A;  2GY7 A;  1N86 B;  1FZF B;  2HPC B;  1RE3 B;  3H32 C;  1LTJ B;  2JHI F;  2HOD C;  2OYI C;  4JYO X;  2XNX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...