2H43B

Crystal structure of human fragment d complexed with ala-his-arg-pro-amide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
302
structure length
302
Chain Sequence
VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Differences in Binding Specificity for the Homologous gamma- and beta-Chain "Holes" on Fibrinogen: Exclusive Binding of Ala-His-Arg-Pro-amide by the beta-Chain Hole.
pubmed doi rcsb
total genus 88
structure length 302
sequence length 302
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2h43B01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2h43B02
2HODB 2HPCB 2FFDB 2OYIC 2FIBA 1FZFC 2OYHB 2Q9IC 2XNXB 1FZEC 4M7FA 3E1IB 2HLOB 2Q9IB 1FZDA 2J64A 1N73B 2Z4EC 2J5ZA 2J3OA 3BVHC 1N86C 2J0HA 1LT9C 1M1JC 2JHIF 2GY7A 2JHKF 2J0GA 2J3GA 3HUSB 2Z4EB 2J1GA 1FZGC 1RE3C 1LT9B 1M1JB 1RF0C 1JC9A 1FZBC 1RF1C 1RE4C 4M7HA 1LTJC 1FZAC 4ZFGA 1Z3SA 2J2PA 2OYIB 2OYHC 2J3FA 1FZFB 1FICA 3H32C 2H43C 1FZEB 2FFDC 1FIBA 2J3UA 1LWUC 1RF0B 1FZBB 1FIDA 2WNPF 1RF1B 1RE4B 4EPUA 3BVHB 1N86B 2JHHC 1FZCC 1FZAB 3FIBA 4JZCA 3E1IC 2HLOC 2JHMF 2J60A 3H32B 2H43B 4R9TA 2J61A 4JYOX 2HODC 1LWUB 2J61B 2HPCC 1FZGB 2D39A 1RE3B 1FZCB 2XNXC 3HUSC 3GHGC 4R9JA 1LTJB 4NYTA 2JHLF 2J0YA 1Z3UA 2J3FD 1N73C
chains in the Genus database with same CATH superfamily
2HODB 2HPCB 2FFDB 2OYIC 2FIBA 1FZFC 2OYHB 2Q9IC 2XNXB 1FZEC 3GHGB 4M7FA 3E1IB 2HLOB 2Q9IB 1FZDA 2J64A 1N73B 2Z4EC 2J5ZA 2J3OA 3BVHC 1N86C 2J0HA 1LT9C 1M1JC 2JHIF 2GY7A 2JHKF 2J0GA 2J3GA 3HUSB 2Z4EB 2J1GA 1FZGC 1RE3C 1LT9B 1M1JB 1RF0C 1JC9A 1FZBC 1RF1C 1RE4C 4M7HA 1LTJC 1FZAC 4ZFGA 1Z3SA 2J2PA 2OYIB 2OYHC 2J3FA 1FZFB 1FICA 3H32C 2H43C 1FZEB 2FFDC 1FIBA 2J3UA 1LWUC 1RF0B 1FZBB 1FIDA 2WNPF 1RF1B 1RE4B 4EPUA 3BVHB 1N86B 2JHHC 1FZCC 1FZAB 3FIBA 4JZCA 3E1IC 2HLOC 2JHMF 2J60A 3H32B 2H43B 4R9TA 2J61A 4JYOX 2HODC 1LWUB 2J61B 2HPCC 1FZGB 2D39A 1RE3B 1FZCB 2XNXC 3HUSC 3GHGC 4R9JA 1LTJB 4NYTA 2JHLF 2J0YA 1Z3UA 2J3FD 1N73C
chains in the Genus database with same CATH topology
2HODB 2HPCB 2FFDB 2OYIC 2FIBA 1FZFC 2OYHB 2Q9IC 2XNXB 1FZEC 4M7FA 3E1IB 2HLOB 2Q9IB 1FZDA 2J64A 1N73B 2Z4EC 2J5ZA 2J3OA 3BVHC 1N86C 2J0HA 1LT9C 1M1JC 2JHIF 2GY7A 2JHKF 2J0GA 2J3GA 3HUSB 2Z4EB 2J1GA 1FZGC 1RE3C 1LT9B 1M1JB 1RF0C 1JC9A 1FZBC 1RF1C 1RE4C 4M7HA 1LTJC 1FZAC 4ZFGA 1Z3SA 2J2PA 2OYIB 2OYHC 2J3FA 1FZFB 1FICA 3H32C 2H43C 1FZEB 2FFDC 1FIBA 2J3UA 1LWUC 1RF0B 1FZBB 1FIDA 2WNPF 1RF1B 1RE4B 4EPUA 3BVHB 1N86B 2JHHC 1FZCC 1FZAB 3FIBA 4JZCA 3E1IC 2HLOC 2JHMF 2J60A 3H32B 2H43B 4R9TA 2J61A 4JYOX 2HODC 1LWUB 2J61B 2HPCC 1FZGB 2D39A 1RE3B 1FZCB 2XNXC 3HUSC 3GHGC 4R9JA 1LTJB 4NYTA 2JHLF 2J0YA 1Z3UA 2J3FD 1N73C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOD B;  2HPC B;  2FFD B;  2OYI C;  2FIB A;  1FZF C;  2OYH B;  2Q9I C;  2XNX B;  1FZE C;  4M7F A;  3E1I B;  2HLO B;  2Q9I B;  1FZD A;  2J64 A;  1N73 B;  2Z4E C;  2J5Z A;  2J3O A;  3BVH C;  1N86 C;  2J0H A;  1LT9 C;  1M1J C;  2JHI F;  2GY7 A;  2JHK F;  2J0G A;  2J3G A;  3HUS B;  2Z4E B;  2J1G A;  1FZG C;  1RE3 C;  1LT9 B;  1M1J B;  1RF0 C;  1JC9 A;  1FZB C;  1RF1 C;  1RE4 C;  4M7H A;  1LTJ C;  1FZA C;  4ZFG A;  1Z3S A;  2J2P A;  2OYI B;  2OYH C;  2J3F A;  1FZF B;  1FIC A;  3H32 C;  2H43 C;  1FZE B;  2FFD C;  1FIB A;  2J3U A;  1LWU C;  1RF0 B;  1FZB B;  1FID A;  2WNP F;  1RF1 B;  1RE4 B;  4EPU A;  3BVH B;  1N86 B;  2JHH C;  1FZC C;  1FZA B;  3FIB A;  4JZC A;  3E1I C;  2HLO C;  2JHM F;  2J60 A;  3H32 B;  2H43 B;  4R9T A;  2J61 A;  4JYO X;  2HOD C;  1LWU B;  2J61 B;  2HPC C;  1FZG B;  2D39 A;  1RE3 B;  1FZC B;  2XNX C;  3HUS C;  3GHG C;  4R9J A;  1LTJ B;  4NYT A;  2JHL F;  2J0Y A;  1Z3U A;  2J3F D;  1N73 C; 
#chains in the Genus database with same CATH topology
 2HOD B;  2HPC B;  2FFD B;  2OYI C;  2FIB A;  1FZF C;  2OYH B;  2Q9I C;  2XNX B;  1FZE C;  3GHG B;  4M7F A;  3E1I B;  2HLO B;  2Q9I B;  1FZD A;  2J64 A;  1N73 B;  2Z4E C;  2J5Z A;  2J3O A;  3BVH C;  1N86 C;  2J0H A;  1LT9 C;  1M1J C;  2JHI F;  2GY7 A;  2JHK F;  2J0G A;  2J3G A;  3HUS B;  2Z4E B;  2J1G A;  1FZG C;  1RE3 C;  1LT9 B;  1M1J B;  1RF0 C;  1JC9 A;  1FZB C;  1RF1 C;  1RE4 C;  4M7H A;  1LTJ C;  1FZA C;  4ZFG A;  1Z3S A;  2J2P A;  2OYI B;  2OYH C;  2J3F A;  1FZF B;  1FIC A;  3H32 C;  2H43 C;  1FZE B;  2FFD C;  1FIB A;  2J3U A;  1LWU C;  1RF0 B;  1FZB B;  1FID A;  2WNP F;  1RF1 B;  1RE4 B;  4EPU A;  3BVH B;  1N86 B;  2JHH C;  1FZC C;  1FZA B;  3FIB A;  4JZC A;  3E1I C;  2HLO C;  2JHM F;  2J60 A;  3H32 B;  2H43 B;  4R9T A;  2J61 A;  4JYO X;  2HOD C;  1LWU B;  2J61 B;  2HPC C;  1FZG B;  2D39 A;  1RE3 B;  1FZC B;  2XNX C;  3HUS C;  3GHG C;  4R9J A;  1LTJ B;  4NYT A;  2JHL F;  2J0Y A;  1Z3U A;  2J3F D;  1N73 C; 
#chains in the Genus database with same CATH homology
 2HOD B;  2HPC B;  2FFD B;  2OYI C;  2FIB A;  1FZF C;  2OYH B;  2Q9I C;  2XNX B;  1FZE C;  4M7F A;  3E1I B;  2HLO B;  2Q9I B;  1FZD A;  2J64 A;  1N73 B;  2Z4E C;  2J5Z A;  2J3O A;  3BVH C;  1N86 C;  2J0H A;  1LT9 C;  1M1J C;  2JHI F;  2GY7 A;  2JHK F;  2J0G A;  2J3G A;  3HUS B;  2Z4E B;  2J1G A;  1FZG C;  1RE3 C;  1LT9 B;  1M1J B;  1RF0 C;  1JC9 A;  1FZB C;  1RF1 C;  1RE4 C;  4M7H A;  1LTJ C;  1FZA C;  4ZFG A;  1Z3S A;  2J2P A;  2OYI B;  2OYH C;  2J3F A;  1FZF B;  1FIC A;  3H32 C;  2H43 C;  1FZE B;  2FFD C;  1FIB A;  2J3U A;  1LWU C;  1RF0 B;  1FZB B;  1FID A;  2WNP F;  1RF1 B;  1RE4 B;  4EPU A;  3BVH B;  1N86 B;  2JHH C;  1FZC C;  1FZA B;  3FIB A;  4JZC A;  3E1I C;  2HLO C;  2JHM F;  2J60 A;  3H32 B;  2H43 B;  4R9T A;  2J61 A;  4JYO X;  2HOD C;  1LWU B;  2J61 B;  2HPC C;  1FZG B;  2D39 A;  1RE3 B;  1FZC B;  2XNX C;  3HUS C;  3GHG C;  4R9J A;  1LTJ B;  4NYT A;  2JHL F;  2J0Y A;  1Z3U A;  2J3F D;  1N73 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...