2J61A

L-ficolin complexed to n-acetylglucosamine (forme c)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
216
structure length
216
Chain Sequence
CLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFRVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 70
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j61A01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j61A02
1RF0C 2J60A 1RF1C 2WNPF 2J1GA 1FZEB 3BVHC 2OYIB 1FZFB 1FZCC 1N86C 4EPUA 4JZCA 2XNXB 1FZGB 2XNXC 1FZAC 2J3OA 1FZBB 3E1IC 1LT9C 2FIBA 4M7HA 1RE4B 2J0YA 3GHGC 1FZEC 2FFDB 2J3FA 2JHKF 4ZFGA 2OYIC 1FZFC 2HODB 2HPCB 1LTJB 3H32B 2Z4EB 1JC9A 2HLOB 2J61A 1FZGC 2J3FD 1RE3B 1M1JB 1N73B 1Z3UA 1FZBC 1M1JC 2D39A 2OYHB 2J0GA 3HUSB 1FZDA 2J3UA 1FICA 2JHIF 1RE4C 2H43B 2JHHC 2FFDC 2H43C 4JYOX 1FIBA 2Q9IB 2HPCC 2HODC 1LTJC 2J5ZA 4R9TA 3H32C 2GY7A 2Z4EC 2HLOC 1RF0B 1RF1B 1RE3C 4R9JA 3FIBA 1N73C 3BVHB 2OYHC 3HUSC 2J0HA 4M7FA 1Z3SA 1FZCB 1N86B 2JHMF 2J64A 2JHLF 1LWUB 1FIDA 1LWUC 2Q9IC 1FZAB 3E1IB 2J2PA 4NYTA 2J3GA 2J61B 1LT9B
chains in the Genus database with same CATH superfamily
1RF0C 2J60A 1RF1C 2WNPF 2J1GA 3GHGB 1FZEB 3BVHC 2OYIB 1FZFB 1FZCC 1N86C 4EPUA 4JZCA 2XNXB 1FZGB 2XNXC 1FZAC 2J3OA 1FZBB 3E1IC 1LT9C 2FIBA 4M7HA 1RE4B 2J0YA 3GHGC 1FZEC 2FFDB 2J3FA 2JHKF 4ZFGA 2OYIC 1FZFC 2HODB 2HPCB 1LTJB 3H32B 2Z4EB 1JC9A 2HLOB 2J61A 1FZGC 2J3FD 1RE3B 1M1JB 1N73B 1Z3UA 1FZBC 1M1JC 2D39A 2OYHB 2J0GA 3HUSB 1FZDA 2J3UA 1FICA 2JHIF 1RE4C 2H43B 2JHHC 2FFDC 2H43C 4JYOX 1FIBA 2Q9IB 2HPCC 2HODC 1LTJC 2J5ZA 4R9TA 3H32C 2GY7A 2Z4EC 2HLOC 1RF0B 1RF1B 1RE3C 4R9JA 3FIBA 1N73C 3BVHB 2OYHC 3HUSC 2J0HA 4M7FA 1Z3SA 1FZCB 1N86B 2JHMF 2J64A 2JHLF 1LWUB 1FIDA 1LWUC 2Q9IC 1FZAB 3E1IB 2J2PA 4NYTA 2J3GA 2J61B 1LT9B
chains in the Genus database with same CATH topology
1RF0C 2J60A 1RF1C 2WNPF 2J1GA 1FZEB 3BVHC 2OYIB 1FZFB 1FZCC 1N86C 4EPUA 4JZCA 2XNXB 1FZGB 2XNXC 1FZAC 2J3OA 1FZBB 3E1IC 1LT9C 2FIBA 4M7HA 1RE4B 2J0YA 3GHGC 1FZEC 2FFDB 2J3FA 2JHKF 4ZFGA 2OYIC 1FZFC 2HODB 2HPCB 1LTJB 3H32B 2Z4EB 1JC9A 2HLOB 2J61A 1FZGC 2J3FD 1RE3B 1M1JB 1N73B 1Z3UA 1FZBC 1M1JC 2D39A 2OYHB 2J0GA 3HUSB 1FZDA 2J3UA 1FICA 2JHIF 1RE4C 2H43B 2JHHC 2FFDC 2H43C 4JYOX 1FIBA 2Q9IB 2HPCC 2HODC 1LTJC 2J5ZA 4R9TA 3H32C 2GY7A 2Z4EC 2HLOC 1RF0B 1RF1B 1RE3C 4R9JA 3FIBA 1N73C 3BVHB 2OYHC 3HUSC 2J0HA 4M7FA 1Z3SA 1FZCB 1N86B 2JHMF 2J64A 2JHLF 1LWUB 1FIDA 1LWUC 2Q9IC 1FZAB 3E1IB 2J2PA 4NYTA 2J3GA 2J61B 1LT9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 C;  2J60 A;  1RF1 C;  2WNP F;  2J1G A;  1FZE B;  3BVH C;  2OYI B;  1FZF B;  1FZC C;  1N86 C;  4EPU A;  4JZC A;  2XNX B;  1FZG B;  2XNX C;  1FZA C;  2J3O A;  1FZB B;  3E1I C;  1LT9 C;  2FIB A;  4M7H A;  1RE4 B;  2J0Y A;  3GHG C;  1FZE C;  2FFD B;  2J3F A;  2JHK F;  4ZFG A;  2OYI C;  1FZF C;  2HOD B;  2HPC B;  1LTJ B;  3H32 B;  2Z4E B;  1JC9 A;  2HLO B;  2J61 A;  1FZG C;  2J3F D;  1RE3 B;  1M1J B;  1N73 B;  1Z3U A;  1FZB C;  1M1J C;  2D39 A;  2OYH B;  2J0G A;  3HUS B;  1FZD A;  2J3U A;  1FIC A;  2JHI F;  1RE4 C;  2H43 B;  2JHH C;  2FFD C;  2H43 C;  4JYO X;  1FIB A;  2Q9I B;  2HPC C;  2HOD C;  1LTJ C;  2J5Z A;  4R9T A;  3H32 C;  2GY7 A;  2Z4E C;  2HLO C;  1RF0 B;  1RF1 B;  1RE3 C;  4R9J A;  3FIB A;  1N73 C;  3BVH B;  2OYH C;  3HUS C;  2J0H A;  4M7F A;  1Z3S A;  1FZC B;  1N86 B;  2JHM F;  2J64 A;  2JHL F;  1LWU B;  1FID A;  1LWU C;  2Q9I C;  1FZA B;  3E1I B;  2J2P A;  4NYT A;  2J3G A;  2J61 B;  1LT9 B; 
#chains in the Genus database with same CATH topology
 1RF0 C;  2J60 A;  1RF1 C;  2WNP F;  2J1G A;  3GHG B;  1FZE B;  3BVH C;  2OYI B;  1FZF B;  1FZC C;  1N86 C;  4EPU A;  4JZC A;  2XNX B;  1FZG B;  2XNX C;  1FZA C;  2J3O A;  1FZB B;  3E1I C;  1LT9 C;  2FIB A;  4M7H A;  1RE4 B;  2J0Y A;  3GHG C;  1FZE C;  2FFD B;  2J3F A;  2JHK F;  4ZFG A;  2OYI C;  1FZF C;  2HOD B;  2HPC B;  1LTJ B;  3H32 B;  2Z4E B;  1JC9 A;  2HLO B;  2J61 A;  1FZG C;  2J3F D;  1RE3 B;  1M1J B;  1N73 B;  1Z3U A;  1FZB C;  1M1J C;  2D39 A;  2OYH B;  2J0G A;  3HUS B;  1FZD A;  2J3U A;  1FIC A;  2JHI F;  1RE4 C;  2H43 B;  2JHH C;  2FFD C;  2H43 C;  4JYO X;  1FIB A;  2Q9I B;  2HPC C;  2HOD C;  1LTJ C;  2J5Z A;  4R9T A;  3H32 C;  2GY7 A;  2Z4E C;  2HLO C;  1RF0 B;  1RF1 B;  1RE3 C;  4R9J A;  3FIB A;  1N73 C;  3BVH B;  2OYH C;  3HUS C;  2J0H A;  4M7F A;  1Z3S A;  1FZC B;  1N86 B;  2JHM F;  2J64 A;  2JHL F;  1LWU B;  1FID A;  1LWU C;  2Q9I C;  1FZA B;  3E1I B;  2J2P A;  4NYT A;  2J3G A;  2J61 B;  1LT9 B; 
#chains in the Genus database with same CATH homology
 1RF0 C;  2J60 A;  1RF1 C;  2WNP F;  2J1G A;  1FZE B;  3BVH C;  2OYI B;  1FZF B;  1FZC C;  1N86 C;  4EPU A;  4JZC A;  2XNX B;  1FZG B;  2XNX C;  1FZA C;  2J3O A;  1FZB B;  3E1I C;  1LT9 C;  2FIB A;  4M7H A;  1RE4 B;  2J0Y A;  3GHG C;  1FZE C;  2FFD B;  2J3F A;  2JHK F;  4ZFG A;  2OYI C;  1FZF C;  2HOD B;  2HPC B;  1LTJ B;  3H32 B;  2Z4E B;  1JC9 A;  2HLO B;  2J61 A;  1FZG C;  2J3F D;  1RE3 B;  1M1J B;  1N73 B;  1Z3U A;  1FZB C;  1M1J C;  2D39 A;  2OYH B;  2J0G A;  3HUS B;  1FZD A;  2J3U A;  1FIC A;  2JHI F;  1RE4 C;  2H43 B;  2JHH C;  2FFD C;  2H43 C;  4JYO X;  1FIB A;  2Q9I B;  2HPC C;  2HOD C;  1LTJ C;  2J5Z A;  4R9T A;  3H32 C;  2GY7 A;  2Z4E C;  2HLO C;  1RF0 B;  1RF1 B;  1RE3 C;  4R9J A;  3FIB A;  1N73 C;  3BVH B;  2OYH C;  3HUS C;  2J0H A;  4M7F A;  1Z3S A;  1FZC B;  1N86 B;  2JHM F;  2J64 A;  2JHL F;  1LWU B;  1FID A;  1LWU C;  2Q9I C;  1FZA B;  3E1I B;  2J2P A;  4NYT A;  2J3G A;  2J61 B;  1LT9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...