1FZBC

Crystal structure of crosslinked fragment d
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
309
structure length
309
Chain Sequence
KMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN
publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 86
structure length 309
sequence length 309
chains with identical sequence F
ec nomenclature
pdb deposition date 1997-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzbC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzbC02
1FZBC 2J3OA 3H32C 2GY7A 3HUSB 4JYOX 4EPUA 2OYHB 2J0GA 2XNXC 2HPCB 2J3FD 1RE3C 4JZCA 1RE4C 2Q9IB 1JC9A 1FZAC 1N73C 3HUSC 1FZGC 2Z4EC 2J3GA 2OYHC 2J60A 3BVHB 1LT9B 2JHIF 2J1GA 2Q9IC 1Z3UA 2J64A 3E1IC 2J3FA 2J61A 2WNPF 1FZFC 2J2PA 4R9TA 2FIBA 2HLOB 1RF0B 4NYTA 3FIBA 3GHGC 2OYIB 2HPCC 2JHHC 2JHLF 2J5ZA 4R9JA 2HODB 2OYIC 3BVHC 2JHKF 1LWUB 1LT9C 1FZEB 2H43B 1RF1B 2FFDB 1FIDA 1FICA 1FZCB 1FZDA 3H32B 2JHMF 1LTJB 1M1JB 2HLOC 4M7FA 1RE4B 1FZAB 2J0HA 1FZCC 1Z3SA 1RF0C 1N73B 1FZGB 2Z4EB 4M7HA 1N86B 1LTJC 1M1JC 2J3UA 3E1IB 1FIBA 2J61B 1N86C 1FZBB 1FZFB 2HODC 2J0YA 1LWUC 1FZEC 2XNXB 4ZFGA 2H43C 1RE3B 1RF1C 2D39A 2FFDC
chains in the Genus database with same CATH superfamily
1FZBC 2J3OA 3H32C 2GY7A 3HUSB 4JYOX 4EPUA 3GHGB 2OYHB 2J0GA 2XNXC 2HPCB 2J3FD 1RE3C 4JZCA 1RE4C 2Q9IB 1JC9A 1FZAC 1N73C 3HUSC 1FZGC 2Z4EC 2J3GA 2OYHC 2J60A 3BVHB 1LT9B 2JHIF 2J1GA 2Q9IC 1Z3UA 2J64A 3E1IC 2J3FA 2J61A 2WNPF 1FZFC 2J2PA 4R9TA 2FIBA 2HLOB 1RF0B 4NYTA 3FIBA 3GHGC 2OYIB 2HPCC 2JHHC 2JHLF 2J5ZA 4R9JA 2HODB 2OYIC 3BVHC 2JHKF 1LWUB 1LT9C 1FZEB 2H43B 1RF1B 2FFDB 1FIDA 1FICA 1FZCB 1FZDA 3H32B 2JHMF 1LTJB 1M1JB 2HLOC 4M7FA 1RE4B 1FZAB 2J0HA 1FZCC 1Z3SA 1RF0C 1N73B 1FZGB 2Z4EB 4M7HA 1N86B 1LTJC 1M1JC 2J3UA 3E1IB 1FIBA 2J61B 1N86C 1FZBB 1FZFB 2HODC 2J0YA 1LWUC 1FZEC 2XNXB 4ZFGA 2H43C 1RE3B 1RF1C 2D39A 2FFDC
chains in the Genus database with same CATH topology
1FZBC 2J3OA 3H32C 2GY7A 3HUSB 4JYOX 4EPUA 2OYHB 2J0GA 2XNXC 2HPCB 2J3FD 1RE3C 4JZCA 1RE4C 2Q9IB 1JC9A 1FZAC 1N73C 3HUSC 1FZGC 2Z4EC 2J3GA 2OYHC 2J60A 3BVHB 1LT9B 2JHIF 2J1GA 2Q9IC 1Z3UA 2J64A 3E1IC 2J3FA 2J61A 2WNPF 1FZFC 2J2PA 4R9TA 2FIBA 2HLOB 1RF0B 4NYTA 3FIBA 3GHGC 2OYIB 2HPCC 2JHHC 2JHLF 2J5ZA 4R9JA 2HODB 2OYIC 3BVHC 2JHKF 1LWUB 1LT9C 1FZEB 2H43B 1RF1B 2FFDB 1FIDA 1FICA 1FZCB 1FZDA 3H32B 2JHMF 1LTJB 1M1JB 2HLOC 4M7FA 1RE4B 1FZAB 2J0HA 1FZCC 1Z3SA 1RF0C 1N73B 1FZGB 2Z4EB 4M7HA 1N86B 1LTJC 1M1JC 2J3UA 3E1IB 1FIBA 2J61B 1N86C 1FZBB 1FZFB 2HODC 2J0YA 1LWUC 1FZEC 2XNXB 4ZFGA 2H43C 1RE3B 1RF1C 2D39A 2FFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZB C;  2J3O A;  3H32 C;  2GY7 A;  3HUS B;  4JYO X;  4EPU A;  2OYH B;  2J0G A;  2XNX C;  2HPC B;  2J3F D;  1RE3 C;  4JZC A;  1RE4 C;  2Q9I B;  1JC9 A;  1FZA C;  1N73 C;  3HUS C;  1FZG C;  2Z4E C;  2J3G A;  2OYH C;  2J60 A;  3BVH B;  1LT9 B;  2JHI F;  2J1G A;  2Q9I C;  1Z3U A;  2J64 A;  3E1I C;  2J3F A;  2J61 A;  2WNP F;  1FZF C;  2J2P A;  4R9T A;  2FIB A;  2HLO B;  1RF0 B;  4NYT A;  3FIB A;  3GHG C;  2OYI B;  2HPC C;  2JHH C;  2JHL F;  2J5Z A;  4R9J A;  2HOD B;  2OYI C;  3BVH C;  2JHK F;  1LWU B;  1LT9 C;  1FZE B;  2H43 B;  1RF1 B;  2FFD B;  1FID A;  1FIC A;  1FZC B;  1FZD A;  3H32 B;  2JHM F;  1LTJ B;  1M1J B;  2HLO C;  4M7F A;  1RE4 B;  1FZA B;  2J0H A;  1FZC C;  1Z3S A;  1RF0 C;  1N73 B;  1FZG B;  2Z4E B;  4M7H A;  1N86 B;  1LTJ C;  1M1J C;  2J3U A;  3E1I B;  1FIB A;  2J61 B;  1N86 C;  1FZB B;  1FZF B;  2HOD C;  2J0Y A;  1LWU C;  1FZE C;  2XNX B;  4ZFG A;  2H43 C;  1RE3 B;  1RF1 C;  2D39 A;  2FFD C; 
#chains in the Genus database with same CATH topology
 1FZB C;  2J3O A;  3H32 C;  2GY7 A;  3HUS B;  4JYO X;  4EPU A;  3GHG B;  2OYH B;  2J0G A;  2XNX C;  2HPC B;  2J3F D;  1RE3 C;  4JZC A;  1RE4 C;  2Q9I B;  1JC9 A;  1FZA C;  1N73 C;  3HUS C;  1FZG C;  2Z4E C;  2J3G A;  2OYH C;  2J60 A;  3BVH B;  1LT9 B;  2JHI F;  2J1G A;  2Q9I C;  1Z3U A;  2J64 A;  3E1I C;  2J3F A;  2J61 A;  2WNP F;  1FZF C;  2J2P A;  4R9T A;  2FIB A;  2HLO B;  1RF0 B;  4NYT A;  3FIB A;  3GHG C;  2OYI B;  2HPC C;  2JHH C;  2JHL F;  2J5Z A;  4R9J A;  2HOD B;  2OYI C;  3BVH C;  2JHK F;  1LWU B;  1LT9 C;  1FZE B;  2H43 B;  1RF1 B;  2FFD B;  1FID A;  1FIC A;  1FZC B;  1FZD A;  3H32 B;  2JHM F;  1LTJ B;  1M1J B;  2HLO C;  4M7F A;  1RE4 B;  1FZA B;  2J0H A;  1FZC C;  1Z3S A;  1RF0 C;  1N73 B;  1FZG B;  2Z4E B;  4M7H A;  1N86 B;  1LTJ C;  1M1J C;  2J3U A;  3E1I B;  1FIB A;  2J61 B;  1N86 C;  1FZB B;  1FZF B;  2HOD C;  2J0Y A;  1LWU C;  1FZE C;  2XNX B;  4ZFG A;  2H43 C;  1RE3 B;  1RF1 C;  2D39 A;  2FFD C; 
#chains in the Genus database with same CATH homology
 1FZB C;  2J3O A;  3H32 C;  2GY7 A;  3HUS B;  4JYO X;  4EPU A;  2OYH B;  2J0G A;  2XNX C;  2HPC B;  2J3F D;  1RE3 C;  4JZC A;  1RE4 C;  2Q9I B;  1JC9 A;  1FZA C;  1N73 C;  3HUS C;  1FZG C;  2Z4E C;  2J3G A;  2OYH C;  2J60 A;  3BVH B;  1LT9 B;  2JHI F;  2J1G A;  2Q9I C;  1Z3U A;  2J64 A;  3E1I C;  2J3F A;  2J61 A;  2WNP F;  1FZF C;  2J2P A;  4R9T A;  2FIB A;  2HLO B;  1RF0 B;  4NYT A;  3FIB A;  3GHG C;  2OYI B;  2HPC C;  2JHH C;  2JHL F;  2J5Z A;  4R9J A;  2HOD B;  2OYI C;  3BVH C;  2JHK F;  1LWU B;  1LT9 C;  1FZE B;  2H43 B;  1RF1 B;  2FFD B;  1FID A;  1FIC A;  1FZC B;  1FZD A;  3H32 B;  2JHM F;  1LTJ B;  1M1J B;  2HLO C;  4M7F A;  1RE4 B;  1FZA B;  2J0H A;  1FZC C;  1Z3S A;  1RF0 C;  1N73 B;  1FZG B;  2Z4E B;  4M7H A;  1N86 B;  1LTJ C;  1M1J C;  2J3U A;  3E1I B;  1FIB A;  2J61 B;  1N86 C;  1FZB B;  1FZF B;  2HOD C;  2J0Y A;  1LWU C;  1FZE C;  2XNX B;  4ZFG A;  2H43 C;  1RE3 B;  1RF1 C;  2D39 A;  2FFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...