1RE4B

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
306
Chain Sequence
DETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEAGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 89
structure length 306
sequence length 306
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re4B01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re4B02
1LTJB 1FZEB 2H43B 2XNXB 2FIBA 3BVHC 1LTJC 2JHIF 2H43C 2XNXC 1RE4B 1FZCC 2J3FA 3H32B 4EPUA 1RF0B 4JYOX 1FZAC 4NYTA 1RE4C 1RE3B 3GHGC 3H32C 1RF1C 2HPCC 2J61A 1JC9A 1RE3C 2HLOB 2FFDB 1FICA 2J0HA 4M7FA 1M1JB 1FZEC 1LWUB 2HLOC 2Z4EB 2FFDC 2J3OA 1LWUC 2J3GA 2Z4EC 1FZBB 2J2PA 1N73B 3E1IB 2J60A 1FZBC 1RF0C 4JZCA 2J0GA 2OYHB 4R9TA 1N73C 2OYIB 3E1IC 2J3UA 2J5ZA 1FIDA 4R9JA 2JHKF 2OYHC 2D39A 1FIBA 1N86B 1M1JC 3FIBA 3HUSB 1FZFB 3BVHB 1FZDA 1LT9B 3HUSC 1FZFC 1FZCB 2JHMF 2J64A 1FZGB 2Q9IB 4M7HA 1LT9C 1FZAB 2J0YA 2HODB 1FZGC 2OYIC 2GY7A 2J3FD 2Q9IC 1RF1B 2WNPF 2HPCB 2J1GA 2J61B 4ZFGA 1Z3UA 1Z3SA 2HODC 1N86C 2JHHC 2JHLF
chains in the Genus database with same CATH superfamily
1LTJB 1FZEB 2H43B 2XNXB 2FIBA 3BVHC 1LTJC 2JHIF 2H43C 2XNXC 1RE4B 1FZCC 3GHGB 2J3FA 3H32B 4EPUA 1RF0B 4JYOX 1FZAC 4NYTA 1RE4C 1RE3B 3GHGC 3H32C 1RF1C 2HPCC 2J61A 1JC9A 1RE3C 2HLOB 2FFDB 1FICA 2J0HA 4M7FA 1M1JB 1FZEC 1LWUB 2HLOC 2Z4EB 2FFDC 2J3OA 1LWUC 2J3GA 2Z4EC 1FZBB 2J2PA 1N73B 3E1IB 2J60A 1FZBC 1RF0C 4JZCA 2J0GA 2OYHB 4R9TA 1N73C 2OYIB 3E1IC 2J3UA 2J5ZA 1FIDA 4R9JA 2JHKF 2OYHC 2D39A 1FIBA 1N86B 1M1JC 3FIBA 3HUSB 1FZFB 3BVHB 1FZDA 1LT9B 3HUSC 1FZFC 1FZCB 2JHMF 2J64A 1FZGB 2Q9IB 4M7HA 1LT9C 1FZAB 2J0YA 2HODB 1FZGC 2OYIC 2GY7A 2J3FD 2Q9IC 1RF1B 2WNPF 2HPCB 2J1GA 2J61B 4ZFGA 1Z3UA 1Z3SA 2HODC 1N86C 2JHHC 2JHLF
chains in the Genus database with same CATH topology
1LTJB 1FZEB 2H43B 2XNXB 2FIBA 3BVHC 1LTJC 2JHIF 2H43C 2XNXC 1RE4B 1FZCC 2J3FA 3H32B 4EPUA 1RF0B 4JYOX 1FZAC 4NYTA 1RE4C 1RE3B 3GHGC 3H32C 1RF1C 2HPCC 2J61A 1JC9A 1RE3C 2HLOB 2FFDB 1FICA 2J0HA 4M7FA 1M1JB 1FZEC 1LWUB 2HLOC 2Z4EB 2FFDC 2J3OA 1LWUC 2J3GA 2Z4EC 1FZBB 2J2PA 1N73B 3E1IB 2J60A 1FZBC 1RF0C 4JZCA 2J0GA 2OYHB 4R9TA 1N73C 2OYIB 3E1IC 2J3UA 2J5ZA 1FIDA 4R9JA 2JHKF 2OYHC 2D39A 1FIBA 1N86B 1M1JC 3FIBA 3HUSB 1FZFB 3BVHB 1FZDA 1LT9B 3HUSC 1FZFC 1FZCB 2JHMF 2J64A 1FZGB 2Q9IB 4M7HA 1LT9C 1FZAB 2J0YA 2HODB 1FZGC 2OYIC 2GY7A 2J3FD 2Q9IC 1RF1B 2WNPF 2HPCB 2J1GA 2J61B 4ZFGA 1Z3UA 1Z3SA 2HODC 1N86C 2JHHC 2JHLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTJ B;  1FZE B;  2H43 B;  2XNX B;  2FIB A;  3BVH C;  1LTJ C;  2JHI F;  2H43 C;  2XNX C;  1RE4 B;  1FZC C;  2J3F A;  3H32 B;  4EPU A;  1RF0 B;  4JYO X;  1FZA C;  4NYT A;  1RE4 C;  1RE3 B;  3GHG C;  3H32 C;  1RF1 C;  2HPC C;  2J61 A;  1JC9 A;  1RE3 C;  2HLO B;  2FFD B;  1FIC A;  2J0H A;  4M7F A;  1M1J B;  1FZE C;  1LWU B;  2HLO C;  2Z4E B;  2FFD C;  2J3O A;  1LWU C;  2J3G A;  2Z4E C;  1FZB B;  2J2P A;  1N73 B;  3E1I B;  2J60 A;  1FZB C;  1RF0 C;  4JZC A;  2J0G A;  2OYH B;  4R9T A;  1N73 C;  2OYI B;  3E1I C;  2J3U A;  2J5Z A;  1FID A;  4R9J A;  2JHK F;  2OYH C;  2D39 A;  1FIB A;  1N86 B;  1M1J C;  3FIB A;  3HUS B;  1FZF B;  3BVH B;  1FZD A;  1LT9 B;  3HUS C;  1FZF C;  1FZC B;  2JHM F;  2J64 A;  1FZG B;  2Q9I B;  4M7H A;  1LT9 C;  1FZA B;  2J0Y A;  2HOD B;  1FZG C;  2OYI C;  2GY7 A;  2J3F D;  2Q9I C;  1RF1 B;  2WNP F;  2HPC B;  2J1G A;  2J61 B;  4ZFG A;  1Z3U A;  1Z3S A;  2HOD C;  1N86 C;  2JHH C;  2JHL F; 
#chains in the Genus database with same CATH topology
 1LTJ B;  1FZE B;  2H43 B;  2XNX B;  2FIB A;  3BVH C;  1LTJ C;  2JHI F;  2H43 C;  2XNX C;  1RE4 B;  1FZC C;  3GHG B;  2J3F A;  3H32 B;  4EPU A;  1RF0 B;  4JYO X;  1FZA C;  4NYT A;  1RE4 C;  1RE3 B;  3GHG C;  3H32 C;  1RF1 C;  2HPC C;  2J61 A;  1JC9 A;  1RE3 C;  2HLO B;  2FFD B;  1FIC A;  2J0H A;  4M7F A;  1M1J B;  1FZE C;  1LWU B;  2HLO C;  2Z4E B;  2FFD C;  2J3O A;  1LWU C;  2J3G A;  2Z4E C;  1FZB B;  2J2P A;  1N73 B;  3E1I B;  2J60 A;  1FZB C;  1RF0 C;  4JZC A;  2J0G A;  2OYH B;  4R9T A;  1N73 C;  2OYI B;  3E1I C;  2J3U A;  2J5Z A;  1FID A;  4R9J A;  2JHK F;  2OYH C;  2D39 A;  1FIB A;  1N86 B;  1M1J C;  3FIB A;  3HUS B;  1FZF B;  3BVH B;  1FZD A;  1LT9 B;  3HUS C;  1FZF C;  1FZC B;  2JHM F;  2J64 A;  1FZG B;  2Q9I B;  4M7H A;  1LT9 C;  1FZA B;  2J0Y A;  2HOD B;  1FZG C;  2OYI C;  2GY7 A;  2J3F D;  2Q9I C;  1RF1 B;  2WNP F;  2HPC B;  2J1G A;  2J61 B;  4ZFG A;  1Z3U A;  1Z3S A;  2HOD C;  1N86 C;  2JHH C;  2JHL F; 
#chains in the Genus database with same CATH homology
 1LTJ B;  1FZE B;  2H43 B;  2XNX B;  2FIB A;  3BVH C;  1LTJ C;  2JHI F;  2H43 C;  2XNX C;  1RE4 B;  1FZC C;  2J3F A;  3H32 B;  4EPU A;  1RF0 B;  4JYO X;  1FZA C;  4NYT A;  1RE4 C;  1RE3 B;  3GHG C;  3H32 C;  1RF1 C;  2HPC C;  2J61 A;  1JC9 A;  1RE3 C;  2HLO B;  2FFD B;  1FIC A;  2J0H A;  4M7F A;  1M1J B;  1FZE C;  1LWU B;  2HLO C;  2Z4E B;  2FFD C;  2J3O A;  1LWU C;  2J3G A;  2Z4E C;  1FZB B;  2J2P A;  1N73 B;  3E1I B;  2J60 A;  1FZB C;  1RF0 C;  4JZC A;  2J0G A;  2OYH B;  4R9T A;  1N73 C;  2OYI B;  3E1I C;  2J3U A;  2J5Z A;  1FID A;  4R9J A;  2JHK F;  2OYH C;  2D39 A;  1FIB A;  1N86 B;  1M1J C;  3FIB A;  3HUS B;  1FZF B;  3BVH B;  1FZD A;  1LT9 B;  3HUS C;  1FZF C;  1FZC B;  2JHM F;  2J64 A;  1FZG B;  2Q9I B;  4M7H A;  1LT9 C;  1FZA B;  2J0Y A;  2HOD B;  1FZG C;  2OYI C;  2GY7 A;  2J3F D;  2Q9I C;  1RF1 B;  2WNP F;  2HPC B;  2J1G A;  2J61 B;  4ZFG A;  1Z3U A;  1Z3S A;  2HOD C;  1N86 C;  2JHH C;  2JHL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...