2JHHC

Structure of globular heads of m-ficolin at acidic ph
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
217
structure length
208
Chain Sequence
SCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRTDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-1
publication title Structural basis for innate immune sensing by M-ficolin and its control by a pH-dependent conformational switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 59
structure length 208
sequence length 217
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2jhhC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2jhhC02
1FZCC 2HPCB 2OYHC 2J0GA 2JHHC 1RF0B 3HUSB 2JHIF 2FFDB 2Z4EB 2Q9IC 1LWUB 1Z3SA 2JHKF 1LT9C 2J3FA 1N73B 1JC9A 3H32C 1RF1C 1N86B 1M1JC 1FZGB 4EPUA 4M7HA 4ZFGA 2J3UA 1FZBC 2J3FD 2OYIC 2JHMF 2J5ZA 2GY7A 2J61A 1FZAB 3E1IB 2J3GA 1RE3B 2HODC 2HPCC 1FZEB 3BVHB 1RE4B 1RF0C 2FFDC 4JZCA 4R9TA 2Z4EC 1FZFB 1LWUC 2HLOC 2J0HA 1Z3UA 2Q9IB 2J60A 1LT9B 2XNXB 2D39A 2J61B 1FICA 1LTJB 2H43C 3H32B 1RF1B 4M7FA 3HUSC 1FZCB 1FZDA 2OYHB 1RE3C 1FZEC 2J0YA 3BVHC 1RE4C 2JHLF 2FIBA 2HODB 1FZFC 1N73C 1N86C 1FIDA 2HLOB 4NYTA 1FZGC 2WNPF 1M1JB 4JYOX 2XNXC 3GHGC 1FZBB 1LTJC 1FZAC 1FIBA 2J1GA 2OYIB 3E1IC 2J2PA 2J3OA 4R9JA 2J64A 3FIBA 2H43B
chains in the Genus database with same CATH superfamily
1FZCC 2HPCB 2OYHC 2J0GA 2JHHC 1RF0B 3HUSB 2JHIF 2FFDB 2Z4EB 2Q9IC 1LWUB 1Z3SA 2JHKF 1LT9C 2J3FA 1N73B 1JC9A 3H32C 1RF1C 1N86B 1M1JC 1FZGB 4EPUA 4M7HA 4ZFGA 2J3UA 1FZBC 2J3FD 2OYIC 2JHMF 2J5ZA 2GY7A 2J61A 1FZAB 3E1IB 2J3GA 1RE3B 2HODC 2HPCC 1FZEB 3BVHB 1RE4B 1RF0C 2FFDC 4JZCA 4R9TA 2Z4EC 1FZFB 1LWUC 2HLOC 2J0HA 1Z3UA 2Q9IB 2J60A 1LT9B 2XNXB 3GHGB 2D39A 2J61B 1FICA 1LTJB 2H43C 3H32B 1RF1B 4M7FA 3HUSC 1FZCB 1FZDA 2OYHB 1RE3C 1FZEC 2J0YA 3BVHC 1RE4C 2JHLF 2FIBA 2HODB 1FZFC 1N73C 1N86C 1FIDA 2HLOB 4NYTA 1FZGC 2WNPF 1M1JB 4JYOX 2XNXC 3GHGC 1FZBB 1LTJC 1FZAC 1FIBA 2J1GA 2OYIB 3E1IC 2J2PA 2J3OA 4R9JA 2J64A 3FIBA 2H43B
chains in the Genus database with same CATH topology
1FZCC 2HPCB 2OYHC 2J0GA 2JHHC 1RF0B 3HUSB 2JHIF 2FFDB 2Z4EB 2Q9IC 1LWUB 1Z3SA 2JHKF 1LT9C 2J3FA 1N73B 1JC9A 3H32C 1RF1C 1N86B 1M1JC 1FZGB 4EPUA 4M7HA 4ZFGA 2J3UA 1FZBC 2J3FD 2OYIC 2JHMF 2J5ZA 2GY7A 2J61A 1FZAB 3E1IB 2J3GA 1RE3B 2HODC 2HPCC 1FZEB 3BVHB 1RE4B 1RF0C 2FFDC 4JZCA 4R9TA 2Z4EC 1FZFB 1LWUC 2HLOC 2J0HA 1Z3UA 2Q9IB 2J60A 1LT9B 2XNXB 2D39A 2J61B 1FICA 1LTJB 2H43C 3H32B 1RF1B 4M7FA 3HUSC 1FZCB 1FZDA 2OYHB 1RE3C 1FZEC 2J0YA 3BVHC 1RE4C 2JHLF 2FIBA 2HODB 1FZFC 1N73C 1N86C 1FIDA 2HLOB 4NYTA 1FZGC 2WNPF 1M1JB 4JYOX 2XNXC 3GHGC 1FZBB 1LTJC 1FZAC 1FIBA 2J1GA 2OYIB 3E1IC 2J2PA 2J3OA 4R9JA 2J64A 3FIBA 2H43B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZC C;  2HPC B;  2OYH C;  2J0G A;  2JHH C;  1RF0 B;  3HUS B;  2JHI F;  2FFD B;  2Z4E B;  2Q9I C;  1LWU B;  1Z3S A;  2JHK F;  1LT9 C;  2J3F A;  1N73 B;  1JC9 A;  3H32 C;  1RF1 C;  1N86 B;  1M1J C;  1FZG B;  4EPU A;  4M7H A;  4ZFG A;  2J3U A;  1FZB C;  2J3F D;  2OYI C;  2JHM F;  2J5Z A;  2GY7 A;  2J61 A;  1FZA B;  3E1I B;  2J3G A;  1RE3 B;  2HOD C;  2HPC C;  1FZE B;  3BVH B;  1RE4 B;  1RF0 C;  2FFD C;  4JZC A;  4R9T A;  2Z4E C;  1FZF B;  1LWU C;  2HLO C;  2J0H A;  1Z3U A;  2Q9I B;  2J60 A;  1LT9 B;  2XNX B;  2D39 A;  2J61 B;  1FIC A;  1LTJ B;  2H43 C;  3H32 B;  1RF1 B;  4M7F A;  3HUS C;  1FZC B;  1FZD A;  2OYH B;  1RE3 C;  1FZE C;  2J0Y A;  3BVH C;  1RE4 C;  2JHL F;  2FIB A;  2HOD B;  1FZF C;  1N73 C;  1N86 C;  1FID A;  2HLO B;  4NYT A;  1FZG C;  2WNP F;  1M1J B;  4JYO X;  2XNX C;  3GHG C;  1FZB B;  1LTJ C;  1FZA C;  1FIB A;  2J1G A;  2OYI B;  3E1I C;  2J2P A;  2J3O A;  4R9J A;  2J64 A;  3FIB A;  2H43 B; 
#chains in the Genus database with same CATH topology
 1FZC C;  2HPC B;  2OYH C;  2J0G A;  2JHH C;  1RF0 B;  3HUS B;  2JHI F;  2FFD B;  2Z4E B;  2Q9I C;  1LWU B;  1Z3S A;  2JHK F;  1LT9 C;  2J3F A;  1N73 B;  1JC9 A;  3H32 C;  1RF1 C;  1N86 B;  1M1J C;  1FZG B;  4EPU A;  4M7H A;  4ZFG A;  2J3U A;  1FZB C;  2J3F D;  2OYI C;  2JHM F;  2J5Z A;  2GY7 A;  2J61 A;  1FZA B;  3E1I B;  2J3G A;  1RE3 B;  2HOD C;  2HPC C;  1FZE B;  3BVH B;  1RE4 B;  1RF0 C;  2FFD C;  4JZC A;  4R9T A;  2Z4E C;  1FZF B;  1LWU C;  2HLO C;  2J0H A;  1Z3U A;  2Q9I B;  2J60 A;  1LT9 B;  2XNX B;  3GHG B;  2D39 A;  2J61 B;  1FIC A;  1LTJ B;  2H43 C;  3H32 B;  1RF1 B;  4M7F A;  3HUS C;  1FZC B;  1FZD A;  2OYH B;  1RE3 C;  1FZE C;  2J0Y A;  3BVH C;  1RE4 C;  2JHL F;  2FIB A;  2HOD B;  1FZF C;  1N73 C;  1N86 C;  1FID A;  2HLO B;  4NYT A;  1FZG C;  2WNP F;  1M1J B;  4JYO X;  2XNX C;  3GHG C;  1FZB B;  1LTJ C;  1FZA C;  1FIB A;  2J1G A;  2OYI B;  3E1I C;  2J2P A;  2J3O A;  4R9J A;  2J64 A;  3FIB A;  2H43 B; 
#chains in the Genus database with same CATH homology
 1FZC C;  2HPC B;  2OYH C;  2J0G A;  2JHH C;  1RF0 B;  3HUS B;  2JHI F;  2FFD B;  2Z4E B;  2Q9I C;  1LWU B;  1Z3S A;  2JHK F;  1LT9 C;  2J3F A;  1N73 B;  1JC9 A;  3H32 C;  1RF1 C;  1N86 B;  1M1J C;  1FZG B;  4EPU A;  4M7H A;  4ZFG A;  2J3U A;  1FZB C;  2J3F D;  2OYI C;  2JHM F;  2J5Z A;  2GY7 A;  2J61 A;  1FZA B;  3E1I B;  2J3G A;  1RE3 B;  2HOD C;  2HPC C;  1FZE B;  3BVH B;  1RE4 B;  1RF0 C;  2FFD C;  4JZC A;  4R9T A;  2Z4E C;  1FZF B;  1LWU C;  2HLO C;  2J0H A;  1Z3U A;  2Q9I B;  2J60 A;  1LT9 B;  2XNX B;  2D39 A;  2J61 B;  1FIC A;  1LTJ B;  2H43 C;  3H32 B;  1RF1 B;  4M7F A;  3HUS C;  1FZC B;  1FZD A;  2OYH B;  1RE3 C;  1FZE C;  2J0Y A;  3BVH C;  1RE4 C;  2JHL F;  2FIB A;  2HOD B;  1FZF C;  1N73 C;  1N86 C;  1FID A;  2HLO B;  4NYT A;  1FZG C;  2WNP F;  1M1J B;  4JYO X;  2XNX C;  3GHG C;  1FZB B;  1LTJ C;  1FZA C;  1FIB A;  2J1G A;  2OYI B;  3E1I C;  2J2P A;  2J3O A;  4R9J A;  2J64 A;  3FIB A;  2H43 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...