1FZDA

Structure of recombinant alphaec domain from human fibrinogen-420
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
197
structure length
197
Chain Sequence
GGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENGVVWVSFRGADYSLRAVRMKIRPLVTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRINOGEN-420
publication title Crystal structure of a recombinant alphaEC domain from human fibrinogen-420.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood coagulation
total genus 60
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzdA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzdA02
2J5ZA 2JHIF 2OYHC 2JHLF 2J3FD 1N86C 2HPCC 1RE4C 2Z4EB 1FZCC 2J0HA 1FICA 4M7HA 2WNPF 3BVHC 3H32B 1FZBB 1LWUC 2J64A 1FZGC 1M1JB 2J61A 4ZFGA 1FZDA 1FZAB 1RE3C 2OYIC 3E1IC 2Q9IB 1LT9C 2HLOC 1Z3SA 2HODC 2J3FA 2JHMF 2JHKF 2H43C 2J0GA 1RF1C 2FFDC 2OYHB 1FIBA 4NYTA 1FZEB 3FIBA 2FIBA 2J3UA 1RF0C 2D39A 2HPCB 1FZFC 1FZCB 2XNXB 1Z3UA 2J1GA 1LTJC 3HUSB 1JC9A 1N73C 1FZGB 1FZBC 1FIDA 1M1JC 1RE3B 1FZAC 4JYOX 3E1IB 1LT9B 2J0YA 2Q9IC 3GHGC 2JHHC 1N86B 2J2PA 2FFDB 1RE4B 2Z4EC 1FZEC 2J61B 3BVHB 1RF0B 1LWUB 2J60A 3H32C 1FZFB 4R9TA 4M7FA 2OYIB 2J3GA 2XNXC 4JZCA 4R9JA 2GY7A 1LTJB 1N73B 4EPUA 3HUSC 2HLOB 2HODB 2J3OA 1RF1B 2H43B
chains in the Genus database with same CATH superfamily
2J5ZA 2JHIF 2OYHC 2JHLF 3GHGB 2J3FD 1N86C 2HPCC 1RE4C 2Z4EB 1FZCC 2J0HA 1FICA 4M7HA 2WNPF 3BVHC 3H32B 1FZBB 1LWUC 2J64A 1FZGC 1M1JB 2J61A 4ZFGA 1FZDA 1FZAB 1RE3C 2OYIC 3E1IC 2Q9IB 1LT9C 2HLOC 1Z3SA 2HODC 2J3FA 2JHMF 2JHKF 2H43C 2J0GA 1RF1C 2FFDC 2OYHB 1FIBA 4NYTA 1FZEB 3FIBA 2FIBA 2J3UA 1RF0C 2D39A 2HPCB 1FZFC 1FZCB 2XNXB 1Z3UA 2J1GA 1LTJC 3HUSB 1JC9A 1N73C 1FZGB 1FZBC 1FIDA 1M1JC 1RE3B 1FZAC 4JYOX 3E1IB 1LT9B 2J0YA 2Q9IC 3GHGC 2JHHC 1N86B 2J2PA 2FFDB 1RE4B 2Z4EC 1FZEC 2J61B 3BVHB 1RF0B 1LWUB 2J60A 3H32C 1FZFB 4R9TA 4M7FA 2OYIB 2J3GA 2XNXC 4JZCA 4R9JA 2GY7A 1LTJB 1N73B 4EPUA 3HUSC 2HLOB 2HODB 2J3OA 1RF1B 2H43B
chains in the Genus database with same CATH topology
2J5ZA 2JHIF 2OYHC 2JHLF 2J3FD 1N86C 2HPCC 1RE4C 2Z4EB 1FZCC 2J0HA 1FICA 4M7HA 2WNPF 3BVHC 3H32B 1FZBB 1LWUC 2J64A 1FZGC 1M1JB 2J61A 4ZFGA 1FZDA 1FZAB 1RE3C 2OYIC 3E1IC 2Q9IB 1LT9C 2HLOC 1Z3SA 2HODC 2J3FA 2JHMF 2JHKF 2H43C 2J0GA 1RF1C 2FFDC 2OYHB 1FIBA 4NYTA 1FZEB 3FIBA 2FIBA 2J3UA 1RF0C 2D39A 2HPCB 1FZFC 1FZCB 2XNXB 1Z3UA 2J1GA 1LTJC 3HUSB 1JC9A 1N73C 1FZGB 1FZBC 1FIDA 1M1JC 1RE3B 1FZAC 4JYOX 3E1IB 1LT9B 2J0YA 2Q9IC 3GHGC 2JHHC 1N86B 2J2PA 2FFDB 1RE4B 2Z4EC 1FZEC 2J61B 3BVHB 1RF0B 1LWUB 2J60A 3H32C 1FZFB 4R9TA 4M7FA 2OYIB 2J3GA 2XNXC 4JZCA 4R9JA 2GY7A 1LTJB 1N73B 4EPUA 3HUSC 2HLOB 2HODB 2J3OA 1RF1B 2H43B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5Z A;  2JHI F;  2OYH C;  2JHL F;  2J3F D;  1N86 C;  2HPC C;  1RE4 C;  2Z4E B;  1FZC C;  2J0H A;  1FIC A;  4M7H A;  2WNP F;  3BVH C;  3H32 B;  1FZB B;  1LWU C;  2J64 A;  1FZG C;  1M1J B;  2J61 A;  4ZFG A;  1FZD A;  1FZA B;  1RE3 C;  2OYI C;  3E1I C;  2Q9I B;  1LT9 C;  2HLO C;  1Z3S A;  2HOD C;  2J3F A;  2JHM F;  2JHK F;  2H43 C;  2J0G A;  1RF1 C;  2FFD C;  2OYH B;  1FIB A;  4NYT A;  1FZE B;  3FIB A;  2FIB A;  2J3U A;  1RF0 C;  2D39 A;  2HPC B;  1FZF C;  1FZC B;  2XNX B;  1Z3U A;  2J1G A;  1LTJ C;  3HUS B;  1JC9 A;  1N73 C;  1FZG B;  1FZB C;  1FID A;  1M1J C;  1RE3 B;  1FZA C;  4JYO X;  3E1I B;  1LT9 B;  2J0Y A;  2Q9I C;  3GHG C;  2JHH C;  1N86 B;  2J2P A;  2FFD B;  1RE4 B;  2Z4E C;  1FZE C;  2J61 B;  3BVH B;  1RF0 B;  1LWU B;  2J60 A;  3H32 C;  1FZF B;  4R9T A;  4M7F A;  2OYI B;  2J3G A;  2XNX C;  4JZC A;  4R9J A;  2GY7 A;  1LTJ B;  1N73 B;  4EPU A;  3HUS C;  2HLO B;  2HOD B;  2J3O A;  1RF1 B;  2H43 B; 
#chains in the Genus database with same CATH topology
 2J5Z A;  2JHI F;  2OYH C;  2JHL F;  3GHG B;  2J3F D;  1N86 C;  2HPC C;  1RE4 C;  2Z4E B;  1FZC C;  2J0H A;  1FIC A;  4M7H A;  2WNP F;  3BVH C;  3H32 B;  1FZB B;  1LWU C;  2J64 A;  1FZG C;  1M1J B;  2J61 A;  4ZFG A;  1FZD A;  1FZA B;  1RE3 C;  2OYI C;  3E1I C;  2Q9I B;  1LT9 C;  2HLO C;  1Z3S A;  2HOD C;  2J3F A;  2JHM F;  2JHK F;  2H43 C;  2J0G A;  1RF1 C;  2FFD C;  2OYH B;  1FIB A;  4NYT A;  1FZE B;  3FIB A;  2FIB A;  2J3U A;  1RF0 C;  2D39 A;  2HPC B;  1FZF C;  1FZC B;  2XNX B;  1Z3U A;  2J1G A;  1LTJ C;  3HUS B;  1JC9 A;  1N73 C;  1FZG B;  1FZB C;  1FID A;  1M1J C;  1RE3 B;  1FZA C;  4JYO X;  3E1I B;  1LT9 B;  2J0Y A;  2Q9I C;  3GHG C;  2JHH C;  1N86 B;  2J2P A;  2FFD B;  1RE4 B;  2Z4E C;  1FZE C;  2J61 B;  3BVH B;  1RF0 B;  1LWU B;  2J60 A;  3H32 C;  1FZF B;  4R9T A;  4M7F A;  2OYI B;  2J3G A;  2XNX C;  4JZC A;  4R9J A;  2GY7 A;  1LTJ B;  1N73 B;  4EPU A;  3HUS C;  2HLO B;  2HOD B;  2J3O A;  1RF1 B;  2H43 B; 
#chains in the Genus database with same CATH homology
 2J5Z A;  2JHI F;  2OYH C;  2JHL F;  2J3F D;  1N86 C;  2HPC C;  1RE4 C;  2Z4E B;  1FZC C;  2J0H A;  1FIC A;  4M7H A;  2WNP F;  3BVH C;  3H32 B;  1FZB B;  1LWU C;  2J64 A;  1FZG C;  1M1J B;  2J61 A;  4ZFG A;  1FZD A;  1FZA B;  1RE3 C;  2OYI C;  3E1I C;  2Q9I B;  1LT9 C;  2HLO C;  1Z3S A;  2HOD C;  2J3F A;  2JHM F;  2JHK F;  2H43 C;  2J0G A;  1RF1 C;  2FFD C;  2OYH B;  1FIB A;  4NYT A;  1FZE B;  3FIB A;  2FIB A;  2J3U A;  1RF0 C;  2D39 A;  2HPC B;  1FZF C;  1FZC B;  2XNX B;  1Z3U A;  2J1G A;  1LTJ C;  3HUS B;  1JC9 A;  1N73 C;  1FZG B;  1FZB C;  1FID A;  1M1J C;  1RE3 B;  1FZA C;  4JYO X;  3E1I B;  1LT9 B;  2J0Y A;  2Q9I C;  3GHG C;  2JHH C;  1N86 B;  2J2P A;  2FFD B;  1RE4 B;  2Z4E C;  1FZE C;  2J61 B;  3BVH B;  1RF0 B;  1LWU B;  2J60 A;  3H32 C;  1FZF B;  4R9T A;  4M7F A;  2OYI B;  2J3G A;  2XNX C;  4JZC A;  4R9J A;  2GY7 A;  1LTJ B;  1N73 B;  4EPU A;  3HUS C;  2HLO B;  2HOD B;  2J3O A;  1RF1 B;  2H43 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...