1LWUC

Crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRPCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha-1 chain
publication title Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide.
pubmed doi rcsb
total genus 84
structure length 317
sequence length 317
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2002-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lwuC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lwuC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lwuC02
1Z3UA 1FZCC 1Z3SA 1FIDA 4ZFGA 1FZCB 1T3UA 1FZBC 1FIBA 1JY3O 1FZBB 3FIBA 1FZEA 2J60A 4JZCA 1LT9A 3E1IA 2J0HA 1FZFC 2J61B 2FFDA 1FZFB 1FZAA 1JY3N 1LWUC 1JY3P 1LWUB 3BVHC 3BVHB 1FZAC 3GHGC 2GY7A 2J3OA 2JHIF 1FZAB 1FZBA 3GHGB 2A45G 2J3GA 2J61A 2JHHC 1FZFA 1RF1C 2Q9IC 1LWUA 1JY2O 2Q9IB 1RE4C 1RF0C 3BVHA 1RE4B 1RF0B 4JYOX 2J2PA 2JHLF 2J0GA 4NYTA 3GHGA 1JC9A 2D39A 2HLOC 1JY2N 1JY2P 2HLOB 2HPCC 1RF1A 2HPCB 2OYIC 1N73C 2OYIB 4EPUA 2Q9IA 1N73B 1FICA 2OYHA 1RE4A 1RF0A 2J3FA 1RE3A 1N86C 1RF1B 2Z4EC 1N86B 2HODC 2Z4EB 2J64A 2HLOA 2OYHC 2HPCA 2OYHB 1RE3C 2FIBA 2H43C 1RE3B 2OYIA 1FZGC 2H43B 1N73A 1FZGB 2A45H 2JHMF 2XNXC 2J3FD 2JHKF 1W2EA 2WNPF 1LTJC 3HUSC 1N86A 4M7FA 2Z4EA 1M1JA 1LTJB 3HUSB 2HODA 3H32A 4R9TA 2J1GA 4M7HA 1FZDA 4R9JA 2H43A 1M1JC 1FZGA 2A45I 1M1JB 3H32C 2HODB 2XNXA 3H32B 1FZEC 2J0YA 1LT9C 3E1IC 1LTJA 3HUSA 1FZEB 2FFDC 1FZCA 1LT9B 3E1IB 2FFDB 2J3UA 2J5ZA 2XNXB
chains in the Genus database with same CATH superfamily
2FBWC 2WTYA 2OGUA 1SFCC 1KB9E 2L91A 2C9NY 2XKMA 2RN0A 4PD4D 3E1IA 4B86A 2E75D 3H6PA 2NPSC 1RQUA 2QM7A 1JY3P 1LWUB 1CI6B 4KT0J 4L76A 2J59M 1U57A 3CCEP 2JKVA 3KPEA 5AW2B 3HE5B 1Y8AA 5E79H 4AQRD 2Q9IB 1KD1Q 3S9OA 5KAFE 1SQQG 2P58A 2Y0CA 4ASVA 2LXCB 4W7ZA 1GMJA 3R2PA 2LXBA 1NH4A 2ZT9B 1BSHA 1G2CB 1RHZB 1NTKE 3T97B 5APSA 1J1EB 2YNYA 3CXHI 1N73A 1GZLA 1Q82Q 3B5NB 2PAJA 3HUSC 3IR9A 3VMZA 2HG5D 2IYPA 1UIXA 2IBZG 2M5AB 1QL1A 3E1IC 1LT9B 3UIAA 4N6JA 4C46A 2QE7H 2AEMA 2B87B 5GTIH 1Z3SA 3GF3A 3PLNA 4H44B 2J60A 4JZCA 5B66E 3L75G 4XA4A 3L73J 3V2RA 1HH0A 1GW4A 1GL2D 2M8RA 2ZAEB 1FZBA 4I2LC 2M0BA 2JHHC 2QJPB 3AE4C 3VMAA 2FXPA 2E74C 1ZRTD 1SFCD 3RBXA 5KLVE 3A7OA 3ITKA 2YXRB 3SWFA 5M1BA 2J0GA 4XE5B 1HGVA 3VOPA 1Q81Q 2Q5UA 1NTKK 2NPSD 4BXLA 1N73C 5KLVG 3H1IJ 3D71A 3OJAB 3V5BA 4HJGH 5CCHA 3BCCE 2KK7A 2VRSA 5GTHE 2Z4EB 3H1ID 3A0BH 2OYHC 1A02J 4EI2A 5APXA 5KLIB 1JTHA 3BCCG 2Y9YA 1K73Q 1QL2A 3L72E 1CW5A 1AVOA 1PZQA 2H7HA 1GW3A 3KDPB 3CMAP 1L0ND 3TGUJ 3L73E 1FZGA 2A45I 1TU3F 4UB6H 3H32C 3L72G 2XNXA 1OX3A 1PV3A 3TGUD 1FZEB 2WPSA 2C0WA 1IFJA 2J5ZA 2R3SA 3V4QA 1L0LJ 4ZMDA 3MTUE 4WY4B 1FZBC 4H0LC 1L0LD 1H0TA 3A0HE 1YBKA 4D6TE 1FZAA 1VL2A 3VN0A 3WUUA 3PHLA 2O1KA 2NRGA 1URQB 2KS1B 3CXHH 3RK2C 3ZDMA 2FY8A 5KLVK 4D6TG 1EDKA 3D70A 2FYUD 3AE3C 5CJ0A 1YTZI 5CCHC 1VF5C 3GHGA 1QEXA 1RH5B 2QIWA 1FBMA 3RGUA 1VQOP 1KYOD 3KYQA 2E76C 4H13C 3H1HG 2WZ7A 4UB6E 1AV1A 3W67A 1N86B 1KILB 1IFMA 2V7QJ 3VTPC 2E5YA 1SLQA 2E74D 1FZGC 1YTZT 2XNXC 1BCCD 1SQXD 5CJ4A 2JHKF 1CZQA 1W2EA 1IZNB 3CPWO 3M9BA 2E75B 3GMAA 1VQKP 1NTMG 1WMKA 2BCCJ 1T3JA 1LTJA 3CXHE 1LP1A 2BCCD 2YIUC 4EIJA 3M0DA 1NJIQ 3V2QA 2KB7P 2OARA 4ZFGA 1NKNA 4NPEA 1JMMA 4U7JA 2ZT9D 1LTSC 3HD7A 1OWAA 2GA1A 2BASA 3P8CD 5CMZA 5CCGA 3GHGC 1OW7A 2LKMA 3G3ZA 4XFJA 2AEJA 3H25A 2JWAA 2IDBA 2P2UA 4H0LD 3QH9A 4DCKA 3AEFC 1S3JA 3QWOC 2O01N 3LW5H 2PGDA 2KSEA 3LW5J 4DOJA 3L36A 1L0LK 1LTIC 3CCJP 5TISH 1KQLA 3RBZA 3RK2D 4JBZA 1U7MA 2FXMA 4N78D 2QRXA 1JCCA 1RE3C 4H44D 1K9MQ 2OYIA 3NXSA 1VF5D 5CCHD 2WNPF 1LTJC 2O3JA 2D2CB 2WPVB 1S5LX 1H89A 1BE3E 3H1KJ 3M0DC 1NU1E 5AVVB 1PGPA 1PL5A 1J1DB 4C7NB 2E76D 1VQ6P 1FJPA 4H13D 2QJKC 1BDCA 1EDLA 1KQFB 1MKMA 5KKZB 1DIPA 2YMKA 1BE3G 1GL2B 1NU1G 4OWFA 2J3UA 1N2DC 3AEBC 1M7LA 1FZCC 2WPQA 1SFCB 5CCGC 4JYBA 3C1LA 1FIBA 3HTKB 2N9YB 2Q1KA 4I1LA 3NMDA 1NTZE 2NPSB 2IFMA 3L74E 1FU1A 1EZVD 2A45G 2J61A 1GK4A 1S9KE 2XZRA 1NTZG 1MUUA 2KYVA 2Z5IA 1UIIA 4NYTA 1SQVE 3H1KE 1IC2A 2YO2A 4U3FE 2FYNC 3FGAD 2OYIC 4WWIA 2KLVA 4NPFX 1ZXGA 1SQVG 4U3FG 3TNUA 2H8PD 1NU1K 1S4XA 3HRNA 3N4XA 2OTKE 1KZUB 4M7FA 5L8RJ 1LJ2A 1KB9D 1M1JA 3HUSB 2HODA 3M91A 4JYCA 3CMEP 1IJDB 1IFNA 3Q3DA 3USSA 2WMMA 2KNCB 1Z56A 2KUBA 4BRYB 3IAOA 1SQQJ 1HVVA 1LTBC 5KTBA 1K04A 3E1IB 2C0XA 4QMAA 1FJKA 4HYTB 1KQGB 1K8AQ 3M9HA 2QG4A 1SVFA 1EXJA 2FKWB 3CWBE 2Y9ZA 5AVSB 5AW3B 2AXTH 3MD0A 1NAFA 5APQA 1BGYG 3CWBG 5AW7B 1L4AC 3L70E 2ZYGA 4OH8B 4GDOA 1SQVK 2QJYC 1NTKD 4RJTA 3O6QB 1R5SA 2E74B 2I1KA 1JOCA 5AVUB 1WRGA 3L70G 4IOIH 1RQVA 4RESB 2ZVNB 1AA0A 1IK7A 3L71E 4WBAA 4KJMA 5AVRB 1N73B 1FICA 1SQQE 1RE4A 1RF0A 4AUWA 2H88C 2HODC 2FYZA 2BEQD 3U59A 3L71G 3E7KA 2OYHB 3L75J 3VP8A 2ZFCA 2Y0DA 5B66H 3WMM0 4NPDA 2K1AA 1NGMB 1IFDA 1PFIA 1PP9G 4R9TA 2W83C 2IZ0A 2AXTE 3A5TA 2KIKA 3B71A 1ZR4A 1FE6A 3H32B 5AVQB 2P1JA 1XTCC 2IZ1A 3TDKA 5KLVJ 3CX5I 2IBZE 2YMYA 1ZP0C 1SQBG 1FOSF 1FDIA 2Z5HA 5KLVD 1FZBB 4H0LB 1CI6A 5GTHH 1HF9A 1LTTC 1VQLP 1YIJP 3BCCJ 3S4RA 1FS0E 1HBWA 3M06A 3EQ2A 3MP7B 3RK2B 3BCCD 3L75E 4ZKPA 4L74A 2Y0EA 2D2CD 3AE5C 4M3LA 2WSEH 1JY2O 3L72J 1RE4C 1RF0C 2KZJA 1LTAC 1VF5B 1MV8A 1SQQK 1NAYA 1OW8A 1JY2N 3L72D 3M0AA 3KHUA 2WT7A 3TK1A 3P32A 3WUVA 3T97A 4LGDE 2IPPA 4DZOA 1JTHB 2E76B 3CL3D 3L73D 4H13B 1L4AD 3AEGC 1M57D 4PV1C 3CLQA 2FIBA 3A0HH 3P8MC 4HH2A 1FZGB 4GIFA 4D6TJ 4DT0A 1RY3A 4A7PA 3CCMP 4R9JA 4D6TD 2H43A 1SQPE 1IFIA 3H1JE 1YQ4C 5APUA 2J0YA 1H0TB 4IL6X 3JC22 3SFDC 1SQPG 2YIUB 3H1JG 2JDIH 3H1HJ 2RMZA 1JY3O 4TT3H 5CHXA 1NHLA 3AECC 1EXIA 2FFDA 5KJ7A 2K37A 1JY3N 1ZMEC 3GHGB 1YITP 1N7LA 1FZFA 1OW6A 1NTMJ 2E5TA 2FXOA 1LGHB 5C39A 2GUSA 3BVHA 1X79B 3KZIE 1JNMA 1NTMD 4IFMA 1ZR2A 2P7JA 3CX5H 3Q5PA 5AW1B 2AXCA 1T8ZA 2ZJSE 3CXHD 3CD6P 1P84I 2H43C 1Q90D 2OTLP 1RE3B 2WSSH 3H1HE 2YKOA 1GD2E 3F5HA 1LTJB 1LP1B 3P7KA 1N7SA 4Y99C 1T2KC 2QJKB 4PV1D 1YI2P 1PIXA 2FFDC 5KJ7C 2KP8A 3CCVP 4WY4A 2QSIA 1NTME 5DJUB 4LLHA 2ZXEB 3CI9A 1AJYA 1L0NG 4PJ0E 2WWWA 3G9RA 1FZCB 1OFCX 4ZKUA 4YTPC 2B88A 3CCSP 2YXQB 2J0HA 1FZFC 4JPZB 3HE4A 1VQ9P 3L4FA 3BVHC 1FZAC 2J3OA 2BEZF 1S5LH 2J3GA 3CX5E 2WVRA 3EFFK 3RK3E 1YJ9P 1WT6A 1W2BO 2G8YA 1AQTA 2KLUA 1BE3J 4RKUJ 2QA4P 1JC9A 3S1KA 1LNQA 4RO0A 1NU1J 2JP3A 1R8EA 2FYNB 1BE3D 3M9QA 2FYUG 1KILA 2Q6QA 3LIDA 2OYIB 1KB9I 4EPUA 1NU1D 2LR2A 2UWJE 1FOSE 1RF1B 4HB1A 2P10A 4EOTA 1N7SC 3MZWB 2K9JB 3L35A 1KFNA 1E5WA 2A45H 3O8ZA 1NTZJ 5APTA 3L74J 4GT1A 3G4SP 1NTZD 1NTMK 1BCCG 1SQXG 3L74D 3FXEA 2I8DA 1S5LE 2HYNA 1S9KD 2ZXXA 3Q5RA 4YXWH 1YHQP 5CBOA 5AW8B 1SQVJ 1KTMA 1T3UA 4U3FJ 1L2PA 1VPCA 3CCRP 1QX8A 4HKZH 1NVOA 2J61B 1SQVD 4PD4I 3H1KD 3H1LE 5APWA 4U3FD 5AVTB 3AEAC 3A3YB 3E1RA 4W80A 1T2KD 3CCLP 1P84H 4O9BA 1L4AB 1PPJE 3H1LG 3HD7C 5KJ7D 4GKGA 3ABVC 3IFMA 1E79H 2N1TA 2QJYB 1M8OB 3WU2E 1AVYA 1PPJG 2J2PA 1YYCA 2A06E 2XDJA 2D39A 3TNUB 3B4SA 4I7ZC 2Q3IA 1IFPA 3CC2P 4LC1A 3JSVC 3GF7A 2J3FA 2A06G 1NOHA 1EDJA 4W7YA 3GG2A 5AW0B 2J64A 2HPCA 4EDFA 4KHXA 1SS1A 1S1CX 1BGYJ 3CWBJ 2OYOA 3G6EP 3BASA 1VQ5P 4Y28J 3CWBD 1BDDA 1FZDA 2JEEA 2W8ZA 2QM8A 1GL2A 3L70J 1X0TA 3D6ZA 2MJZA 3K5BA 1P84E 3L70D 1VQ7P 2M3BA 2IFNA 3B8EB 1HJBA 5APVA 1FIDA 1Y47A 1Q2NA 1BSNA 3AE7C 2JO1A 3L71J 1NO4A 2N1TC 3RL0C 5EFWB 3GLMA 1EC5A 2JR8A 2YKQA 3AE2C 3L71D 5AW4B 3FWLA 1SQQD 1PP9J 4R4LA 1NTZK 1OIPA 1PGQA 1VQPP 1BGYE 3V4WA 1IO4A 1LT1A 1KMIZ 1RE4B 5H2FH 1RF0B 3TYYA 3NFQA 1JMBA 1YJNP 2HPCC 2KOGA 2Q3EA 5AW5B 2R32A 2WSCH 2OQQA 1SQBJ 3Q1MA 1J1DC 3V2NA 3CC7P 2WSCJ 1GTWA 3MHVA 3HD7D 4AYCA 1ZN5A 1OVUA 4PV1B 4GODA 2HLOA 2W27A 5CCGD 2WSFH 2I1JA 3VYIA 3AE1C 2R3CA 1W5CE 1QVFO 2IBZD 3PRJA 3VMXA 2KNCA 5BU5A 3KXDA 4BRYA 2J1GA 4M7HA 2WPRA 3AE6C 1M1JC 2RKLA 1PP9E 3OA7A 1N8RQ 1SP4A 1ZOYC 2HFED 1JUNA 3AEDC 3L75D 1DEEG 2HR3A 3PP5A 4UB8E 2P67A 5H2FE 5AVXB 3CCUP 3NTNA 1USEA 1SQBE 2V4HA 1KILE 5TJHA 1ZV8A 1GU5A 2IYOA 1NYHA 3O6QA 2JHIF 1R5LA 3U1AA 5B5EH 2N9BA 2WT7B 4GOEA 3V2PA 3VP9A 1LWUA 3C8VA 4PD4E 4IL6H 2WITA 3HE5A 2CPSA 3F89A 2HLOC 2N1TD 3RL0D 1AQ5A 1NTKG 1SQPJ 3H1JJ 2K88A 5AVYB 1KYOI 2Q9IA 1HJ0A 2OYHA 1SQPD 3H1JD 5AW9B 4OGQC 1G1JA 2KSJA 3IF4A 2R5DA 2W90A 2WSEJ 1J2JB 2H43B 3RK3C 2J3FD 1HGZA 1D7MA 5E79E 3N7NA 1G2CA 3H32A 4Z1MH 2IX7C 1S72P 3B5NA 2XV5A 4Y99B 4OVNF 1EDIA 2Q7CA 2FFDB 2DW3A 3KZIH 1LTGC 1OVVA 2XNXB 5B5EE 5K5GB 3GW6A 2W6BA 1MFTA 5AVZB 2R44A 2M5AA 1SQBK 2K9YA 1JB0J 3WUTA 1LT9A 1X22A 1OMIA 2CPBA 4IL6E 1KORA 1FZFB 4YPCA 1ZLLA 1LWUC 2B87A 5AW6B 3BVHB 4K35A 1FZAB 4R4MA 2M3EA 1KN7A 3AE8C 2Q9IC 2MKVA 4DJGA 2POHA 3H1HD 1Q86Q 2JHLF 2KZIA 5GTIE 5KAIH 5AVWB 1L0NJ 1KV4A 3A2AA 2ZT9C 4I6MC 1QLED 4PJ0H 2QEXP 1J1EC 1ZRTE 2GM4A 2QVAA 1N7SB 5BVZA 2O1JA 4EYYQ 3B5NC 3VMYA 3L73G 1IK9A 2Z4EA 2RH0A 2H89C 3H1IE 5CBNA 4OGQD 1LT9C 2R5BA 1VQ8P 4YXDC 2FYUJ 1Q7YQ 3CX5D 1SQPK 3HE4B 3LIEA 3MUDA 2K3RA 3PTZA 3H1IG 2JWDA 3RK3D 3A0BE 2G3AA 4JQ0D 4H44C 1FZEA 1KYOH 4K3AA 4L75A 1VQNP 1L0NE 4MN4C 3BRTB 5KAIE 2O01H 1JO5A 1FAVA 2O01J 3TGUE 1EZVI 2GY7A 4IFDK 2QJPC 1Y9BA 1FDMA 3HD7B 2V7QH 1K05A 3AE9C 2OTJP 1HUCA 3TGUG 1BCCJ 1SQXJ 1L0LE 1DEBA 1URQA 2KS1A 1S2EA 3JCUH 1DD4A 2W6AA 3I5CA 1VQMP 3PJSK 3SSUA 4I7ZB 1MZ9A 1L0LG 3OAKA 1DH3A 1U7JA 1M1KQ 4WB4A 1JEKA 1JCDA 3L37A 1X9VA 1RE3A 2Z4EC 3CCQP 2FYUE 4CPGA 5KLIC 2YO3A 3SWYA 1OVRA 3EWKA 1N86A 2C9LY 3H1LJ 1KYOE 3MUDC 1VDFA 1H88A 3BRVB 3H1LD 4C7RA 2J58A 1FZEC 3WU2H 1FZCA 1FC2C 1PPJD 1YQ3C 2E43A 1M90Q 1BCCE 1SQXE 1L0NK 3B5ND 1USDA 4WY4C 3FX0A 3JCUE 3FIBA 2A06D 2N1TB 3RL0B 3I56P 1URQC 2BCCE 3W68A 3SWKA 4ZNCA 2AEFA 2E42A 2B89A 1GK6A 2BCCG 1DX7A 2L5GB 3RL0g 3KQGA 2IBZI 2PP6A 1RF1A 1DD3A 2HPCB 2FYUK 1QGKB 1KC8Q 2ZYAA 3P8CE 1AFOA 2K9JA 1N86C 3Q5SA 1KILC 1QVGO 1H8AA 1P84D 2CK3H 1MFZA 4ASWA 2JHMF 2ZYDA 1HTLC 2E75C 1M56D 2PRRA 3PH0A 3R4YA 1G1IA 1EQ7A 1M1JB 2HODB 3SFEC 1SQXK 1NWQA 3MIWA 4N78E 3FXDA 5TISE 3I55P 2J5UA 1Z3UA 1NKZB 3TSIA 4C7NA 4TLFA 3G71P 4N3YB 1BGYD 1X8YA 3EFGA 4GOFA 1XTGB 3TF5A 3L74G 4L73A 3Q2YA 2B9BA 2YKPA 1OZHA 3MGNA 1L4AA 1KQSO 2SPZA 3BATA 1SFCA 1N7SD 3HTKA 1PGOA 3V6IA 2XNDH 1GU4A 3FWNA 5DJTB 1RF1C 3H1KG 2NPSA 1KB9H 4WY4D 4JYOX 3IN6A 1ZW0A 2NZ2A 2KXPB 1JY2P 2HLOB 2KI7B 2PFXA 2JJLA 2ITAA 1EZVE 1URQD 4JF7A 4IFFA 3II6A 1VQ4P 1GDTA 1PP9D 2GUVA 4OGQB 1OXZA 4UB8H 1EZVG 3D6YA 4WVZA 5KAFH 3RK3B 1FDOA 2D2CC 1A02F 2ZVOB 3AEEC 3U1CA 1T6AA 4BWNA 1JM0A 2W6JH 1YJWP 3CC4P 5KKZC 1SQBD 1KFMA 3C9IA 1HWTC 5BU8B 1KILD 1PGJA 1GL2C 1CSBA 2XU6A 3HUSA 3OW2O 5APYA 1NTKJ 2WSFJ 4PD4H 2WQYC
chains in the Genus database with same CATH topology
1M7LA 2WTYA 2W6BA 2WPQA 2WWWA 1SFCC 1FZCC 5AVZB 1FZCB 1SFCB 5CCGC 4JYBA 1SQBK 4ZKUA 2C9NY 1FIBA 3HTKB 2XKMA 4I1LA 1LT9A 2CPBA 3E1IA 2J0HA 1FZFC 4B86A 1FZFB 3H6PA 3NMDA 3HE4A 2NPSC 1ZLLA 2QM7A 1LWUC 1JY3P 2NPSB 5AW6B 1LWUB 3L4FA 2IFMA 3BVHC 1CI6B 1FU1A 3BVHB 2J59M 1FZAC 2J3OA 3KPEA 1FZAB 5AW2B 2A45G 3HE5B 2J3GA 2J61A 1GK4A 1S9KE 2XZRA 4AQRD 2Q9IC 1MUUA 1WT6A 2KYVA 2Q9IB 2Z5IA 2POHA 2JHLF 4NYTA 1JC9A 1IC2A 2YO2A 5AVWB 3M9QA 2OYIC 1KILA 3LIDA 2OYIB 2KLVA 4EPUA 4W7ZA 3R2PA 3A2AA 4I6MC 1NH4A 1FOSE 1RF1B 1G2CB 3TNUA 5APSA 4EOTA 1N7SC 1J1EC 2GM4A 1N7SB 1J1EB 2YNYA 5BVZA 2O1JA 2H8PD 3L35A 1KFNA 1N73A 1E5WA 1GZLA 3B5NC 2A45H 1NU1K 3VMYA 3HRNA 3N4XA 3B5NB 1KZUB 2PAJA 1IK9A 3HUSC 4M7FA 2Z4EA 1M1JA 3HUSB 3O8ZA 2HODA 3M91A 5APTA 4JYCA 1IJDB 1IFNA 3IR9A 3VMZA 4GT1A 2HG5D 1NTMK 1Z56A 1QL1A 1HVVA 1LTBC 5KTBA 1LT9C 2R5BA 3E1IC 1LT9B 3UIAA 2C0XA 3E1IB 1FJKA 4N6JA 4HYTB 4C46A 2HYNA 1S9KD 1SQPK 3HE4B 3LIEA 3MUDA 3M9HA 1Z3SA 3RK3D 5AW8B 1SVFA 1T3UA 2FKWB 1VPCA 1FZEA 2J60A 4JZCA 2J61B 5AVSB 5AW3B 5APWA 3MD0A 5AVTB 3BRTB 2O01H 1NAFA 3A3YB 4XA4A 5APQA 1JO5A 4W80A 1T2KD 1FAVA 3V2RA 1HH0A 1GW4A 5AW7B 1L4AC 2GY7A 1GL2D 2M8RA 4OH8B 1FZBA 1L4AB 4O9BA 4IFDK 3HD7C 4I2LC 5KJ7D 4GKGA 2JHHC 1FDMA 3HD7B 3IFMA 1SQVK 2N1TA 1HUCA 1SFCD 2I1KA 1JOCA 1DEBA 1URQA 1WRGA 3A7OA 5AVUB 3SWFA 2J2PA 2J0GA 2W6AA 4XE5B 1HGVA 1YYCA 2XDJA 3I5CA 2D39A 3VOPA 3TNUB 2Q5UA 4RESB 2Q3IA 1NTKK 2NPSD 1MZ9A 4WBAA 1N73C 5AVRB 3OAKA 1N73B 1FICA 3OJAB 1DH3A 4LC1A 4WB4A 3V5BA 1RE4A 1JCDA 1RF0A 1X9VA 1RE3A 3L37A 5CCHA 4AUWA 2J3FA 2Z4EC 1NOHA 4W7YA 2VRSA 2HODC 2Z4EB 2FYZA 5AW0B 2J64A 2OYHC 3U59A 1A02J 2HPCA 2OYHB 3VP8A 4KHXA 2ZFCA 5APXA 2YO3A 3WMM0 1JTHA 3SWYA 1QL2A 1N86A 2C9LY 1IFDA 3BASA 1PFIA 1CW5A 4R9TA 2H7HA 1FZDA 2JEEA 1GW3A 1VDFA 3KDPB 2QM8A 3BRVB 3A5TA 1GL2A 1H88A 1FZGA 2A45I 4C7RA 3H32C 1ZR4A 2XNXA 3H32B 5AVQB 2P1JA 2J58A 2MJZA 1XTCC 1FZEC 1FZEB 1FZCA 2WPSA 2C0WA 1IFJA 2M3BA 2IFNA 2E43A 2J5ZA 3V4QA 2YMYA 1L0NK 3B8EB 1HJBA 3MTUE 3B5ND 5APVA 1FIDA 4WY4C 1FOSF 4WY4B 1FZBC 2Z5HA 1FZBB 3FIBA 1CI6A 1NO4A 2N1TC 3RL0C 2N1TB 1FZAA 3RL0B 3VN0A 1LTTC 2YKQA 1URQC 2O1KA 1HBWA 3M06A 5AW4B 1URQB 3EQ2A 3RK2C 5KLVK 3RK2B 1NTZK 4ZKPA 2E42A 4M3LA 2WSEH 1JY2O 3V4WA 1GK6A 5CJ0A 1RE4C 1IO4A 1RF0C 1YTZI 5CCHC 1RE4B 1RF0B 1LTAC 1MV8A 1SQQK 3GHGA 3TYYA 3NFQA 1DX7A 2L5GB 1JY2N 3M0AA 2HPCC 3KQGA 1FBMA 2KOGA 2PP6A 1RF1A 2WT7A 2HPCB 3TK1A 3P32A 5AW5B 2FYUK 2R32A 3T97A 3KYQA 4LGDE 2IPPA 3P8CE 4DZOA 2WSCH 1AFOA 1JTHB 3CL3D 1L4AD 1J1DC 2WZ7A 1N86C 3V2NA 1KILC 1N86B 1GTWA 3HD7D 4AYCA 1KILB 1ZN5A 1IFMA 2HLOA 2W27A 1H8AA 3VTPC 5CCGD 1SLQA 2WSFH 3CLQA 2FIBA 1MFZA 3P8MC 2I1JA 1FZGC 3VYIA 2R3CA 4HH2A 1YTZT 1FZGB 2XNXC 2JHMF 5CJ4A 2JHKF 3VMXA 4GIFA 1CZQA 1W2EA 5BU5A 1HTLC 1RY3A 2J1GA 4M7HA 3M9BA 2WPRA 4R9JA 2H43A 1M1JC 1IFIA 1G1IA 1EQ7A 1M1JB 2HODB 5APUA 1T3JA 1SQXK 1NWQA 3MIWA 3OA7A 4N78E 2J0YA 1LTJA 1SP4A 2HFED 4EIJA 1JUNA 3M0DA 1Z3UA 1NKZB 3TSIA 3V2QA 4C7NA 2KB7P 4N3YB 1X8YA 2OARA 3PP5A 1NKNA 4ZFGA 3EFGA 1XTGB 2P67A 1JY3O 5CHXA 1NHLA 5AVXB 2FFDA 2YKPA 1JMMA 5KJ7A 3MGNA 1L4AA 3NTNA 1JY3N 1LTSC 3HD7A 1OWAA 3BATA 1SFCA 1ZV8A 1GU5A 1N7SD 2BASA 3P8CD 5CMZA 5CCGA 3GHGC 2JHIF 3HTKA 3GHGB 3U1AA 2LKMA 1GU4A 1N7LA 1FZFA 1RF1C 3G3ZA 2N9BA 2WT7B 3V2PA 2NPSA 3VP9A 1LWUA 1LGHB 2P2UA 4WY4D 2GUSA 3BVHA 4JYOX 1X79B 1JNMA 4IFMA 2WITA 3HE5A 2CPSA 2HLOC 3LW5H 2N1TD 3RL0D 1JY2P 1ZR2A 1AQ5A 2HLOB 2P7JA 2JJLA 4DOJA 3L36A 5AVYB 1L0LK 1LTIC 1URQD 2Q9IA 4JF7A 2OYHA 1KQLA 4IFFA 5AW9B 3RK2D 1G1JA 3II6A 5AW1B 1GDTA 2GUVA 1OXZA 1T8ZA 2KSJA 2FXMA 4N78D 1JCCA 1RE3C 2R5DA 2H43C 1RE3B 2OYIA 2H43B 1J2JB 3RK3C 2J3FD 3NXSA 5CCHD 1HGZA 3RK3B 2YKOA 3N7NA 2WNPF 1LTJC 1G2CA 1GD2E 1LTJB 1A02F 1H89A 3H32A 3M0DC 3U1CA 3P7KA 1N7SA 5AVVB 2IX7C 1J1DB 4C7NB 1FJPA 4Y99C 1T2KC 3B5NA 2XV5A 4Y99B 1KFMA 3C9IA 1HWTC 5BU8B 1KILD 1GL2C 1CSBA 2XU6A 3HUSA 1GL2B 2FFDC 5KJ7C 2Q7CA 2KP8A 5APYA 2FFDB 4WY4A 2J3UA 1LTGC 2XNXB 1N2DC 4LLHA 2ZXEB 3CI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3U A;  1FZC C;  1Z3S A;  1FID A;  4ZFG A;  1FZC B;  1T3U A;  1FZB C;  1FIB A;  1JY3 O;  1FZB B;  3FIB A;  1FZE A;  2J60 A;  4JZC A;  1LT9 A;  3E1I A;  2J0H A;  1FZF C;  2J61 B;  2FFD A;  1FZF B;  1FZA A;  1JY3 N;  1LWU C;  1JY3 P;  1LWU B;  3BVH C;  3BVH B;  1FZA C;  3GHG C;  2GY7 A;  2J3O A;  2JHI F;  1FZA B;  1FZB A;  3GHG B;  2A45 G;  2J3G A;  2J61 A;  2JHH C;  1FZF A;  1RF1 C;  2Q9I C;  1LWU A;  1JY2 O;  2Q9I B;  1RE4 C;  1RF0 C;  3BVH A;  1RE4 B;  1RF0 B;  4JYO X;  2J2P A;  2JHL F;  2J0G A;  4NYT A;  3GHG A;  1JC9 A;  2D39 A;  2HLO C;  1JY2 N;  1JY2 P;  2HLO B;  2HPC C;  1RF1 A;  2HPC B;  2OYI C;  1N73 C;  2OYI B;  4EPU A;  2Q9I A;  1N73 B;  1FIC A;  2OYH A;  1RE4 A;  1RF0 A;  2J3F A;  1RE3 A;  1N86 C;  1RF1 B;  2Z4E C;  1N86 B;  2HOD C;  2Z4E B;  2J64 A;  2HLO A;  2OYH C;  2HPC A;  2OYH B;  1RE3 C;  2FIB A;  2H43 C;  1RE3 B;  2OYI A;  1FZG C;  2H43 B;  1N73 A;  1FZG B;  2A45 H;  2JHM F;  2XNX C;  2J3F D;  2JHK F;  1W2E A;  2WNP F;  1LTJ C;  3HUS C;  1N86 A;  4M7F A;  2Z4E A;  1M1J A;  1LTJ B;  3HUS B;  2HOD A;  3H32 A;  4R9T A;  2J1G A;  4M7H A;  1FZD A;  4R9J A;  2H43 A;  1M1J C;  1FZG A;  2A45 I;  1M1J B;  3H32 C;  2HOD B;  2XNX A;  3H32 B;  1FZE C;  2J0Y A;  1LT9 C;  3E1I C;  1LTJ A;  3HUS A;  1FZE B;  2FFD C;  1FZC A;  1LT9 B;  3E1I B;  2FFD B;  2J3U A;  2J5Z A;  2XNX B; 
#chains in the Genus database with same CATH topology
 2FBW C;  2WTY A;  2OGU A;  1SFC C;  1KB9 E;  2L91 A;  2C9N Y;  2XKM A;  2RN0 A;  4PD4 D;  3E1I A;  4B86 A;  2E75 D;  3H6P A;  2NPS C;  1RQU A;  2QM7 A;  1JY3 P;  1LWU B;  1CI6 B;  4KT0 J;  4L76 A;  2J59 M;  1U57 A;  3CCE P;  2JKV A;  3KPE A;  5AW2 B;  3HE5 B;  1Y8A A;  5E79 H;  4AQR D;  2Q9I B;  1KD1 Q;  3S9O A;  5KAF E;  1SQQ G;  2P58 A;  2Y0C A;  4ASV A;  2LXC B;  4W7Z A;  1GMJ A;  3R2P A;  2LXB A;  1NH4 A;  2ZT9 B;  1BSH A;  1G2C B;  1RHZ B;  1NTK E;  3T97 B;  5APS A;  1J1E B;  2YNY A;  3CXH I;  1N73 A;  1GZL A;  1Q82 Q;  3B5N B;  2PAJ A;  3HUS C;  3IR9 A;  3VMZ A;  2HG5 D;  2IYP A;  1UIX A;  2IBZ G;  2M5A B;  1QL1 A;  3E1I C;  1LT9 B;  3UIA A;  4N6J A;  4C46 A;  2QE7 H;  2AEM A;  2B87 B;  5GTI H;  1Z3S A;  3GF3 A;  3PLN A;  4H44 B;  2J60 A;  4JZC A;  5B66 E;  3L75 G;  4XA4 A;  3L73 J;  3V2R A;  1HH0 A;  1GW4 A;  1GL2 D;  2M8R A;  2ZAE B;  1FZB A;  4I2L C;  2M0B A;  2JHH C;  2QJP B;  3AE4 C;  3VMA A;  2FXP A;  2E74 C;  1ZRT D;  1SFC D;  3RBX A;  5KLV E;  3A7O A;  3ITK A;  2YXR B;  3SWF A;  5M1B A;  2J0G A;  4XE5 B;  1HGV A;  3VOP A;  1Q81 Q;  2Q5U A;  1NTK K;  2NPS D;  4BXL A;  1N73 C;  5KLV G;  3H1I J;  3D71 A;  3OJA B;  3V5B A;  4HJG H;  5CCH A;  3BCC E;  2KK7 A;  2VRS A;  5GTH E;  2Z4E B;  3H1I D;  3A0B H;  2OYH C;  1A02 J;  4EI2 A;  5APX A;  5KLI B;  1JTH A;  3BCC G;  2Y9Y A;  1K73 Q;  1QL2 A;  3L72 E;  1CW5 A;  1AVO A;  1PZQ A;  2H7H A;  1GW3 A;  3KDP B;  3CMA P;  1L0N D;  3TGU J;  3L73 E;  1FZG A;  2A45 I;  1TU3 F;  4UB6 H;  3H32 C;  3L72 G;  2XNX A;  1OX3 A;  1PV3 A;  3TGU D;  1FZE B;  2WPS A;  2C0W A;  1IFJ A;  2J5Z A;  2R3S A;  3V4Q A;  1L0L J;  4ZMD A;  3MTU E;  4WY4 B;  1FZB C;  4H0L C;  1L0L D;  1H0T A;  3A0H E;  1YBK A;  4D6T E;  1FZA A;  1VL2 A;  3VN0 A;  3WUU A;  3PHL A;  2O1K A;  2NRG A;  1URQ B;  2KS1 B;  3CXH H;  3RK2 C;  3ZDM A;  2FY8 A;  5KLV K;  4D6T G;  1EDK A;  3D70 A;  2FYU D;  3AE3 C;  5CJ0 A;  1YTZ I;  5CCH C;  1VF5 C;  3GHG A;  1QEX A;  1RH5 B;  2QIW A;  1FBM A;  3RGU A;  1VQO P;  1KYO D;  3KYQ A;  2E76 C;  4H13 C;  3H1H G;  2WZ7 A;  4UB6 E;  1AV1 A;  3W67 A;  1N86 B;  1KIL B;  1IFM A;  2V7Q J;  3VTP C;  2E5Y A;  1SLQ A;  2E74 D;  1FZG C;  1YTZ T;  2XNX C;  1BCC D;  1SQX D;  5CJ4 A;  2JHK F;  1CZQ A;  1W2E A;  1IZN B;  3CPW O;  3M9B A;  2E75 B;  3GMA A;  1VQK P;  1NTM G;  1WMK A;  2BCC J;  1T3J A;  1LTJ A;  3CXH E;  1LP1 A;  2BCC D;  2YIU C;  4EIJ A;  3M0D A;  1NJI Q;  3V2Q A;  2KB7 P;  2OAR A;  4ZFG A;  1NKN A;  4NPE A;  1JMM A;  4U7J A;  2ZT9 D;  1LTS C;  3HD7 A;  1OWA A;  2GA1 A;  2BAS A;  3P8C D;  5CMZ A;  5CCG A;  3GHG C;  1OW7 A;  2LKM A;  3G3Z A;  4XFJ A;  2AEJ A;  3H25 A;  2JWA A;  2IDB A;  2P2U A;  4H0L D;  3QH9 A;  4DCK A;  3AEF C;  1S3J A;  3QWO C;  2O01 N;  3LW5 H;  2PGD A;  2KSE A;  3LW5 J;  4DOJ A;  3L36 A;  1L0L K;  1LTI C;  3CCJ P;  5TIS H;  1KQL A;  3RBZ A;  3RK2 D;  4JBZ A;  1U7M A;  2FXM A;  4N78 D;  2QRX A;  1JCC A;  1RE3 C;  4H44 D;  1K9M Q;  2OYI A;  3NXS A;  1VF5 D;  5CCH D;  2WNP F;  1LTJ C;  2O3J A;  2D2C B;  2WPV B;  1S5L X;  1H89 A;  1BE3 E;  3H1K J;  3M0D C;  1NU1 E;  5AVV B;  1PGP A;  1PL5 A;  1J1D B;  4C7N B;  2E76 D;  1VQ6 P;  1FJP A;  4H13 D;  2QJK C;  1BDC A;  1EDL A;  1KQF B;  1MKM A;  5KKZ B;  1DIP A;  2YMK A;  1BE3 G;  1GL2 B;  1NU1 G;  4OWF A;  2J3U A;  1N2D C;  3AEB C;  1M7L A;  1FZC C;  2WPQ A;  1SFC B;  5CCG C;  4JYB A;  3C1L A;  1FIB A;  3HTK B;  2N9Y B;  2Q1K A;  4I1L A;  3NMD A;  1NTZ E;  2NPS B;  2IFM A;  3L74 E;  1FU1 A;  1EZV D;  2A45 G;  2J61 A;  1GK4 A;  1S9K E;  2XZR A;  1NTZ G;  1MUU A;  2KYV A;  2Z5I A;  1UII A;  4NYT A;  1SQV E;  3H1K E;  1IC2 A;  2YO2 A;  4U3F E;  2FYN C;  3FGA D;  2OYI C;  4WWI A;  2KLV A;  4NPF X;  1ZXG A;  1SQV G;  4U3F G;  3TNU A;  2H8P D;  1NU1 K;  1S4X A;  3HRN A;  3N4X A;  2OTK E;  1KZU B;  4M7F A;  5L8R J;  1LJ2 A;  1KB9 D;  1M1J A;  3HUS B;  2HOD A;  3M91 A;  4JYC A;  3CME P;  1IJD B;  1IFN A;  3Q3D A;  3USS A;  2WMM A;  2KNC B;  1Z56 A;  2KUB A;  4BRY B;  3IAO A;  1SQQ J;  1HVV A;  1LTB C;  5KTB A;  1K04 A;  3E1I B;  2C0X A;  4QMA A;  1FJK A;  4HYT B;  1KQG B;  1K8A Q;  3M9H A;  2QG4 A;  1SVF A;  1EXJ A;  2FKW B;  3CWB E;  2Y9Z A;  5AVS B;  5AW3 B;  2AXT H;  3MD0 A;  1NAF A;  5APQ A;  1BGY G;  3CWB G;  5AW7 B;  1L4A C;  3L70 E;  2ZYG A;  4OH8 B;  4GDO A;  1SQV K;  2QJY C;  1NTK D;  4RJT A;  3O6Q B;  1R5S A;  2E74 B;  2I1K A;  1JOC A;  5AVU B;  1WRG A;  3L70 G;  4IOI H;  1RQV A;  4RES B;  2ZVN B;  1AA0 A;  1IK7 A;  3L71 E;  4WBA A;  4KJM A;  5AVR B;  1N73 B;  1FIC A;  1SQQ E;  1RE4 A;  1RF0 A;  4AUW A;  2H88 C;  2HOD C;  2FYZ A;  2BEQ D;  3U59 A;  3L71 G;  3E7K A;  2OYH B;  3L75 J;  3VP8 A;  2ZFC A;  2Y0D A;  5B66 H;  3WMM 0;  4NPD A;  2K1A A;  1NGM B;  1IFD A;  1PFI A;  1PP9 G;  4R9T A;  2W83 C;  2IZ0 A;  2AXT E;  3A5T A;  2KIK A;  3B71 A;  1ZR4 A;  1FE6 A;  3H32 B;  5AVQ B;  2P1J A;  1XTC C;  2IZ1 A;  3TDK A;  5KLV J;  3CX5 I;  2IBZ E;  2YMY A;  1ZP0 C;  1SQB G;  1FOS F;  1FDI A;  2Z5H A;  5KLV D;  1FZB B;  4H0L B;  1CI6 A;  5GTH H;  1HF9 A;  1LTT C;  1VQL P;  1YIJ P;  3BCC J;  3S4R A;  1FS0 E;  1HBW A;  3M06 A;  3EQ2 A;  3MP7 B;  3RK2 B;  3BCC D;  3L75 E;  4ZKP A;  4L74 A;  2Y0E A;  2D2C D;  3AE5 C;  4M3L A;  2WSE H;  1JY2 O;  3L72 J;  1RE4 C;  1RF0 C;  2KZJ A;  1LTA C;  1VF5 B;  1MV8 A;  1SQQ K;  1NAY A;  1OW8 A;  1JY2 N;  3L72 D;  3M0A A;  3KHU A;  2WT7 A;  3TK1 A;  3P32 A;  3WUV A;  3T97 A;  4LGD E;  2IPP A;  4DZO A;  1JTH B;  2E76 B;  3CL3 D;  3L73 D;  4H13 B;  1L4A D;  3AEG C;  1M57 D;  4PV1 C;  3CLQ A;  2FIB A;  3A0H H;  3P8M C;  4HH2 A;  1FZG B;  4GIF A;  4D6T J;  4DT0 A;  1RY3 A;  4A7P A;  3CCM P;  4R9J A;  4D6T D;  2H43 A;  1SQP E;  1IFI A;  3H1J E;  1YQ4 C;  5APU A;  2J0Y A;  1H0T B;  4IL6 X;  3JC2 2;  3SFD C;  1SQP G;  2YIU B;  3H1J G;  2JDI H;  3H1H J;  2RMZ A;  1JY3 O;  4TT3 H;  5CHX A;  1NHL A;  3AEC C;  1EXI A;  2FFD A;  5KJ7 A;  2K37 A;  1JY3 N;  1ZME C;  3GHG B;  1YIT P;  1N7L A;  1FZF A;  1OW6 A;  1NTM J;  2E5T A;  2FXO A;  1LGH B;  5C39 A;  2GUS A;  3BVH A;  1X79 B;  3KZI E;  1JNM A;  1NTM D;  4IFM A;  1ZR2 A;  2P7J A;  3CX5 H;  3Q5P A;  5AW1 B;  2AXC A;  1T8Z A;  2ZJS E;  3CXH D;  3CD6 P;  1P84 I;  2H43 C;  1Q90 D;  2OTL P;  1RE3 B;  2WSS H;  3H1H E;  2YKO A;  1GD2 E;  3F5H A;  1LTJ B;  1LP1 B;  3P7K A;  1N7S A;  4Y99 C;  1T2K C;  2QJK B;  4PV1 D;  1YI2 P;  1PIX A;  2FFD C;  5KJ7 C;  2KP8 A;  3CCV P;  4WY4 A;  2QSI A;  1NTM E;  5DJU B;  4LLH A;  2ZXE B;  3CI9 A;  1AJY A;  1L0N G;  4PJ0 E;  2WWW A;  3G9R A;  1FZC B;  1OFC X;  4ZKU A;  4YTP C;  2B88 A;  3CCS P;  2YXQ B;  2J0H A;  1FZF C;  4JPZ B;  3HE4 A;  1VQ9 P;  3L4F A;  3BVH C;  1FZA C;  2J3O A;  2BEZ F;  1S5L H;  2J3G A;  3CX5 E;  2WVR A;  3EFF K;  3RK3 E;  1YJ9 P;  1WT6 A;  1W2B O;  2G8Y A;  1AQT A;  2KLU A;  1BE3 J;  4RKU J;  2QA4 P;  1JC9 A;  3S1K A;  1LNQ A;  4RO0 A;  1NU1 J;  2JP3 A;  1R8E A;  2FYN B;  1BE3 D;  3M9Q A;  2FYU G;  1KIL A;  2Q6Q A;  3LID A;  2OYI B;  1KB9 I;  4EPU A;  1NU1 D;  2LR2 A;  2UWJ E;  1FOS E;  1RF1 B;  4HB1 A;  2P10 A;  4EOT A;  1N7S C;  3MZW B;  2K9J B;  3L35 A;  1KFN A;  1E5W A;  2A45 H;  3O8Z A;  1NTZ J;  5APT A;  3L74 J;  4GT1 A;  3G4S P;  1NTZ D;  1NTM K;  1BCC G;  1SQX G;  3L74 D;  3FXE A;  2I8D A;  1S5L E;  2HYN A;  1S9K D;  2ZXX A;  3Q5R A;  4YXW H;  1YHQ P;  5CBO A;  5AW8 B;  1SQV J;  1KTM A;  1T3U A;  4U3F J;  1L2P A;  1VPC A;  3CCR P;  1QX8 A;  4HKZ H;  1NVO A;  2J61 B;  1SQV D;  4PD4 I;  3H1K D;  3H1L E;  5APW A;  4U3F D;  5AVT B;  3AEA C;  3A3Y B;  3E1R A;  4W80 A;  1T2K D;  3CCL P;  1P84 H;  4O9B A;  1L4A B;  1PPJ E;  3H1L G;  3HD7 C;  5KJ7 D;  4GKG A;  3ABV C;  3IFM A;  1E79 H;  2N1T A;  2QJY B;  1M8O B;  3WU2 E;  1AVY A;  1PPJ G;  2J2P A;  1YYC A;  2A06 E;  2XDJ A;  2D39 A;  3TNU B;  3B4S A;  4I7Z C;  2Q3I A;  1IFP A;  3CC2 P;  4LC1 A;  3JSV C;  3GF7 A;  2J3F A;  2A06 G;  1NOH A;  1EDJ A;  4W7Y A;  3GG2 A;  5AW0 B;  2J64 A;  2HPC A;  4EDF A;  4KHX A;  1SS1 A;  1S1C X;  1BGY J;  3CWB J;  2OYO A;  3G6E P;  3BAS A;  1VQ5 P;  4Y28 J;  3CWB D;  1BDD A;  1FZD A;  2JEE A;  2W8Z A;  2QM8 A;  1GL2 A;  3L70 J;  1X0T A;  3D6Z A;  2MJZ A;  3K5B A;  1P84 E;  3L70 D;  1VQ7 P;  2M3B A;  2IFN A;  3B8E B;  1HJB A;  5APV A;  1FID A;  1Y47 A;  1Q2N A;  1BSN A;  3AE7 C;  2JO1 A;  3L71 J;  1NO4 A;  2N1T C;  3RL0 C;  5EFW B;  3GLM A;  1EC5 A;  2JR8 A;  2YKQ A;  3AE2 C;  3L71 D;  5AW4 B;  3FWL A;  1SQQ D;  1PP9 J;  4R4L A;  1NTZ K;  1OIP A;  1PGQ A;  1VQP P;  1BGY E;  3V4W A;  1IO4 A;  1LT1 A;  1KMI Z;  1RE4 B;  5H2F H;  1RF0 B;  3TYY A;  3NFQ A;  1JMB A;  1YJN P;  2HPC C;  2KOG A;  2Q3E A;  5AW5 B;  2R32 A;  2WSC H;  2OQQ A;  1SQB J;  3Q1M A;  1J1D C;  3V2N A;  3CC7 P;  2WSC J;  1GTW A;  3MHV A;  3HD7 D;  4AYC A;  1ZN5 A;  1OVU A;  4PV1 B;  4GOD A;  2HLO A;  2W27 A;  5CCG D;  2WSF H;  2I1J A;  3VYI A;  3AE1 C;  2R3C A;  1W5C E;  1QVF O;  2IBZ D;  3PRJ A;  3VMX A;  2KNC A;  5BU5 A;  3KXD A;  4BRY A;  2J1G A;  4M7H A;  2WPR A;  3AE6 C;  1M1J C;  2RKL A;  1PP9 E;  3OA7 A;  1N8R Q;  1SP4 A;  1ZOY C;  2HFE D;  1JUN A;  3AED C;  3L75 D;  1DEE G;  2HR3 A;  3PP5 A;  4UB8 E;  2P67 A;  5H2F E;  5AVX B;  3CCU P;  3NTN A;  1USE A;  1SQB E;  2V4H A;  1KIL E;  5TJH A;  1ZV8 A;  1GU5 A;  2IYO A;  1NYH A;  3O6Q A;  2JHI F;  1R5L A;  3U1A A;  5B5E H;  2N9B A;  2WT7 B;  4GOE A;  3V2P A;  3VP9 A;  1LWU A;  3C8V A;  4PD4 E;  4IL6 H;  2WIT A;  3HE5 A;  2CPS A;  3F89 A;  2HLO C;  2N1T D;  3RL0 D;  1AQ5 A;  1NTK G;  1SQP J;  3H1J J;  2K88 A;  5AVY B;  1KYO I;  2Q9I A;  1HJ0 A;  2OYH A;  1SQP D;  3H1J D;  5AW9 B;  4OGQ C;  1G1J A;  2KSJ A;  3IF4 A;  2R5D A;  2W90 A;  2WSE J;  1J2J B;  2H43 B;  3RK3 C;  2J3F D;  1HGZ A;  1D7M A;  5E79 E;  3N7N A;  1G2C A;  3H32 A;  4Z1M H;  2IX7 C;  1S72 P;  3B5N A;  2XV5 A;  4Y99 B;  4OVN F;  1EDI A;  2Q7C A;  2FFD B;  2DW3 A;  3KZI H;  1LTG C;  1OVV A;  2XNX B;  5B5E E;  5K5G B;  3GW6 A;  2W6B A;  1MFT A;  5AVZ B;  2R44 A;  2M5A A;  1SQB K;  2K9Y A;  1JB0 J;  3WUT A;  1LT9 A;  1X22 A;  1OMI A;  2CPB A;  4IL6 E;  1KOR A;  1FZF B;  4YPC A;  1ZLL A;  1LWU C;  2B87 A;  5AW6 B;  3BVH B;  4K35 A;  1FZA B;  4R4M A;  2M3E A;  1KN7 A;  3AE8 C;  2Q9I C;  2MKV A;  4DJG A;  2POH A;  3H1H D;  1Q86 Q;  2JHL F;  2KZI A;  5GTI E;  5KAI H;  5AVW B;  1L0N J;  1KV4 A;  3A2A A;  2ZT9 C;  4I6M C;  1QLE D;  4PJ0 H;  2QEX P;  1J1E C;  1ZRT E;  2GM4 A;  2QVA A;  1N7S B;  5BVZ A;  2O1J A;  4EYY Q;  3B5N C;  3VMY A;  3L73 G;  1IK9 A;  2Z4E A;  2RH0 A;  2H89 C;  3H1I E;  5CBN A;  4OGQ D;  1LT9 C;  2R5B A;  1VQ8 P;  4YXD C;  2FYU J;  1Q7Y Q;  3CX5 D;  1SQP K;  3HE4 B;  3LIE A;  3MUD A;  2K3R A;  3PTZ A;  3H1I G;  2JWD A;  3RK3 D;  3A0B E;  2G3A A;  4JQ0 D;  4H44 C;  1FZE A;  1KYO H;  4K3A A;  4L75 A;  1VQN P;  1L0N E;  4MN4 C;  3BRT B;  5KAI E;  2O01 H;  1JO5 A;  1FAV A;  2O01 J;  3TGU E;  1EZV I;  2GY7 A;  4IFD K;  2QJP C;  1Y9B A;  1FDM A;  3HD7 B;  2V7Q H;  1K05 A;  3AE9 C;  2OTJ P;  1HUC A;  3TGU G;  1BCC J;  1SQX J;  1L0L E;  1DEB A;  1URQ A;  2KS1 A;  1S2E A;  3JCU H;  1DD4 A;  2W6A A;  3I5C A;  1VQM P;  3PJS K;  3SSU A;  4I7Z B;  1MZ9 A;  1L0L G;  3OAK A;  1DH3 A;  1U7J A;  1M1K Q;  4WB4 A;  1JEK A;  1JCD A;  3L37 A;  1X9V A;  1RE3 A;  2Z4E C;  3CCQ P;  2FYU E;  4CPG A;  5KLI C;  2YO3 A;  3SWY A;  1OVR A;  3EWK A;  1N86 A;  2C9L Y;  3H1L J;  1KYO E;  3MUD C;  1VDF A;  1H88 A;  3BRV B;  3H1L D;  4C7R A;  2J58 A;  1FZE C;  3WU2 H;  1FZC A;  1FC2 C;  1PPJ D;  1YQ3 C;  2E43 A;  1M90 Q;  1BCC E;  1SQX E;  1L0N K;  3B5N D;  1USD A;  4WY4 C;  3FX0 A;  3JCU E;  3FIB A;  2A06 D;  2N1T B;  3RL0 B;  3I56 P;  1URQ C;  2BCC E;  3W68 A;  3SWK A;  4ZNC A;  2AEF A;  2E42 A;  2B89 A;  1GK6 A;  2BCC G;  1DX7 A;  2L5G B;  3RL0 g;  3KQG A;  2IBZ I;  2PP6 A;  1RF1 A;  1DD3 A;  2HPC B;  2FYU K;  1QGK B;  1KC8 Q;  2ZYA A;  3P8C E;  1AFO A;  2K9J A;  1N86 C;  3Q5S A;  1KIL C;  1QVG O;  1H8A A;  1P84 D;  2CK3 H;  1MFZ A;  4ASW A;  2JHM F;  2ZYD A;  1HTL C;  2E75 C;  1M56 D;  2PRR A;  3PH0 A;  3R4Y A;  1G1I A;  1EQ7 A;  1M1J B;  2HOD B;  3SFE C;  1SQX K;  1NWQ A;  3MIW A;  4N78 E;  3FXD A;  5TIS E;  3I55 P;  2J5U A;  1Z3U A;  1NKZ B;  3TSI A;  4C7N A;  4TLF A;  3G71 P;  4N3Y B;  1BGY D;  1X8Y A;  3EFG A;  4GOF A;  1XTG B;  3TF5 A;  3L74 G;  4L73 A;  3Q2Y A;  2B9B A;  2YKP A;  1OZH A;  3MGN A;  1L4A A;  1KQS O;  2SPZ A;  3BAT A;  1SFC A;  1N7S D;  3HTK A;  1PGO A;  3V6I A;  2XND H;  1GU4 A;  3FWN A;  5DJT B;  1RF1 C;  3H1K G;  2NPS A;  1KB9 H;  4WY4 D;  4JYO X;  3IN6 A;  1ZW0 A;  2NZ2 A;  2KXP B;  1JY2 P;  2HLO B;  2KI7 B;  2PFX A;  2JJL A;  2ITA A;  1EZV E;  1URQ D;  4JF7 A;  4IFF A;  3II6 A;  1VQ4 P;  1GDT A;  1PP9 D;  2GUV A;  4OGQ B;  1OXZ A;  4UB8 H;  1EZV G;  3D6Y A;  4WVZ A;  5KAF H;  3RK3 B;  1FDO A;  2D2C C;  1A02 F;  2ZVO B;  3AEE C;  3U1C A;  1T6A A;  4BWN A;  1JM0 A;  2W6J H;  1YJW P;  3CC4 P;  5KKZ C;  1SQB D;  1KFM A;  3C9I A;  1HWT C;  5BU8 B;  1KIL D;  1PGJ A;  1GL2 C;  1CSB A;  2XU6 A;  3HUS A;  3OW2 O;  5APY A;  1NTK J;  2WSF J;  4PD4 H;  2WQY C; 
#chains in the Genus database with same CATH homology
 1M7L A;  2WTY A;  2W6B A;  2WPQ A;  2WWW A;  1SFC C;  1FZC C;  5AVZ B;  1FZC B;  1SFC B;  5CCG C;  4JYB A;  1SQB K;  4ZKU A;  2C9N Y;  1FIB A;  3HTK B;  2XKM A;  4I1L A;  1LT9 A;  2CPB A;  3E1I A;  2J0H A;  1FZF C;  4B86 A;  1FZF B;  3H6P A;  3NMD A;  3HE4 A;  2NPS C;  1ZLL A;  2QM7 A;  1LWU C;  1JY3 P;  2NPS B;  5AW6 B;  1LWU B;  3L4F A;  2IFM A;  3BVH C;  1CI6 B;  1FU1 A;  3BVH B;  2J59 M;  1FZA C;  2J3O A;  3KPE A;  1FZA B;  5AW2 B;  2A45 G;  3HE5 B;  2J3G A;  2J61 A;  1GK4 A;  1S9K E;  2XZR A;  4AQR D;  2Q9I C;  1MUU A;  1WT6 A;  2KYV A;  2Q9I B;  2Z5I A;  2POH A;  2JHL F;  4NYT A;  1JC9 A;  1IC2 A;  2YO2 A;  5AVW B;  3M9Q A;  2OYI C;  1KIL A;  3LID A;  2OYI B;  2KLV A;  4EPU A;  4W7Z A;  3R2P A;  3A2A A;  4I6M C;  1NH4 A;  1FOS E;  1RF1 B;  1G2C B;  3TNU A;  5APS A;  4EOT A;  1N7S C;  1J1E C;  2GM4 A;  1N7S B;  1J1E B;  2YNY A;  5BVZ A;  2O1J A;  2H8P D;  3L35 A;  1KFN A;  1N73 A;  1E5W A;  1GZL A;  3B5N C;  2A45 H;  1NU1 K;  3VMY A;  3HRN A;  3N4X A;  3B5N B;  1KZU B;  2PAJ A;  1IK9 A;  3HUS C;  4M7F A;  2Z4E A;  1M1J A;  3HUS B;  3O8Z A;  2HOD A;  3M91 A;  5APT A;  4JYC A;  1IJD B;  1IFN A;  3IR9 A;  3VMZ A;  4GT1 A;  2HG5 D;  1NTM K;  1Z56 A;  1QL1 A;  1HVV A;  1LTB C;  5KTB A;  1LT9 C;  2R5B A;  3E1I C;  1LT9 B;  3UIA A;  2C0X A;  3E1I B;  1FJK A;  4N6J A;  4HYT B;  4C46 A;  2HYN A;  1S9K D;  1SQP K;  3HE4 B;  3LIE A;  3MUD A;  3M9H A;  1Z3S A;  3RK3 D;  5AW8 B;  1SVF A;  1T3U A;  2FKW B;  1VPC A;  1FZE A;  2J60 A;  4JZC A;  2J61 B;  5AVS B;  5AW3 B;  5APW A;  3MD0 A;  5AVT B;  3BRT B;  2O01 H;  1NAF A;  3A3Y B;  4XA4 A;  5APQ A;  1JO5 A;  4W80 A;  1T2K D;  1FAV A;  3V2R A;  1HH0 A;  1GW4 A;  5AW7 B;  1L4A C;  2GY7 A;  1GL2 D;  2M8R A;  4OH8 B;  1FZB A;  1L4A B;  4O9B A;  4IFD K;  3HD7 C;  4I2L C;  5KJ7 D;  4GKG A;  2JHH C;  1FDM A;  3HD7 B;  3IFM A;  1SQV K;  2N1T A;  1HUC A;  1SFC D;  2I1K A;  1JOC A;  1DEB A;  1URQ A;  1WRG A;  3A7O A;  5AVU B;  3SWF A;  2J2P A;  2J0G A;  2W6A A;  4XE5 B;  1HGV A;  1YYC A;  2XDJ A;  3I5C A;  2D39 A;  3VOP A;  3TNU B;  2Q5U A;  4RES B;  2Q3I A;  1NTK K;  2NPS D;  1MZ9 A;  4WBA A;  1N73 C;  5AVR B;  3OAK A;  1N73 B;  1FIC A;  3OJA B;  1DH3 A;  4LC1 A;  4WB4 A;  3V5B A;  1RE4 A;  1JCD A;  1RF0 A;  1X9V A;  1RE3 A;  3L37 A;  5CCH A;  4AUW A;  2J3F A;  2Z4E C;  1NOH A;  4W7Y A;  2VRS A;  2HOD C;  2Z4E B;  2FYZ A;  5AW0 B;  2J64 A;  2OYH C;  3U59 A;  1A02 J;  2HPC A;  2OYH B;  3VP8 A;  4KHX A;  2ZFC A;  5APX A;  2YO3 A;  3WMM 0;  1JTH A;  3SWY A;  1QL2 A;  1N86 A;  2C9L Y;  1IFD A;  3BAS A;  1PFI A;  1CW5 A;  4R9T A;  2H7H A;  1FZD A;  2JEE A;  1GW3 A;  1VDF A;  3KDP B;  2QM8 A;  3BRV B;  3A5T A;  1GL2 A;  1H88 A;  1FZG A;  2A45 I;  4C7R A;  3H32 C;  1ZR4 A;  2XNX A;  3H32 B;  5AVQ B;  2P1J A;  2J58 A;  2MJZ A;  1XTC C;  1FZE C;  1FZE B;  1FZC A;  2WPS A;  2C0W A;  1IFJ A;  2M3B A;  2IFN A;  2E43 A;  2J5Z A;  3V4Q A;  2YMY A;  1L0N K;  3B8E B;  1HJB A;  3MTU E;  3B5N D;  5APV A;  1FID A;  4WY4 C;  1FOS F;  4WY4 B;  1FZB C;  2Z5H A;  1FZB B;  3FIB A;  1CI6 A;  1NO4 A;  2N1T C;  3RL0 C;  2N1T B;  1FZA A;  3RL0 B;  3VN0 A;  1LTT C;  2YKQ A;  1URQ C;  2O1K A;  1HBW A;  3M06 A;  5AW4 B;  1URQ B;  3EQ2 A;  3RK2 C;  5KLV K;  3RK2 B;  1NTZ K;  4ZKP A;  2E42 A;  4M3L A;  2WSE H;  1JY2 O;  3V4W A;  1GK6 A;  5CJ0 A;  1RE4 C;  1IO4 A;  1RF0 C;  1YTZ I;  5CCH C;  1RE4 B;  1RF0 B;  1LTA C;  1MV8 A;  1SQQ K;  3GHG A;  3TYY A;  3NFQ A;  1DX7 A;  2L5G B;  1JY2 N;  3M0A A;  2HPC C;  3KQG A;  1FBM A;  2KOG A;  2PP6 A;  1RF1 A;  2WT7 A;  2HPC B;  3TK1 A;  3P32 A;  5AW5 B;  2FYU K;  2R32 A;  3T97 A;  3KYQ A;  4LGD E;  2IPP A;  3P8C E;  4DZO A;  2WSC H;  1AFO A;  1JTH B;  3CL3 D;  1L4A D;  1J1D C;  2WZ7 A;  1N86 C;  3V2N A;  1KIL C;  1N86 B;  1GTW A;  3HD7 D;  4AYC A;  1KIL B;  1ZN5 A;  1IFM A;  2HLO A;  2W27 A;  1H8A A;  3VTP C;  5CCG D;  1SLQ A;  2WSF H;  3CLQ A;  2FIB A;  1MFZ A;  3P8M C;  2I1J A;  1FZG C;  3VYI A;  2R3C A;  4HH2 A;  1YTZ T;  1FZG B;  2XNX C;  2JHM F;  5CJ4 A;  2JHK F;  3VMX A;  4GIF A;  1CZQ A;  1W2E A;  5BU5 A;  1HTL C;  1RY3 A;  2J1G A;  4M7H A;  3M9B A;  2WPR A;  4R9J A;  2H43 A;  1M1J C;  1IFI A;  1G1I A;  1EQ7 A;  1M1J B;  2HOD B;  5APU A;  1T3J A;  1SQX K;  1NWQ A;  3MIW A;  3OA7 A;  4N78 E;  2J0Y A;  1LTJ A;  1SP4 A;  2HFE D;  4EIJ A;  1JUN A;  3M0D A;  1Z3U A;  1NKZ B;  3TSI A;  3V2Q A;  4C7N A;  2KB7 P;  4N3Y B;  1X8Y A;  2OAR A;  3PP5 A;  1NKN A;  4ZFG A;  3EFG A;  1XTG B;  2P67 A;  1JY3 O;  5CHX A;  1NHL A;  5AVX B;  2FFD A;  2YKP A;  1JMM A;  5KJ7 A;  3MGN A;  1L4A A;  3NTN A;  1JY3 N;  1LTS C;  3HD7 A;  1OWA A;  3BAT A;  1SFC A;  1ZV8 A;  1GU5 A;  1N7S D;  2BAS A;  3P8C D;  5CMZ A;  5CCG A;  3GHG C;  2JHI F;  3HTK A;  3GHG B;  3U1A A;  2LKM A;  1GU4 A;  1N7L A;  1FZF A;  1RF1 C;  3G3Z A;  2N9B A;  2WT7 B;  3V2P A;  2NPS A;  3VP9 A;  1LWU A;  1LGH B;  2P2U A;  4WY4 D;  2GUS A;  3BVH A;  4JYO X;  1X79 B;  1JNM A;  4IFM A;  2WIT A;  3HE5 A;  2CPS A;  2HLO C;  3LW5 H;  2N1T D;  3RL0 D;  1JY2 P;  1ZR2 A;  1AQ5 A;  2HLO B;  2P7J A;  2JJL A;  4DOJ A;  3L36 A;  5AVY B;  1L0L K;  1LTI C;  1URQ D;  2Q9I A;  4JF7 A;  2OYH A;  1KQL A;  4IFF A;  5AW9 B;  3RK2 D;  1G1J A;  3II6 A;  5AW1 B;  1GDT A;  2GUV A;  1OXZ A;  1T8Z A;  2KSJ A;  2FXM A;  4N78 D;  1JCC A;  1RE3 C;  2R5D A;  2H43 C;  1RE3 B;  2OYI A;  2H43 B;  1J2J B;  3RK3 C;  2J3F D;  3NXS A;  5CCH D;  1HGZ A;  3RK3 B;  2YKO A;  3N7N A;  2WNP F;  1LTJ C;  1G2C A;  1GD2 E;  1LTJ B;  1A02 F;  1H89 A;  3H32 A;  3M0D C;  3U1C A;  3P7K A;  1N7S A;  5AVV B;  2IX7 C;  1J1D B;  4C7N B;  1FJP A;  4Y99 C;  1T2K C;  3B5N A;  2XV5 A;  4Y99 B;  1KFM A;  3C9I A;  1HWT C;  5BU8 B;  1KIL D;  1GL2 C;  1CSB A;  2XU6 A;  3HUS A;  1GL2 B;  2FFD C;  5KJ7 C;  2Q7C A;  2KP8 A;  5APY A;  2FFD B;  4WY4 A;  2J3U A;  1LTG C;  2XNX B;  1N2D C;  4LLH A;  2ZXE B;  3CI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...