1FZBB

Crystal structure of crosslinked fragment d
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
312
structure length
312
Chain Sequence
b'KHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN
publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 92
structure length 312
sequence length 312
chains with identical sequence E
ec nomenclature
pdb deposition date 1997-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzbB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzbB02
1M1JB 1RE4C 2JHHC 2FFDB 4ZFGA 3E1IB 3H32B 3GHGC 1FZAC 1RE3B 1LWUB 3HUSC 1FZDA 2J3FD 1LTJB 2J3GA 2J5ZA 1LWUC 2XNXC 4EPUA 4M7HA 1N73C 4M7FA 1RF1B 1FZCB 2J0GA 2Q9IB 1FZBC 2OYIB 2OYHC 2J61A 4JZCA 1FZCC 1FZGB 1M1JC 2FFDC 2HODB 1FIBA 3E1IC 3H32C 1FZFB 1RE3C 2HPCB 2H43B 2Z4EB 3FIBA 2J3FA 2HODC 2JHMF 2D39A 2GY7A 1LTJC 1LT9B 1RF0B 2J3OA 1RF1C 2J61B 3BVHB 2JHKF 1FZEB 2FIBA 2Q9IC 1N86B 1Z3SA 2OYIC 2HLOB 1RE4B 2JHIF 1FZGC 4JYOX 2J0YA 1JC9A 1FIDA 1FZFC 3HUSB 2J0HA 2HPCC 2J2PA 2J60A 2H43C 2Z4EC 1Z3UA 2J64A 2XNXB 4NYTA 1N73B 1LT9C 1RF0C 2J1GA 2WNPF 2JHLF 1FICA 2J3UA 3BVHC 1FZBB 1FZEC 4R9JA 2OYHB 1N86C 1FZAB 2HLOC 4R9TA
chains in the Genus database with same CATH superfamily
1M1JB 1RE4C 2JHHC 2FFDB 4ZFGA 3E1IB 3H32B 3GHGC 1FZAC 1RE3B 1LWUB 3HUSC 1FZDA 2J3FD 1LTJB 2J3GA 2J5ZA 1LWUC 2XNXC 4EPUA 4M7HA 1N73C 4M7FA 1RF1B 1FZCB 2J0GA 2Q9IB 1FZBC 2OYIB 2OYHC 2J61A 4JZCA 1FZCC 1FZGB 1M1JC 2FFDC 2HODB 1FIBA 3E1IC 3H32C 1FZFB 1RE3C 2HPCB 2H43B 2Z4EB 3FIBA 2J3FA 2HODC 2JHMF 2D39A 2GY7A 1LTJC 1LT9B 1RF0B 2J3OA 1RF1C 2J61B 3BVHB 2JHKF 1FZEB 2FIBA 2Q9IC 1N86B 1Z3SA 2OYIC 2HLOB 1RE4B 2JHIF 1FZGC 4JYOX 3GHGB 2J0YA 1JC9A 1FIDA 1FZFC 3HUSB 2J0HA 2HPCC 2J2PA 2J60A 2H43C 2Z4EC 1Z3UA 2J64A 2XNXB 4NYTA 1N73B 1LT9C 1RF0C 2J1GA 2WNPF 2JHLF 1FICA 2J3UA 3BVHC 1FZBB 1FZEC 4R9JA 2OYHB 1N86C 1FZAB 2HLOC 4R9TA
chains in the Genus database with same CATH topology
1M1JB 1RE4C 2JHHC 2FFDB 4ZFGA 3E1IB 3H32B 3GHGC 1FZAC 1RE3B 1LWUB 3HUSC 1FZDA 2J3FD 1LTJB 2J3GA 2J5ZA 1LWUC 2XNXC 4EPUA 4M7HA 1N73C 4M7FA 1RF1B 1FZCB 2J0GA 2Q9IB 1FZBC 2OYIB 2OYHC 2J61A 4JZCA 1FZCC 1FZGB 1M1JC 2FFDC 2HODB 1FIBA 3E1IC 3H32C 1FZFB 1RE3C 2HPCB 2H43B 2Z4EB 3FIBA 2J3FA 2HODC 2JHMF 2D39A 2GY7A 1LTJC 1LT9B 1RF0B 2J3OA 1RF1C 2J61B 3BVHB 2JHKF 1FZEB 2FIBA 2Q9IC 1N86B 1Z3SA 2OYIC 2HLOB 1RE4B 2JHIF 1FZGC 4JYOX 2J0YA 1JC9A 1FIDA 1FZFC 3HUSB 2J0HA 2HPCC 2J2PA 2J60A 2H43C 2Z4EC 1Z3UA 2J64A 2XNXB 4NYTA 1N73B 1LT9C 1RF0C 2J1GA 2WNPF 2JHLF 1FICA 2J3UA 3BVHC 1FZBB 1FZEC 4R9JA 2OYHB 1N86C 1FZAB 2HLOC 4R9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J B;  1RE4 C;  2JHH C;  2FFD B;  4ZFG A;  3E1I B;  3H32 B;  3GHG C;  1FZA C;  1RE3 B;  1LWU B;  3HUS C;  1FZD A;  2J3F D;  1LTJ B;  2J3G A;  2J5Z A;  1LWU C;  2XNX C;  4EPU A;  4M7H A;  1N73 C;  4M7F A;  1RF1 B;  1FZC B;  2J0G A;  2Q9I B;  1FZB C;  2OYI B;  2OYH C;  2J61 A;  4JZC A;  1FZC C;  1FZG B;  1M1J C;  2FFD C;  2HOD B;  1FIB A;  3E1I C;  3H32 C;  1FZF B;  1RE3 C;  2HPC B;  2H43 B;  2Z4E B;  3FIB A;  2J3F A;  2HOD C;  2JHM F;  2D39 A;  2GY7 A;  1LTJ C;  1LT9 B;  1RF0 B;  2J3O A;  1RF1 C;  2J61 B;  3BVH B;  2JHK F;  1FZE B;  2FIB A;  2Q9I C;  1N86 B;  1Z3S A;  2OYI C;  2HLO B;  1RE4 B;  2JHI F;  1FZG C;  4JYO X;  2J0Y A;  1JC9 A;  1FID A;  1FZF C;  3HUS B;  2J0H A;  2HPC C;  2J2P A;  2J60 A;  2H43 C;  2Z4E C;  1Z3U A;  2J64 A;  2XNX B;  4NYT A;  1N73 B;  1LT9 C;  1RF0 C;  2J1G A;  2WNP F;  2JHL F;  1FIC A;  2J3U A;  3BVH C;  1FZB B;  1FZE C;  4R9J A;  2OYH B;  1N86 C;  1FZA B;  2HLO C;  4R9T A; 
#chains in the Genus database with same CATH topology
 1M1J B;  1RE4 C;  2JHH C;  2FFD B;  4ZFG A;  3E1I B;  3H32 B;  3GHG C;  1FZA C;  1RE3 B;  1LWU B;  3HUS C;  1FZD A;  2J3F D;  1LTJ B;  2J3G A;  2J5Z A;  1LWU C;  2XNX C;  4EPU A;  4M7H A;  1N73 C;  4M7F A;  1RF1 B;  1FZC B;  2J0G A;  2Q9I B;  1FZB C;  2OYI B;  2OYH C;  2J61 A;  4JZC A;  1FZC C;  1FZG B;  1M1J C;  2FFD C;  2HOD B;  1FIB A;  3E1I C;  3H32 C;  1FZF B;  1RE3 C;  2HPC B;  2H43 B;  2Z4E B;  3FIB A;  2J3F A;  2HOD C;  2JHM F;  2D39 A;  2GY7 A;  1LTJ C;  1LT9 B;  1RF0 B;  2J3O A;  1RF1 C;  2J61 B;  3BVH B;  2JHK F;  1FZE B;  2FIB A;  2Q9I C;  1N86 B;  1Z3S A;  2OYI C;  2HLO B;  1RE4 B;  2JHI F;  1FZG C;  4JYO X;  3GHG B;  2J0Y A;  1JC9 A;  1FID A;  1FZF C;  3HUS B;  2J0H A;  2HPC C;  2J2P A;  2J60 A;  2H43 C;  2Z4E C;  1Z3U A;  2J64 A;  2XNX B;  4NYT A;  1N73 B;  1LT9 C;  1RF0 C;  2J1G A;  2WNP F;  2JHL F;  1FIC A;  2J3U A;  3BVH C;  1FZB B;  1FZE C;  4R9J A;  2OYH B;  1N86 C;  1FZA B;  2HLO C;  4R9T A; 
#chains in the Genus database with same CATH homology
 1M1J B;  1RE4 C;  2JHH C;  2FFD B;  4ZFG A;  3E1I B;  3H32 B;  3GHG C;  1FZA C;  1RE3 B;  1LWU B;  3HUS C;  1FZD A;  2J3F D;  1LTJ B;  2J3G A;  2J5Z A;  1LWU C;  2XNX C;  4EPU A;  4M7H A;  1N73 C;  4M7F A;  1RF1 B;  1FZC B;  2J0G A;  2Q9I B;  1FZB C;  2OYI B;  2OYH C;  2J61 A;  4JZC A;  1FZC C;  1FZG B;  1M1J C;  2FFD C;  2HOD B;  1FIB A;  3E1I C;  3H32 C;  1FZF B;  1RE3 C;  2HPC B;  2H43 B;  2Z4E B;  3FIB A;  2J3F A;  2HOD C;  2JHM F;  2D39 A;  2GY7 A;  1LTJ C;  1LT9 B;  1RF0 B;  2J3O A;  1RF1 C;  2J61 B;  3BVH B;  2JHK F;  1FZE B;  2FIB A;  2Q9I C;  1N86 B;  1Z3S A;  2OYI C;  2HLO B;  1RE4 B;  2JHI F;  1FZG C;  4JYO X;  2J0Y A;  1JC9 A;  1FID A;  1FZF C;  3HUS B;  2J0H A;  2HPC C;  2J2P A;  2J60 A;  2H43 C;  2Z4E C;  1Z3U A;  2J64 A;  2XNX B;  4NYT A;  1N73 B;  1LT9 C;  1RF0 C;  2J1G A;  2WNP F;  2JHL F;  1FIC A;  2J3U A;  3BVH C;  1FZB B;  1FZE C;  4R9J A;  2OYH B;  1N86 C;  1FZA B;  2HLO C;  4R9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...