2HLOB

Crystal structure of fragment d-dimer from human fibrin complexed with gly-hydroxypro-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
303
structure length
303
Chain Sequence
VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrin alpha chain
molecule tags Blood clotting
total genus 91
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hloB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hloB02
1JC9A 2J0GA 2J0HA 4JYOX 1FZDA 2HODB 4EPUA 1FZEC 2GY7A 2Z4EB 2J60A 1N86C 3E1IB 1RF0B 2J61A 1FZGC 1LTJB 1N86B 2Z4EC 2Q9IB 3E1IC 2J1GA 4ZFGA 2JHKF 1RF0C 2J64A 1FICA 1FZGB 3GHGC 1RE3B 1LTJC 2JHLF 2XNXC 1LT9B 2J61B 2HPCB 2J5ZA 2Q9IC 2JHMF 1Z3UA 2J0YA 4R9JA 1FIDA 3BVHC 3H32B 2OYIB 4NYTA 2J3OA 2XNXB 1RE3C 1Z3SA 2J3FA 1LT9C 2H43B 1RE4C 2HPCC 2FIBA 2WNPF 3BVHB 1FZCC 3H32C 2J3UA 2OYIC 2J2PA 1RE4B 4M7FA 4JZCA 2J3FD 2H43C 2OYHB 3HUSC 1FIBA 1M1JB 1FZCB 2FFDB 1FZBB 2JHIF 1FZFC 4R9TA 3FIBA 1RF1C 3HUSB 1N73B 2HLOC 2OYHC 1LWUC 2J3GA 1FZAC 1M1JC 1FZFB 2FFDC 4M7HA 1FZBC 2D39A 1RF1B 2HLOB 1N73C 1LWUB 1FZAB 1FZEB 2JHHC 2HODC
chains in the Genus database with same CATH superfamily
1JC9A 2J0GA 2J0HA 4JYOX 1FZDA 2HODB 4EPUA 1FZEC 2GY7A 2Z4EB 2J60A 1N86C 3E1IB 1RF0B 2J61A 1FZGC 1LTJB 1N86B 2Z4EC 2Q9IB 3E1IC 2J1GA 4ZFGA 2JHKF 1RF0C 2J64A 1FICA 1FZGB 3GHGC 1RE3B 1LTJC 2JHLF 2XNXC 1LT9B 2J61B 2HPCB 2J5ZA 2Q9IC 2JHMF 1Z3UA 2J0YA 4R9JA 1FIDA 3GHGB 3BVHC 3H32B 2OYIB 4NYTA 2J3OA 2XNXB 1RE3C 1Z3SA 2J3FA 1LT9C 2H43B 1RE4C 2HPCC 2FIBA 2WNPF 3BVHB 1FZCC 3H32C 2J3UA 2OYIC 2J2PA 1RE4B 4M7FA 4JZCA 2J3FD 2H43C 2OYHB 3HUSC 1FIBA 1M1JB 1FZCB 2FFDB 1FZBB 2JHIF 1FZFC 4R9TA 3FIBA 1RF1C 3HUSB 1N73B 2HLOC 2OYHC 1LWUC 2J3GA 1FZAC 1M1JC 1FZFB 2FFDC 4M7HA 1FZBC 2D39A 1RF1B 2HLOB 1N73C 1LWUB 1FZAB 1FZEB 2JHHC 2HODC
chains in the Genus database with same CATH topology
1JC9A 2J0GA 2J0HA 4JYOX 1FZDA 2HODB 4EPUA 1FZEC 2GY7A 2Z4EB 2J60A 1N86C 3E1IB 1RF0B 2J61A 1FZGC 1LTJB 1N86B 2Z4EC 2Q9IB 3E1IC 2J1GA 4ZFGA 2JHKF 1RF0C 2J64A 1FICA 1FZGB 3GHGC 1RE3B 1LTJC 2JHLF 2XNXC 1LT9B 2J61B 2HPCB 2J5ZA 2Q9IC 2JHMF 1Z3UA 2J0YA 4R9JA 1FIDA 3BVHC 3H32B 2OYIB 4NYTA 2J3OA 2XNXB 1RE3C 1Z3SA 2J3FA 1LT9C 2H43B 1RE4C 2HPCC 2FIBA 2WNPF 3BVHB 1FZCC 3H32C 2J3UA 2OYIC 2J2PA 1RE4B 4M7FA 4JZCA 2J3FD 2H43C 2OYHB 3HUSC 1FIBA 1M1JB 1FZCB 2FFDB 1FZBB 2JHIF 1FZFC 4R9TA 3FIBA 1RF1C 3HUSB 1N73B 2HLOC 2OYHC 1LWUC 2J3GA 1FZAC 1M1JC 1FZFB 2FFDC 4M7HA 1FZBC 2D39A 1RF1B 2HLOB 1N73C 1LWUB 1FZAB 1FZEB 2JHHC 2HODC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JC9 A;  2J0G A;  2J0H A;  4JYO X;  1FZD A;  2HOD B;  4EPU A;  1FZE C;  2GY7 A;  2Z4E B;  2J60 A;  1N86 C;  3E1I B;  1RF0 B;  2J61 A;  1FZG C;  1LTJ B;  1N86 B;  2Z4E C;  2Q9I B;  3E1I C;  2J1G A;  4ZFG A;  2JHK F;  1RF0 C;  2J64 A;  1FIC A;  1FZG B;  3GHG C;  1RE3 B;  1LTJ C;  2JHL F;  2XNX C;  1LT9 B;  2J61 B;  2HPC B;  2J5Z A;  2Q9I C;  2JHM F;  1Z3U A;  2J0Y A;  4R9J A;  1FID A;  3BVH C;  3H32 B;  2OYI B;  4NYT A;  2J3O A;  2XNX B;  1RE3 C;  1Z3S A;  2J3F A;  1LT9 C;  2H43 B;  1RE4 C;  2HPC C;  2FIB A;  2WNP F;  3BVH B;  1FZC C;  3H32 C;  2J3U A;  2OYI C;  2J2P A;  1RE4 B;  4M7F A;  4JZC A;  2J3F D;  2H43 C;  2OYH B;  3HUS C;  1FIB A;  1M1J B;  1FZC B;  2FFD B;  1FZB B;  2JHI F;  1FZF C;  4R9T A;  3FIB A;  1RF1 C;  3HUS B;  1N73 B;  2HLO C;  2OYH C;  1LWU C;  2J3G A;  1FZA C;  1M1J C;  1FZF B;  2FFD C;  4M7H A;  1FZB C;  2D39 A;  1RF1 B;  2HLO B;  1N73 C;  1LWU B;  1FZA B;  1FZE B;  2JHH C;  2HOD C; 
#chains in the Genus database with same CATH topology
 1JC9 A;  2J0G A;  2J0H A;  4JYO X;  1FZD A;  2HOD B;  4EPU A;  1FZE C;  2GY7 A;  2Z4E B;  2J60 A;  1N86 C;  3E1I B;  1RF0 B;  2J61 A;  1FZG C;  1LTJ B;  1N86 B;  2Z4E C;  2Q9I B;  3E1I C;  2J1G A;  4ZFG A;  2JHK F;  1RF0 C;  2J64 A;  1FIC A;  1FZG B;  3GHG C;  1RE3 B;  1LTJ C;  2JHL F;  2XNX C;  1LT9 B;  2J61 B;  2HPC B;  2J5Z A;  2Q9I C;  2JHM F;  1Z3U A;  2J0Y A;  4R9J A;  1FID A;  3GHG B;  3BVH C;  3H32 B;  2OYI B;  4NYT A;  2J3O A;  2XNX B;  1RE3 C;  1Z3S A;  2J3F A;  1LT9 C;  2H43 B;  1RE4 C;  2HPC C;  2FIB A;  2WNP F;  3BVH B;  1FZC C;  3H32 C;  2J3U A;  2OYI C;  2J2P A;  1RE4 B;  4M7F A;  4JZC A;  2J3F D;  2H43 C;  2OYH B;  3HUS C;  1FIB A;  1M1J B;  1FZC B;  2FFD B;  1FZB B;  2JHI F;  1FZF C;  4R9T A;  3FIB A;  1RF1 C;  3HUS B;  1N73 B;  2HLO C;  2OYH C;  1LWU C;  2J3G A;  1FZA C;  1M1J C;  1FZF B;  2FFD C;  4M7H A;  1FZB C;  2D39 A;  1RF1 B;  2HLO B;  1N73 C;  1LWU B;  1FZA B;  1FZE B;  2JHH C;  2HOD C; 
#chains in the Genus database with same CATH homology
 1JC9 A;  2J0G A;  2J0H A;  4JYO X;  1FZD A;  2HOD B;  4EPU A;  1FZE C;  2GY7 A;  2Z4E B;  2J60 A;  1N86 C;  3E1I B;  1RF0 B;  2J61 A;  1FZG C;  1LTJ B;  1N86 B;  2Z4E C;  2Q9I B;  3E1I C;  2J1G A;  4ZFG A;  2JHK F;  1RF0 C;  2J64 A;  1FIC A;  1FZG B;  3GHG C;  1RE3 B;  1LTJ C;  2JHL F;  2XNX C;  1LT9 B;  2J61 B;  2HPC B;  2J5Z A;  2Q9I C;  2JHM F;  1Z3U A;  2J0Y A;  4R9J A;  1FID A;  3BVH C;  3H32 B;  2OYI B;  4NYT A;  2J3O A;  2XNX B;  1RE3 C;  1Z3S A;  2J3F A;  1LT9 C;  2H43 B;  1RE4 C;  2HPC C;  2FIB A;  2WNP F;  3BVH B;  1FZC C;  3H32 C;  2J3U A;  2OYI C;  2J2P A;  1RE4 B;  4M7F A;  4JZC A;  2J3F D;  2H43 C;  2OYH B;  3HUS C;  1FIB A;  1M1J B;  1FZC B;  2FFD B;  1FZB B;  2JHI F;  1FZF C;  4R9T A;  3FIB A;  1RF1 C;  3HUS B;  1N73 B;  2HLO C;  2OYH C;  1LWU C;  2J3G A;  1FZA C;  1M1J C;  1FZF B;  2FFD C;  4M7H A;  1FZB C;  2D39 A;  1RF1 B;  2HLO B;  1N73 C;  1LWU B;  1FZA B;  1FZE B;  2JHH C;  2HOD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...