1RE4B

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
306
structure length
306
Chain Sequence
DETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEAGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 306
sequence length 306
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re4B01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re4B02
2HLOC 2J3UA 2J60A 1FZDA 1N86B 1N73C 2Q9IB 1LT9C 4JYOX 2XNXB 1FZEB 2FFDC 1LWUC 3FIBA 1N73B 1LT9B 2D39A 2FFDB 2J1GA 1LWUB 3E1IC 4R9TA 1RE3B 2Q9IC 1FIBA 2GY7A 4M7FA 2H43B 2XNXC 1FZEC 1Z3SA 2J5ZA 3BVHC 2JHMF 1FZCC 2JHHC 2OYHC 1RE3C 1LTJC 4R9JA 1JC9A 4JZCA 3BVHB 4M7HA 1RF1C 1FZCB 2H43C 2OYHB 2JHLF 1FZBB 1LTJB 2JHIF 2J3OA 3HUSC 1RF1B 4EPUA 3H32C 1RE4B 1Z3UA 2HPCC 3HUSB 1FZGC 2J2PA 3H32B 2Z4EC 2HPCB 2HODC 2J61A 1M1JB 2J0YA 1FZGB 2OYIB 4NYTA 1FZBC 2J0GA 2J61B 2Z4EB 1RF0C 2HODB 1FZFC 1RE4C 1FIDA 2J64A 4ZFGA 1RF0B 2WNPF 1FZFB 2J3FD 2J3GA 2HLOB 1M1JC 2OYIC 1FICA 2FIBA 2JHKF 1FZAC 2J3FA 1N86C 1FZAB 3E1IB 3GHGC 2J0HA
chains in the Genus database with same CATH superfamily
2HLOC 2J3UA 2J60A 1FZDA 1N86B 1N73C 2Q9IB 1LT9C 4JYOX 2XNXB 1FZEB 2FFDC 1LWUC 3FIBA 1N73B 1LT9B 2D39A 2FFDB 2J1GA 1LWUB 3E1IC 4R9TA 1RE3B 2Q9IC 1FIBA 2GY7A 4M7FA 2H43B 2XNXC 1FZEC 1Z3SA 2J5ZA 3BVHC 2JHMF 1FZCC 2JHHC 2OYHC 1RE3C 1LTJC 4R9JA 1JC9A 4JZCA 3BVHB 4M7HA 1RF1C 1FZCB 2H43C 2OYHB 2JHLF 1FZBB 1LTJB 2JHIF 2J3OA 3HUSC 1RF1B 4EPUA 3H32C 1RE4B 1Z3UA 2HPCC 3HUSB 1FZGC 2J2PA 3H32B 2Z4EC 2HPCB 2HODC 2J61A 1M1JB 2J0YA 1FZGB 2OYIB 4NYTA 1FZBC 2J0GA 2J61B 2Z4EB 1RF0C 2HODB 1FZFC 1RE4C 1FIDA 2J64A 4ZFGA 1RF0B 2WNPF 1FZFB 3GHGB 2J3FD 2J3GA 2HLOB 1M1JC 2OYIC 1FICA 2FIBA 2JHKF 1FZAC 2J3FA 1N86C 1FZAB 3E1IB 3GHGC 2J0HA
chains in the Genus database with same CATH topology
2HLOC 2J3UA 2J60A 1FZDA 1N86B 1N73C 2Q9IB 1LT9C 4JYOX 2XNXB 1FZEB 2FFDC 1LWUC 3FIBA 1N73B 1LT9B 2D39A 2FFDB 2J1GA 1LWUB 3E1IC 4R9TA 1RE3B 2Q9IC 1FIBA 2GY7A 4M7FA 2H43B 2XNXC 1FZEC 1Z3SA 2J5ZA 3BVHC 2JHMF 1FZCC 2JHHC 2OYHC 1RE3C 1LTJC 4R9JA 1JC9A 4JZCA 3BVHB 4M7HA 1RF1C 1FZCB 2H43C 2OYHB 2JHLF 1FZBB 1LTJB 2JHIF 2J3OA 3HUSC 1RF1B 4EPUA 3H32C 1RE4B 1Z3UA 2HPCC 3HUSB 1FZGC 2J2PA 3H32B 2Z4EC 2HPCB 2HODC 2J61A 1M1JB 2J0YA 1FZGB 2OYIB 4NYTA 1FZBC 2J0GA 2J61B 2Z4EB 1RF0C 2HODB 1FZFC 1RE4C 1FIDA 2J64A 4ZFGA 1RF0B 2WNPF 1FZFB 2J3FD 2J3GA 2HLOB 1M1JC 2OYIC 1FICA 2FIBA 2JHKF 1FZAC 2J3FA 1N86C 1FZAB 3E1IB 3GHGC 2J0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLO C;  2J3U A;  2J60 A;  1FZD A;  1N86 B;  1N73 C;  2Q9I B;  1LT9 C;  4JYO X;  2XNX B;  1FZE B;  2FFD C;  1LWU C;  3FIB A;  1N73 B;  1LT9 B;  2D39 A;  2FFD B;  2J1G A;  1LWU B;  3E1I C;  4R9T A;  1RE3 B;  2Q9I C;  1FIB A;  2GY7 A;  4M7F A;  2H43 B;  2XNX C;  1FZE C;  1Z3S A;  2J5Z A;  3BVH C;  2JHM F;  1FZC C;  2JHH C;  2OYH C;  1RE3 C;  1LTJ C;  4R9J A;  1JC9 A;  4JZC A;  3BVH B;  4M7H A;  1RF1 C;  1FZC B;  2H43 C;  2OYH B;  2JHL F;  1FZB B;  1LTJ B;  2JHI F;  2J3O A;  3HUS C;  1RF1 B;  4EPU A;  3H32 C;  1RE4 B;  1Z3U A;  2HPC C;  3HUS B;  1FZG C;  2J2P A;  3H32 B;  2Z4E C;  2HPC B;  2HOD C;  2J61 A;  1M1J B;  2J0Y A;  1FZG B;  2OYI B;  4NYT A;  1FZB C;  2J0G A;  2J61 B;  2Z4E B;  1RF0 C;  2HOD B;  1FZF C;  1RE4 C;  1FID A;  2J64 A;  4ZFG A;  1RF0 B;  2WNP F;  1FZF B;  2J3F D;  2J3G A;  2HLO B;  1M1J C;  2OYI C;  1FIC A;  2FIB A;  2JHK F;  1FZA C;  2J3F A;  1N86 C;  1FZA B;  3E1I B;  3GHG C;  2J0H A; 
#chains in the Genus database with same CATH topology
 2HLO C;  2J3U A;  2J60 A;  1FZD A;  1N86 B;  1N73 C;  2Q9I B;  1LT9 C;  4JYO X;  2XNX B;  1FZE B;  2FFD C;  1LWU C;  3FIB A;  1N73 B;  1LT9 B;  2D39 A;  2FFD B;  2J1G A;  1LWU B;  3E1I C;  4R9T A;  1RE3 B;  2Q9I C;  1FIB A;  2GY7 A;  4M7F A;  2H43 B;  2XNX C;  1FZE C;  1Z3S A;  2J5Z A;  3BVH C;  2JHM F;  1FZC C;  2JHH C;  2OYH C;  1RE3 C;  1LTJ C;  4R9J A;  1JC9 A;  4JZC A;  3BVH B;  4M7H A;  1RF1 C;  1FZC B;  2H43 C;  2OYH B;  2JHL F;  1FZB B;  1LTJ B;  2JHI F;  2J3O A;  3HUS C;  1RF1 B;  4EPU A;  3H32 C;  1RE4 B;  1Z3U A;  2HPC C;  3HUS B;  1FZG C;  2J2P A;  3H32 B;  2Z4E C;  2HPC B;  2HOD C;  2J61 A;  1M1J B;  2J0Y A;  1FZG B;  2OYI B;  4NYT A;  1FZB C;  2J0G A;  2J61 B;  2Z4E B;  1RF0 C;  2HOD B;  1FZF C;  1RE4 C;  1FID A;  2J64 A;  4ZFG A;  1RF0 B;  2WNP F;  1FZF B;  3GHG B;  2J3F D;  2J3G A;  2HLO B;  1M1J C;  2OYI C;  1FIC A;  2FIB A;  2JHK F;  1FZA C;  2J3F A;  1N86 C;  1FZA B;  3E1I B;  3GHG C;  2J0H A; 
#chains in the Genus database with same CATH homology
 2HLO C;  2J3U A;  2J60 A;  1FZD A;  1N86 B;  1N73 C;  2Q9I B;  1LT9 C;  4JYO X;  2XNX B;  1FZE B;  2FFD C;  1LWU C;  3FIB A;  1N73 B;  1LT9 B;  2D39 A;  2FFD B;  2J1G A;  1LWU B;  3E1I C;  4R9T A;  1RE3 B;  2Q9I C;  1FIB A;  2GY7 A;  4M7F A;  2H43 B;  2XNX C;  1FZE C;  1Z3S A;  2J5Z A;  3BVH C;  2JHM F;  1FZC C;  2JHH C;  2OYH C;  1RE3 C;  1LTJ C;  4R9J A;  1JC9 A;  4JZC A;  3BVH B;  4M7H A;  1RF1 C;  1FZC B;  2H43 C;  2OYH B;  2JHL F;  1FZB B;  1LTJ B;  2JHI F;  2J3O A;  3HUS C;  1RF1 B;  4EPU A;  3H32 C;  1RE4 B;  1Z3U A;  2HPC C;  3HUS B;  1FZG C;  2J2P A;  3H32 B;  2Z4E C;  2HPC B;  2HOD C;  2J61 A;  1M1J B;  2J0Y A;  1FZG B;  2OYI B;  4NYT A;  1FZB C;  2J0G A;  2J61 B;  2Z4E B;  1RF0 C;  2HOD B;  1FZF C;  1RE4 C;  1FID A;  2J64 A;  4ZFG A;  1RF0 B;  2WNP F;  1FZF B;  2J3F D;  2J3G A;  2HLO B;  1M1J C;  2OYI C;  1FIC A;  2FIB A;  2JHK F;  1FZA C;  2J3F A;  1N86 C;  1FZA B;  3E1I B;  3GHG C;  2J0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...