1LWUC

Crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRPCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha-1 chain
publication title Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood clotting
total genus 84
structure length 317
sequence length 317
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2002-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lwuC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lwuC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lwuC02
1FIDA 4ZFGA 2J1GA 4JZCA 1LTJC 1RF1C 2JHHC 1LWUA 1JY2P 3GHGA 2JHLF 1LWUB 1N73A 3GHGB 1N73B 2J3FA 1RE4A 2A45I 1RE4B 2GY7A 2HODA 3BVHA 1LT9C 2JHKF 2HODB 3BVHB 2H43A 1RF0A 2H43B 1JY3O 2FFDA 2J2PA 1RF0B 4EPUA 2FFDB 1FZDA 1FZFC 3HUSA 1FZEC 3HUSB 2OYIA 2OYIB 2HLOA 4R9JA 1FZAA 1JY3P 2HLOB 1FZAB 4R9TA 2HPCA 2Z4EC 2HPCB 2D39A 3H32C 2J3FD 1LT9A 1M1JC 2J3GA 3FIBA 1LT9B 1FZBA 1FZBB 1W2EA 4JYOX 1FZFA 1FZCA 1RE3C 1T3UA 2WNPF 3E1IC 1FZFB 1FZCB 2J64A 1FZGA 2A45H 1FZGB 1Z3UA 2JHMF 1LWUC 3GHGC 1LTJA 1N73C 1JY2N 1RF1A 1JY3N 1LTJB 1RF1B 2XNXC 4NYTA 2J61A 4M7HA 2J61B 1RE4C 1N86C 2J0HA 3H32A 3BVHC 3H32B 1M1JA 2H43C 1M1JB 4M7FA 1RF0C 1FZGC 2FFDC 2Q9IC 2JHIF 2OYHC 2J0GA 1JC9A 1RE3B 3HUSC 2J5ZA 2J0YA 1FZEA 2J60A 2OYIC 1FZEB 2HLOC 1FZAC 1Z3SA 2XNXA 1FICA 2XNXB 2HPCC 1N86A 1FIBA 2Z4EA 1N86B 2Z4EB 2HODC 1FZBC 1JY2O 2Q9IA 2J3UA 2Q9IB 2OYHA 2OYHB 1FZCC 2FIBA 2J3OA 1RE3A 3E1IA 2A45G 3E1IB
chains in the Genus database with same CATH superfamily
3CD6P 1KYOH 4LLHA 3TF5A 3CCQP 1G2CA 4HKZH 1BCCG 1KQFB 2JHLF 4H0LC 5AVTB 4ZMDA 4WB4A 4AUWA 1SQQK 4WY4D 1U57A 2C0XA 1ZOYC 2H43A 2E42A 3EFFK 1FZDA 2O01H 3LW5J 1G1JA 1BSNA 2FKWB 1IO4A 1ZN5A 3FXEA 3MIWA 4UB6E 1A02J 4H13C 1L2PA 1LJ2A 4L75A 5H2FE 3T97B 2B9BA 1FZCA 4KT0J 1FZFB 1JB0J 2A45H 1S5LH 4LGDE 3KHUA 3HE4A 2QA4P 1KYOD 3OW2O 4I7ZC 1T6AA 2XU6A 2R5BA 3PTZA 4CPGA 1RE4C 1Q82Q 3BVHC 1NTMJ 2XV5A 1USDA 1KB9D 3BCCD 3L36A 3VP9A 1PPJD 1ZRTD 2P2UA 1EDKA 1NOHA 1KILD 2D2CB 3TGUJ 1Y47A 2OYIC 1VL2A 5AW2B 5AVUB 3L70D 4N3YB 1KB9E 2JWDA 3V2RA 2P58A 1PPJE 3KXDA 1JMMA 3L70E 5APVA 1EZVD 2J1GA 2E75B 4YXDC 1HTLC 2QEXP 3V4QA 1OZHA 3M0DC 1YI2P 1EZVE 1AA0A 1DEEG 2FFDB 5AW0B 3MP7B 2YIUB 3AE1C 5CCHA 3GW6A 5AVZB 1GL2B 1FDOA 2PFXA 4ZNCA 1SFCB 2HLOB 1PIXA 1RQVA 1T3JA 1VQ6P 5TISE 4A7PA 2I1KA 1FZBA 4HJGH 1J1DB 1QGKB 2Q1KA 2KLUA 3A2AA 4JYOX 5CBNA 1MFZA 3RK3D 2A06D 4NYTA 1SQBD 3P7KA 3BCCJ 3SWYA 2N1TA 2JWAA 1NTKJ 5CHXA 2KUBA 4H44B 1WMKA 3CXHH 1BSHA 3OA7A 1M90Q 3B5NB 1SQBE 1DD4A 3L70J 4GOFA 1S4XA 4MN4C 2P67A 2G8YA 4WY4B 5C39A 1FICA 5KLVG 2Z4EB 3F5HA 3D6YA 3M9QA 1L0LG 1LP1B 1YBKA 5BU8B 2Y0EA 3A0HH 3EQ2A 1M1KQ 2KOGA 3S9OA 5KLVK 1EXJA 1HUCA 4C7NA 5GTIH 1L0LK 3VP8A 2J3FA 4R4LA 1N2DC 2ZAEB 1JCCA 2WMMA 1LTTC 2K3RA 3FWLA 2PGDA 3M06A 1GW4A 1A02F 1DIPA 1BDDA 4Y99B 3PHLA 1SQXG 2ZFCA 2ZXXA 1KQGB 1LT9A 1N8RQ 1S72P 2J3GA 3C8VA 1BGYE 3PH0A 1H88A 1MZ9A 3AEBC 5B5EE 1SQXK 2IBZG 2ZT9B 2H89C 1VQLP 2N9BA 1RF1A 2NPSA 3L75D 1URQA 3H1LD 1OW7A 2WTYA 3U1AA 1Q86Q 1W5CE 1H0TB 1LTIC 3AE5C 1M7LA 3L74D 5L8RJ 3L75E 2QG4A 3H1LE 2L5GB 2J60A 3CPWO 1EQ7A 3NXSA 4GOEA 1BE3J 4PD4I 1EXIA 5AW6B 2HPCC 3L74E 4LC1A 5CCGD 1L0ND 1JNMA 4EIJA 3WU2H 2YXRB 2E74D 3WUUA 1L0NE 1LWUA 5KKZB 3CMEP 2XZRA 4AQRD 3MUDA 3A0BE 5GTHE 2BCCD 2HYNA 1RF0A 2G3AA 1YITP 1YQ4C 3A3YB 2WPRA 5APXA 1FBMA 2W90A 2PAJA 3HE5B 1KN7A 5KTBA 2OTJP 4HH2A 4IL6E 3AEAC 3E1IC 1RH5B 2ZXEB 3RL0D 4NPFX 3H1JG 2JHMF 2B87B 3L75J 1Q7YQ 1E5WA 2WSEH 3H1LJ 2LXBA 3H1KE 1IFIA 2NRGA 3MHVA 1GU4A 1VF5B 4L73A 2Q6QA 2N1TD 3A5TA 1N7SD 2I1JA 2WSCH 1IC2A 2JP3A 1LNQA 1Z3SA 2M3BA 1R8EA 1JTHB 1AFOA 2YMYA 3H1ID 1QVFO 4PJ0H 1USEA 2OYHB 3C9IA 1AJYA 1NWQA 1GU5A 3HD7D 1P84E 4JZCA 1HJ0A 2W6JH 2IYOA 1KORA 1M57D 2R44A 1DEBA 1RE4A 2BCCJ 1OVVA 4EOTA 2WWWA 2QJPC 2HODA 3BVHA 1LT9C 2QSIA 4JYBA 2P10A 4PD4H 1Z56A 2ZYAA 1M8OB 1LTBC 2JR8A 2D2CC 4PV1D 2KS1A 2OYIA 5APQA 1CW5A 2QJKB 2D39A 4Z1MH 2E76B 2CPBA 1PGPA 1MUUA 3L72J 5AVVB 1PPJG 1RHZB 2QE7H 1VQ7P 2E75C 1FZGB 3GMAA 2HFED 3CCVP 2M3EA 2NPSD 3IFMA 2LKMA 1URQD 3M0DA 1WRGA 1M1JA 5B66H 2FFDC 5BU5A 4DCKA 4IFDK 2YIUC 4PD4D 1EZVG 4IFFA 4DZOA 2DW3A 1S9KD 4OGQD 3R4YA 1GL2C 1QEXA 2HLOC 1S9KE 3H1IJ 3S1KA 3GG2A 2AEFA 2J3OA 3AEEC 2B89A 4U7JA 2M5AA 2WSEJ 2QRXA 2ZYGA 3TGUD 1NTME 1FJPA 3G6EP 1JM0A 4H44C 2KIKA 4GIFA 2QJYB 3RL0B 3B5NC 3TGUE 2W6AA 2WSCJ 2FBWC 3HUSB 2RKLA 3PP5A 5AVRB 2WPVB 4WY4C 1SQBG 2UWJE 3JCUE 2JKVA 2Z4EC 2Q5UA 3ITKA 3VMXA 3P8CD 5AW5B 1TU3F 1J2JB 2FYUJ 1SQBK 1N7SB 1SQPD 5CMZA 3HTKA 1NU1J 1MKMA 3P8CE 4O9BA 1NJIQ 2W6BA 4XA4A 3CXHI 1SQPE 4M7FA 3KPEA 4UB8E 2K9JB 4EI2A 4DJGA 1YIJP 4W80A 2AXTE 3HD7B 3LIDA 2KNCA 3C1LA 1GD2E 1QX8A 3VMAA 3KZIE 2CPSA 3AE3C 3PRJA 1JOCA 3B4SA 2HODC 4H13D 3V6IA 2Q9IA 1U7JA 1KYOE 3I55P 1BGYG 2GA1A 4PV1B 1NTKD 2ZT9C 3WUVA 1FU1A 1SQVD 2YXQB 3GHGB 4D6TD 2P1JA 1MFTA 3BCCE 2FYZA 1NTKE 2JHKF 1ZRTE 1PP9D 1X8YA 1KILE 3H1HD 4RO0A 2M8RA 1BDCA 4XFJA 2OYOA 3L71G 2ITAA 4M3LA 1GK6A 2QVAA 1PP9E 3TDKA 4BXLA 4R9JA 4I6MC 2HPCA 3PJSK 3NMDA 1NTZD 3TNUB 1JO5A 1FDIA 1M1JC 3G71P 1OW8A 2FXPA 1S5LE 3L74G 5AVYB 1SQPJ 2WNPF 1R5LA 4OGQB 3E1IB 1HGVA 3QH9A 4BRYA 1CSBA 5KKZC 2IZ0A 2FXMA 1LTJB 2J61A 3H32A 1L0NG 4GDOA 5CBOA 5AVSB 3JSVC 4KHXA 5AW1B 1KTMA 1GMJA 1LTSC 5KAFH 1L0NK 1FZEB 1FAVA 2W27A 2XNXA 3V2PA 4N6JA 1QL2A 2WT7A 1N86A 3TSIA 3A7OA 2O01J 1YHQP 5EFWB 2BASA 3E1IA 3RK3E 1SQVJ 1L4AB 2A06E 1OMIA 2Y0DA 4D6TJ 1DD3A 5TJHA 2JJLA 3FX0A 2AEMA 3OAKA 1N73B 2H8PD 1PP9J 4NPEA 4RKUJ 1BE3D 1Q2NA 3H1HJ 1VF5C 3VN0A 3MZWB 3H1KG 4C46A 2H88C 2J2PA 4EDFA 3M9HA 1OVUA 4WWIA 1KFNA 5DJTB 1FOSE 3AE7C 1BE3E 2IDBA 1NTZJ 1SLQA 3SFDC 2K37A 2V4HA 3CMAP 3IN6A 2Q7CA 3CL3D 4ZKPA 3T97A 4TT3H 1FZFA 1KZUB 3TYYA 3CXHD 1PGQA 1SP4A 1VQ9P 2PP6A 4I2LC 3CXHE 2IBZI 4K3AA 4W7ZA 4NPDA 1IFMA 2Q9IC 1XTGB 3L73J 1CI6B 2YKQA 3O6QB 3RBXA 5KLIC 2KXPB 1X0TA 1KILB 4W7YA 1GW3A 5KAIH 3KYQA 3AEDC 1NGMB 4C7RA 3CWBD 3CCRP 2E76C 3A0HE 4XE5B 2POHA 3CLQA 3W68A 2J3UA 2E5YA 1U7MA 1FZGC 3RBZA 5GTIE 4B86A 3CWBE 1BCCJ 1OX3A 1OW6A 1MV8A 4L74A 5CCGC 1SS1A 1YJWP 1NH4A 2FFDA 3AEGC 1HGZA 1OXZA 4IL6X 3O8ZA 3GF7A 1IFDA 2M0BA 2XNDH 1R5SA 2OQQA 1GL2A 2IFMA 1SFCA 2HLOA 4IOIH 3V4WA 5KJ7C 2JEEA 1FZAB 2BEQD 2QIWA 3CX5H 1KV4A 3H32C 2IFNA 1GZLA 3GF3A 3MD0A 1IZNB 2LR2A 2SPZA 4RJTA 2P7JA 4OVNF 3RK3B 2BCCE 5CCHD 2XNXC 1N86C 1ZR2A 1NTMG 3RL0C 1VDFA 2B88A 1VQ8P 3B5NA 5AW8B 1K05A 1KC8Q 5APYA 2OTLP 1LGHB 3L72D 3HUSC 3E1RA 1S3JA 3TGUG 1CZQA 2IX7C 3CWBJ 4WY4A 1NTMK 1EC5A 1ZP0C 1NKZB 2Z4EA 3L72E 1LP1A 4BWNA 3V2NA 1JUNA 2R32A 3GLMA 2Q3EA 3WU2E 4JQ0D 2HG5D 1RE3B 5APWA 2JO1A 1G2CB 2V7QH 3D70A 5CJ4A 3Q1MA 1PGOA 1KQSO 2H43B 2QM7A 5AW4B 3D71A 1N7LA 4GT1A 1FZFC 1SQPG 3I5CA 3HD7C 1OIPA 1VQKP 1ZLLA 2WSFH 5DJUB 3H1IE 3PLNA 1SQXD 4KJMA 1SQPK 2J3FD 5AW9B 1CI6A 3R2PA 2MJZA 5AVWB 4EYYQ 2YKOA 1FZCB 2J64A 1QLED 3WMM0 3QWOC 2Y0CA 3AE4C 1K8AQ 1OFCX 2IBZD 3HE4B 3S4RA 3GHGC 3VOPA 1NHLA 3RGUA 1YQ3C 1S1CX 2K1AA 1OVRA 1FE6A 3BCCG 2R3CA 1H0TA 2ZYDA 3L4FA 4YTPC 3IAOA 1NTKG 1FS0E 2FYNB 1IFNA 3F89A 4U3FD 2FYUD 2D2CD 3L70G 5E79H 3AEFC 3VMYA 1NU1D 4RESB 1FIBA 1PP9G 1NTKK 4PJ0E 4K35A 1L0LJ 4OH8B 1SQVK 4U3FE 2FYUE 4DOJA 4ASVA 4OGQC 1EDIA 1FOSF 1NU1E 2A45G 2J58A 1KD1Q 2E74B 1LTJC 1SFCC 1EDJA 3KQGA 4PD4E 2GY7A 1VQNP 1JEKA 1PGJA 4L76A 1J1DC 1HBWA 3BATA 3RK2D 2Y9YA 3LIEA 1LTGC 2YO2A 1NTZK 1ZW0A 1FZEC 5AVXB 1SQXJ 5AW3B 3HE5A 2VRSA 4I1LA 3L35A 1AVYA 1RY3A 2W8ZA 4UB6H 1FZBB 1L4AC 5H2FH 3VYIA 1ZMEC 5M1BA 2B87A 1Z3UA 2O1JA 3H1JD 2V7QJ 2A06G 1N73C 4HYTB 3RL0g 5B66E 1T2KD 2YNYA 2J0HA 4WBAA 1NVOA 3B71A 1VQOP 2N1TB 4U3FJ 3V2QA 3B5ND 1IK7A 2OTKE 2WSFJ 2KB7P 2Y9ZA 1BE3G 4H0LD 1KB9H 1JTHA 3G4SP 2WVRA 1DX7A 1PV3A 2OYHA 1D7MA 2FIBA 3I56P 1Q90D 3CI9A 1ZR4A 4Y99C 4C7NB 1JY2P 5AVQB 2WITA 4R4MA 3CC2P 3IR9A 3FWNA 4JF7A 3G9RA 1S5LX 2NZ2A 2BEZF 1YTZI 3P8MC 1PFIA 1KILC 1RQUA 3L37A 1WT6A 1QL1A 5APUA 2E5TA 1VQMP 3K5BA 2QJPB 3Q2YA 1LT9B 1GTWA 3EWKA 5TISH 3SFEC 1SQVE 4ASWA 1X79B 3H1JJ 4D6TE 1FZGA 2ZVNB 2ZT9D 3L75G 1JY3N 2KZJA 3CWBG 1RF1B 2YMKA 3P32A 2K9YA 2NPSB 3H1HE 4HB1A 5CCGA 3H1LG 1URQB 1NAFA 2R5DA 4DT0A 5APTA 2J0GA 1JC9A 1DH3A 3CCLP 2KI7B 2C0WA 1KFMA 1NTZE 3Q5RA 1Q81Q 1HWTC 1FZAC 1OWAA 5KJ7A 1IFPA 1ZXGA 3Q3DA 1JY2O 2O1KA 1J1EB 3RK2B 3ABVC 2Q3IA 3L73D 3JC22 3CCMP 3RK3C 2WQYC 2KLVA 1T8ZA 1LWUB 3CCSP 3M9BA 3D6ZA 3H6PA 2BCCG 3L73E 1RF0B 2XKMA 2MKVA 1SQQD 1XTCC 2J59M 2R3SA 3HUSA 3CX5I 1X9VA 1YTZT 1BCCD 1IK9A 3SWFA 4GKGA 1SQQE 4JBZA 2KP8A 1AV1A 2YKPA 3L72G 1RE3C 1N7SA 1BCCE 3VTPC 2KK7A 5B5EH 3CCUP 4M7HA 1LT1A 4H0LB 1H89A 2Z5HA 2C9LY 2H43C 3NFQA 1VF5D 2K9JA 1VQPP 2OYHC 4TLFA 5KAFE 2I8DA 1P84I 1YJ9P 3HD7A 2J5ZA 2J0YA 2N9YB 2O3JA 3N7NA 1JCDA 2QM8A 2C9NY 1NKNA 3UIAA 4H13B 3H1IG 1K9MQ 1VQ5P 1KQLA 3KDPB 3TK1A 2KYVA 1FZCC 4YXWH 1BGYD 3CC7P 2AEJA 1YYCA 3GHGA 3U59A 2YO3A 4I7ZB 2QJKC 1RE4B 4IFMA 2HODB 3BVHB 1PL5A 1SQQJ 3A0BH 2FYNC 5GTHH 1FJKA 3E7KA 3L71D 1SQBJ 3BRVB 2KS1B 2OYIB 3HRNA 1S2EA 2AXCA 3TNUA 2PRRA 3WUTA 3V5BA 1KMIZ 2E76D 2W83C 2OARA 3L71E 1NYHA 1W2EA 3SWKA 3MGNA 4U3FG 4ZKUA 2FYUG 5K5GB 2E74C 1FC2C 1FDMA 2LXCB 4IL6H 1NU1G 1LTJA 3AECC 1JY2N 3EFGA 3USSA 2JDIH 3CCEP 1AVOA 2FYUK 3FXDA 1M1JB 2JHIF 2OGUA 2WSSH 5KAIE 3MTUE 1NU1K 3B8EB 5CCHC 2GUVA 1FZEA 1IFJA 5APSA 5KJ7D 1E79H 1VQ4P 1EDLA 3G3ZA 1FZBC 4JPZB 3M0AA 1LTAC 2QJYC 2WPSA 1BGYJ 1ZV8A 1L4AA 2K88A 2RMZA 4ZFGA 1AQTA 2JHHC 2M5AB 1N73A 1HH0A 1P84H 1K04A 2ZJSE 5BVZA 5KLVD 3CX5D 2N1TC 2WZ7A 2KZIA 3H1KD 1L0LD 1N7SC 2KSJA 3L71J 1Y9BA 3ZDMA 4YPCA 5KLVE 3CX5E 2ZVOB 2XDJA 2KSEA 1AQ5A 1JY3P 3FGAD 2E43A 1L0LE 3L74J 2H7HA 1W2BO 1JMBA 3HTKB 2O01N 1L0NJ 1K73Q 1H8AA 1P84D 3AE6C 4QMAA 1KYOI 3O6QA 3LW5H 4PV1C 1KILA 1SQXE 2IPPA 1KB9I 3Q5SA 2KNCB 3CCJP 1UIXA 3U1CA 1HJBA 1YJNP 4JYCA 1PZQA 2Q9IB 2IBZE 4N78D 2IYPA 5KLIB 1HVVA 2FXOA 1FIDA 2Z5IA 1SQVG 4WVZA 3SSUA 4D6TG 1RF1C 1GK4A 2NPSC 1URQC 5KLVJ 1QVGO 4N78E 1EZVI 2A45I 3II6A 2CK3H 3H1KJ 2GM4A 2HR3A 3H1HG 2FY8A 1JY3O 2L91A 4EPUA 2RN0A 1M56D 2RH0A 3AE9C 2GUSA 3W67A 3H25A 2E75D 1IJDB 1FZAA 4R9TA 1NTZG 2HPCB 1UIIA 1J1EC 3JCUH 3FIBA 3RK2C 4Y28J 1T3UA 3N4XA 3Q5PA 2J5UA 1SVFA 3AE8C 3BRTB 4BRYB 1LWUC 3AE2C 1GL2D 4AYCA 1SFCD 3IF4A 2J61B 3MUDC 3NTNA 3H32B 3BASA 1X22A 4GODA 1NAYA 1RF0C 1NTMD 3L73G 2IZ1A 4OWFA 5E79E 4UB8H 3M91A 1HF9A 1G1IA 1T2KC 1NO4A 1VPCA 2AXTH 1Y8AA 3CC4P 2XNXB 3OJAB 5CJ0A 5AW7B 2WT7B 1N86B 1GDTA 3VMZA 3KZIH 3H1JE 1SQQG 2WPQA 1RE3A 4H44D 1L4AD
chains in the Genus database with same CATH topology
4B86A 1NWQA 1GU5A 3HD7D 4JZCA 4LLHA 3RK3C 1G2CA 2KLVA 1MV8A 1T8ZA 1LWUB 2JHLF 3M9BA 5CCGC 3H6PA 5AVTB 4WB4A 4AUWA 1SQQK 4WY4D 1DEBA 1RE4A 4EOTA 2WWWA 2HODA 3BVHA 1LT9C 1NH4A 2C0XA 2H43A 2E42A 4JYBA 2FFDA 1HGZA 1RF0B 1OXZA 1FZDA 2O01H 1Z56A 2XKMA 3O8ZA 1G1JA 1IFDA 1LTBC 2FKWB 1XTCC 2J59M 3HUSA 1IO4A 1X9VA 1ZN5A 1GL2A 2IFMA 1SFCA 2OYIA 3MIWA 5APQA 2HLOA 3V4WA 5KJ7C 1YTZT 2JEEA 1FZAB 1CW5A 1IK9A 3SWFA 1A02J 4GKGA 2KP8A 2D39A 2IFNA 3H32C 2CPBA 2YKPA 1MUUA 1GZLA 5AVVB 3MD0A 1RE3C 1FZCA 1N7SA 1FZFB 2A45H 4LGDE 1FZGB 3VTPC 3HE4A 2HFED 2P7JA 3RK3B 2XU6A 5CCHD 2XNXC 2R5BA 4M7HA 2NPSD 1RE4C 3IFMA 2LKMA 1N86C 1URQD 3M0DA 1H89A 3BVHC 1WRGA 1M1JA 2XV5A 2Z5HA 2C9LY 2H43C 1ZR2A 3NFQA 2FFDC 5BU5A 4IFDK 2OYHC 3RL0C 1VDFA 3L36A 4IFFA 3VP9A 4DZOA 3B5NA 5APYA 5AW8B 1S9KD 3HD7A 1LGHB 3HUSC 2P2UA 1NOHA 1GL2C 1KILD 2J5ZA 2J0YA 3N7NA 5AW2B 2OYIC 2HLOC 5AVUB 1CZQA 1JCDA 2IX7C 4N3YB 4WY4A 1NTMK 2QM8A 1NKZB 3V2RA 2Z4EA 2C9NY 1NKNA 3UIAA 1S9KE 3V2NA 1JUNA 1KQLA 2R32A 3KDPB 3TK1A 2KYVA 1JMMA 1FZCC 2J3OA 2HG5D 5APVA 1RE3B 5APWA 2J1GA 1G2CB 1YYCA 3GHGA 3U59A 1HTLC 2YO3A 5CJ4A 3V4QA 3M0DC 1RE4B 4IFMA 2HODB 3BVHB 2H43B 1FJPA 2QM7A 5AW4B 2FFDB 4GIFA 5AW0B 1N7LA 4GT1A 3RL0B 1FZFC 3B5NC 3I5CA 3HD7C 1FJKA 2W6AA 3HUSB 5CCHA 5AVZB 1GL2B 3BRVB 3PP5A 5AVRB 1SFCB 1ZLLA 4WY4C 2OYIB 2HLOB 3HRNA 1T3JA 2WSFH 2Z4EC 3TNUA 1SQPK 2J3FD 2I1KA 2Q5UA 3V5BA 1FZBA 1CI6A 5AW9B 3VMXA 3P8CD 1J1DB 2OARA 3R2PA 5AW5B 3A2AA 1W2EA 1J2JB 2MJZA 5AVWB 4JYOX 3MGNA 2YKOA 4ZKUA 1FZCB 2J64A 1SQBK 3WMM0 1N7SB 5CMZA 1FDMA 3HTKA 3HE4B 3GHGC 3VOPA 1NHLA 1LTJA 1JY2N 1MFZA 3P8CE 3EFGA 4O9BA 3RK3D 4NYTA 2W6BA 4XA4A 3P7KA 2FYUK 3SWYA 1M1JB 4M7FA 2R3CA 3KPEA 2N1TA 2JHIF 3L4FA 5CHXA 3MTUE 1NU1K 4W80A 3OA7A 3B8EB 3B5NB 1IFNA 3HD7B 5CCHC 2GUVA 1FZEA 3LIDA 1IFJA 1GD2E 5APSA 3VMYA 2P67A 2CPSA 4WY4B 1FICA 5KJ7D 4RESB 1FIBA 1NTKK 1JOCA 2Z4EB 3G3ZA 2HODC 3M9QA 4OH8B 1FZBC 1SQVK 2Q9IA 3M0AA 4DOJA 1LTAC 5BU8B 2WPSA 1ZV8A 1L4AA 3EQ2A 1FOSF 2A45G 2KOGA 2J58A 4ZFGA 1FU1A 5KLVK 1HUCA 4C7NA 1LTJC 1SFCC 2JHHC 1N73A 1L0LK 3GHGB 3VP8A 2P1JA 1HH0A 2J3FA 3KQGA 5BVZA 2FYZA 2GY7A 1N2DC 2JHKF 2N1TC 1J1DC 1X8YA 1HBWA 2WZ7A 1JCCA 3BATA 3RK2D 1N7SC 2M8RA 3LIEA 2KSJA 1LTGC 1LTTC 2YO2A 1NTZK 3M06A 1FZEC 1GW4A 4M3LA 1A02F 1GK6A 4Y99B 5AVXB 4R9JA 2XDJA 1AQ5A 1JY3P 5AW3B 2E43A 2ZFCA 3HE5A 4I6MC 2VRSA 4I1LA 2HPCA 3L35A 3NMDA 3TNUB 1JO5A 1LT9A 1M1JC 1RY3A 2J3GA 2H7HA 1FZBB 5AVYB 1H88A 1L4AC 2WNPF 1MZ9A 3VYIA 3E1IB 1SQXK 1HGVA 1Z3UA 2O1JA 1CSBA 3HTKB 2N9BA 1N73C 1RF1A 2FXMA 4HYTB 1LTJB 2NPSA 2J61A 1T2KD 1URQA 2YNYA 2J0HA 1H8AA 3H32A 4WBAA 2WTYA 3U1AA 2N1TB 5AVSB 1LTIC 1M7LA 4KHXA 3LW5H 5AW1B 3V2QA 1KILA 3B5ND 1LTSC 2IPPA 2L5GB 2J60A 1L0NK 1FZEB 1EQ7A 3NXSA 2KB7P 1FAVA 2W27A 2XNXA 3U1CA 3V2PA 4N6JA 5AW6B 1QL2A 2WT7A 2HPCC 1N86A 4LC1A 1HJBA 5CCGD 1JTHA 3TSIA 3A7OA 4JYCA 2Q9IB 1DX7A 1JNMA 2OYHA 2FIBA 2BASA 4N78D 3E1IA 1L4AB 4EIJA 1HVVA 1FIDA 2Z5IA 3CI9A 1ZR4A 4Y99C 2JJLA 1RF1C 1LWUA 1GK4A 1JY2P 2NPSC 3OAKA 5AVQB 4C7NB 1N73B 1URQC 2H8PD 2WITA 2XZRA 3IR9A 4N78E 4AQRD 3MUDA 2A45I 3II6A 4JF7A 3VN0A 2GM4A 4C46A 2HYNA 1RF0A 1JY3O 2J2PA 4EPUA 3M9HA 3P8MC 1YTZI 1KFNA 1PFIA 1KILC 2GUSA 1FOSE 3L37A 3A3YB 2WPRA 1IJDB 1WT6A 5APXA 1QL1A 1FZAA 5APUA 1SLQA 1FBMA 4R9TA 2PAJA 3HE5B 2HPCB 2Q7CA 3CL3D 4ZKPA 1J1EC 3T97A 1LT9B 1GTWA 3FIBA 3RK2C 5KTBA 4HH2A 1X79B 1FZFA 1T3UA 1KZUB 3N4XA 3E1IC 2ZXEB 3TYYA 3RL0D 1FZGA 1SVFA 2JHMF 3BRTB 1SP4A 1LWUC 1E5WA 1GL2D 1JY3N 4AYCA 2WSEH 1RF1B 1SFCD 3P32A 2NPSB 5CCGA 2J61B 1IFIA 1URQB 2PP6A 4I2LC 3NTNA 3H32B 3BASA 1NAFA 1GU4A 1RF0C 2R5DA 4W7ZA 5APTA 1IFMA 2Q9IC 1XTGB 1CI6B 2YKQA 2N1TD 2J0GA 1JC9A 3A5TA 1KILB 1N7SD 4W7YA 2I1JA 1GW3A 3M91A 1DH3A 1G1IA 2C0WA 2WSCH 1KFMA 1IC2A 3KYQA 1T2KC 1NO4A 1VPCA 1HWTC 1FZAC 1Z3SA 1OWAA 5KJ7A 2XNXB 3OJAB 2M3BA 5CJ0A 5AW7B 4C7RA 2WT7B 1N86B 1GDTA 3VMZA 4XE5B 1JY2O 2POHA 1JTHB 2O1KA 3CLQA 1J1EB 1AFOA 2J3UA 2YMYA 3RK2B 2OYHB 2Q3IA 3C9IA 2WPQA 1RE3A 1FZGC 1L4AD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FID A;  4ZFG A;  2J1G A;  4JZC A;  1LTJ C;  1RF1 C;  2JHH C;  1LWU A;  1JY2 P;  3GHG A;  2JHL F;  1LWU B;  1N73 A;  3GHG B;  1N73 B;  2J3F A;  1RE4 A;  2A45 I;  1RE4 B;  2GY7 A;  2HOD A;  3BVH A;  1LT9 C;  2JHK F;  2HOD B;  3BVH B;  2H43 A;  1RF0 A;  2H43 B;  1JY3 O;  2FFD A;  2J2P A;  1RF0 B;  4EPU A;  2FFD B;  1FZD A;  1FZF C;  3HUS A;  1FZE C;  3HUS B;  2OYI A;  2OYI B;  2HLO A;  4R9J A;  1FZA A;  1JY3 P;  2HLO B;  1FZA B;  4R9T A;  2HPC A;  2Z4E C;  2HPC B;  2D39 A;  3H32 C;  2J3F D;  1LT9 A;  1M1J C;  2J3G A;  3FIB A;  1LT9 B;  1FZB A;  1FZB B;  1W2E A;  4JYO X;  1FZF A;  1FZC A;  1RE3 C;  1T3U A;  2WNP F;  3E1I C;  1FZF B;  1FZC B;  2J64 A;  1FZG A;  2A45 H;  1FZG B;  1Z3U A;  2JHM F;  1LWU C;  3GHG C;  1LTJ A;  1N73 C;  1JY2 N;  1RF1 A;  1JY3 N;  1LTJ B;  1RF1 B;  2XNX C;  4NYT A;  2J61 A;  4M7H A;  2J61 B;  1RE4 C;  1N86 C;  2J0H A;  3H32 A;  3BVH C;  3H32 B;  1M1J A;  2H43 C;  1M1J B;  4M7F A;  1RF0 C;  1FZG C;  2FFD C;  2Q9I C;  2JHI F;  2OYH C;  2J0G A;  1JC9 A;  1RE3 B;  3HUS C;  2J5Z A;  2J0Y A;  1FZE A;  2J60 A;  2OYI C;  1FZE B;  2HLO C;  1FZA C;  1Z3S A;  2XNX A;  1FIC A;  2XNX B;  2HPC C;  1N86 A;  1FIB A;  2Z4E A;  1N86 B;  2Z4E B;  2HOD C;  1FZB C;  1JY2 O;  2Q9I A;  2J3U A;  2Q9I B;  2OYH A;  2OYH B;  1FZC C;  2FIB A;  2J3O A;  1RE3 A;  3E1I A;  2A45 G;  3E1I B; 
#chains in the Genus database with same CATH topology
 3CD6 P;  1KYO H;  4LLH A;  3TF5 A;  3CCQ P;  1G2C A;  4HKZ H;  1BCC G;  1KQF B;  2JHL F;  4H0L C;  5AVT B;  4ZMD A;  4WB4 A;  4AUW A;  1SQQ K;  4WY4 D;  1U57 A;  2C0X A;  1ZOY C;  2H43 A;  2E42 A;  3EFF K;  1FZD A;  2O01 H;  3LW5 J;  1G1J A;  1BSN A;  2FKW B;  1IO4 A;  1ZN5 A;  3FXE A;  3MIW A;  4UB6 E;  1A02 J;  4H13 C;  1L2P A;  1LJ2 A;  4L75 A;  5H2F E;  3T97 B;  2B9B A;  1FZC A;  4KT0 J;  1FZF B;  1JB0 J;  2A45 H;  1S5L H;  4LGD E;  3KHU A;  3HE4 A;  2QA4 P;  1KYO D;  3OW2 O;  4I7Z C;  1T6A A;  2XU6 A;  2R5B A;  3PTZ A;  4CPG A;  1RE4 C;  1Q82 Q;  3BVH C;  1NTM J;  2XV5 A;  1USD A;  1KB9 D;  3BCC D;  3L36 A;  3VP9 A;  1PPJ D;  1ZRT D;  2P2U A;  1EDK A;  1NOH A;  1KIL D;  2D2C B;  3TGU J;  1Y47 A;  2OYI C;  1VL2 A;  5AW2 B;  5AVU B;  3L70 D;  4N3Y B;  1KB9 E;  2JWD A;  3V2R A;  2P58 A;  1PPJ E;  3KXD A;  1JMM A;  3L70 E;  5APV A;  1EZV D;  2J1G A;  2E75 B;  4YXD C;  1HTL C;  2QEX P;  3V4Q A;  1OZH A;  3M0D C;  1YI2 P;  1EZV E;  1AA0 A;  1DEE G;  2FFD B;  5AW0 B;  3MP7 B;  2YIU B;  3AE1 C;  5CCH A;  3GW6 A;  5AVZ B;  1GL2 B;  1FDO A;  2PFX A;  4ZNC A;  1SFC B;  2HLO B;  1PIX A;  1RQV A;  1T3J A;  1VQ6 P;  5TIS E;  4A7P A;  2I1K A;  1FZB A;  4HJG H;  1J1D B;  1QGK B;  2Q1K A;  2KLU A;  3A2A A;  4JYO X;  5CBN A;  1MFZ A;  3RK3 D;  2A06 D;  4NYT A;  1SQB D;  3P7K A;  3BCC J;  3SWY A;  2N1T A;  2JWA A;  1NTK J;  5CHX A;  2KUB A;  4H44 B;  1WMK A;  3CXH H;  1BSH A;  3OA7 A;  1M90 Q;  3B5N B;  1SQB E;  1DD4 A;  3L70 J;  4GOF A;  1S4X A;  4MN4 C;  2P67 A;  2G8Y A;  4WY4 B;  5C39 A;  1FIC A;  5KLV G;  2Z4E B;  3F5H A;  3D6Y A;  3M9Q A;  1L0L G;  1LP1 B;  1YBK A;  5BU8 B;  2Y0E A;  3A0H H;  3EQ2 A;  1M1K Q;  2KOG A;  3S9O A;  5KLV K;  1EXJ A;  1HUC A;  4C7N A;  5GTI H;  1L0L K;  3VP8 A;  2J3F A;  4R4L A;  1N2D C;  2ZAE B;  1JCC A;  2WMM A;  1LTT C;  2K3R A;  3FWL A;  2PGD A;  3M06 A;  1GW4 A;  1A02 F;  1DIP A;  1BDD A;  4Y99 B;  3PHL A;  1SQX G;  2ZFC A;  2ZXX A;  1KQG B;  1LT9 A;  1N8R Q;  1S72 P;  2J3G A;  3C8V A;  1BGY E;  3PH0 A;  1H88 A;  1MZ9 A;  3AEB C;  5B5E E;  1SQX K;  2IBZ G;  2ZT9 B;  2H89 C;  1VQL P;  2N9B A;  1RF1 A;  2NPS A;  3L75 D;  1URQ A;  3H1L D;  1OW7 A;  2WTY A;  3U1A A;  1Q86 Q;  1W5C E;  1H0T B;  1LTI C;  3AE5 C;  1M7L A;  3L74 D;  5L8R J;  3L75 E;  2QG4 A;  3H1L E;  2L5G B;  2J60 A;  3CPW O;  1EQ7 A;  3NXS A;  4GOE A;  1BE3 J;  4PD4 I;  1EXI A;  5AW6 B;  2HPC C;  3L74 E;  4LC1 A;  5CCG D;  1L0N D;  1JNM A;  4EIJ A;  3WU2 H;  2YXR B;  2E74 D;  3WUU A;  1L0N E;  1LWU A;  5KKZ B;  3CME P;  2XZR A;  4AQR D;  3MUD A;  3A0B E;  5GTH E;  2BCC D;  2HYN A;  1RF0 A;  2G3A A;  1YIT P;  1YQ4 C;  3A3Y B;  2WPR A;  5APX A;  1FBM A;  2W90 A;  2PAJ A;  3HE5 B;  1KN7 A;  5KTB A;  2OTJ P;  4HH2 A;  4IL6 E;  3AEA C;  3E1I C;  1RH5 B;  2ZXE B;  3RL0 D;  4NPF X;  3H1J G;  2JHM F;  2B87 B;  3L75 J;  1Q7Y Q;  1E5W A;  2WSE H;  3H1L J;  2LXB A;  3H1K E;  1IFI A;  2NRG A;  3MHV A;  1GU4 A;  1VF5 B;  4L73 A;  2Q6Q A;  2N1T D;  3A5T A;  1N7S D;  2I1J A;  2WSC H;  1IC2 A;  2JP3 A;  1LNQ A;  1Z3S A;  2M3B A;  1R8E A;  1JTH B;  1AFO A;  2YMY A;  3H1I D;  1QVF O;  4PJ0 H;  1USE A;  2OYH B;  3C9I A;  1AJY A;  1NWQ A;  1GU5 A;  3HD7 D;  1P84 E;  4JZC A;  1HJ0 A;  2W6J H;  2IYO A;  1KOR A;  1M57 D;  2R44 A;  1DEB A;  1RE4 A;  2BCC J;  1OVV A;  4EOT A;  2WWW A;  2QJP C;  2HOD A;  3BVH A;  1LT9 C;  2QSI A;  4JYB A;  2P10 A;  4PD4 H;  1Z56 A;  2ZYA A;  1M8O B;  1LTB C;  2JR8 A;  2D2C C;  4PV1 D;  2KS1 A;  2OYI A;  5APQ A;  1CW5 A;  2QJK B;  2D39 A;  4Z1M H;  2E76 B;  2CPB A;  1PGP A;  1MUU A;  3L72 J;  5AVV B;  1PPJ G;  1RHZ B;  2QE7 H;  1VQ7 P;  2E75 C;  1FZG B;  3GMA A;  2HFE D;  3CCV P;  2M3E A;  2NPS D;  3IFM A;  2LKM A;  1URQ D;  3M0D A;  1WRG A;  1M1J A;  5B66 H;  2FFD C;  5BU5 A;  4DCK A;  4IFD K;  2YIU C;  4PD4 D;  1EZV G;  4IFF A;  4DZO A;  2DW3 A;  1S9K D;  4OGQ D;  3R4Y A;  1GL2 C;  1QEX A;  2HLO C;  1S9K E;  3H1I J;  3S1K A;  3GG2 A;  2AEF A;  2J3O A;  3AEE C;  2B89 A;  4U7J A;  2M5A A;  2WSE J;  2QRX A;  2ZYG A;  3TGU D;  1NTM E;  1FJP A;  3G6E P;  1JM0 A;  4H44 C;  2KIK A;  4GIF A;  2QJY B;  3RL0 B;  3B5N C;  3TGU E;  2W6A A;  2WSC J;  2FBW C;  3HUS B;  2RKL A;  3PP5 A;  5AVR B;  2WPV B;  4WY4 C;  1SQB G;  2UWJ E;  3JCU E;  2JKV A;  2Z4E C;  2Q5U A;  3ITK A;  3VMX A;  3P8C D;  5AW5 B;  1TU3 F;  1J2J B;  2FYU J;  1SQB K;  1N7S B;  1SQP D;  5CMZ A;  3HTK A;  1NU1 J;  1MKM A;  3P8C E;  4O9B A;  1NJI Q;  2W6B A;  4XA4 A;  3CXH I;  1SQP E;  4M7F A;  3KPE A;  4UB8 E;  2K9J B;  4EI2 A;  4DJG A;  1YIJ P;  4W80 A;  2AXT E;  3HD7 B;  3LID A;  2KNC A;  3C1L A;  1GD2 E;  1QX8 A;  3VMA A;  3KZI E;  2CPS A;  3AE3 C;  3PRJ A;  1JOC A;  3B4S A;  2HOD C;  4H13 D;  3V6I A;  2Q9I A;  1U7J A;  1KYO E;  3I55 P;  1BGY G;  2GA1 A;  4PV1 B;  1NTK D;  2ZT9 C;  3WUV A;  1FU1 A;  1SQV D;  2YXQ B;  3GHG B;  4D6T D;  2P1J A;  1MFT A;  3BCC E;  2FYZ A;  1NTK E;  2JHK F;  1ZRT E;  1PP9 D;  1X8Y A;  1KIL E;  3H1H D;  4RO0 A;  2M8R A;  1BDC A;  4XFJ A;  2OYO A;  3L71 G;  2ITA A;  4M3L A;  1GK6 A;  2QVA A;  1PP9 E;  3TDK A;  4BXL A;  4R9J A;  4I6M C;  2HPC A;  3PJS K;  3NMD A;  1NTZ D;  3TNU B;  1JO5 A;  1FDI A;  1M1J C;  3G71 P;  1OW8 A;  2FXP A;  1S5L E;  3L74 G;  5AVY B;  1SQP J;  2WNP F;  1R5L A;  4OGQ B;  3E1I B;  1HGV A;  3QH9 A;  4BRY A;  1CSB A;  5KKZ C;  2IZ0 A;  2FXM A;  1LTJ B;  2J61 A;  3H32 A;  1L0N G;  4GDO A;  5CBO A;  5AVS B;  3JSV C;  4KHX A;  5AW1 B;  1KTM A;  1GMJ A;  1LTS C;  5KAF H;  1L0N K;  1FZE B;  1FAV A;  2W27 A;  2XNX A;  3V2P A;  4N6J A;  1QL2 A;  2WT7 A;  1N86 A;  3TSI A;  3A7O A;  2O01 J;  1YHQ P;  5EFW B;  2BAS A;  3E1I A;  3RK3 E;  1SQV J;  1L4A B;  2A06 E;  1OMI A;  2Y0D A;  4D6T J;  1DD3 A;  5TJH A;  2JJL A;  3FX0 A;  2AEM A;  3OAK A;  1N73 B;  2H8P D;  1PP9 J;  4NPE A;  4RKU J;  1BE3 D;  1Q2N A;  3H1H J;  1VF5 C;  3VN0 A;  3MZW B;  3H1K G;  4C46 A;  2H88 C;  2J2P A;  4EDF A;  3M9H A;  1OVU A;  4WWI A;  1KFN A;  5DJT B;  1FOS E;  3AE7 C;  1BE3 E;  2IDB A;  1NTZ J;  1SLQ A;  3SFD C;  2K37 A;  2V4H A;  3CMA P;  3IN6 A;  2Q7C A;  3CL3 D;  4ZKP A;  3T97 A;  4TT3 H;  1FZF A;  1KZU B;  3TYY A;  3CXH D;  1PGQ A;  1SP4 A;  1VQ9 P;  2PP6 A;  4I2L C;  3CXH E;  2IBZ I;  4K3A A;  4W7Z A;  4NPD A;  1IFM A;  2Q9I C;  1XTG B;  3L73 J;  1CI6 B;  2YKQ A;  3O6Q B;  3RBX A;  5KLI C;  2KXP B;  1X0T A;  1KIL B;  4W7Y A;  1GW3 A;  5KAI H;  3KYQ A;  3AED C;  1NGM B;  4C7R A;  3CWB D;  3CCR P;  2E76 C;  3A0H E;  4XE5 B;  2POH A;  3CLQ A;  3W68 A;  2J3U A;  2E5Y A;  1U7M A;  1FZG C;  3RBZ A;  5GTI E;  4B86 A;  3CWB E;  1BCC J;  1OX3 A;  1OW6 A;  1MV8 A;  4L74 A;  5CCG C;  1SS1 A;  1YJW P;  1NH4 A;  2FFD A;  3AEG C;  1HGZ A;  1OXZ A;  4IL6 X;  3O8Z A;  3GF7 A;  1IFD A;  2M0B A;  2XND H;  1R5S A;  2OQQ A;  1GL2 A;  2IFM A;  1SFC A;  2HLO A;  4IOI H;  3V4W A;  5KJ7 C;  2JEE A;  1FZA B;  2BEQ D;  2QIW A;  3CX5 H;  1KV4 A;  3H32 C;  2IFN A;  1GZL A;  3GF3 A;  3MD0 A;  1IZN B;  2LR2 A;  2SPZ A;  4RJT A;  2P7J A;  4OVN F;  3RK3 B;  2BCC E;  5CCH D;  2XNX C;  1N86 C;  1ZR2 A;  1NTM G;  3RL0 C;  1VDF A;  2B88 A;  1VQ8 P;  3B5N A;  5AW8 B;  1K05 A;  1KC8 Q;  5APY A;  2OTL P;  1LGH B;  3L72 D;  3HUS C;  3E1R A;  1S3J A;  3TGU G;  1CZQ A;  2IX7 C;  3CWB J;  4WY4 A;  1NTM K;  1EC5 A;  1ZP0 C;  1NKZ B;  2Z4E A;  3L72 E;  1LP1 A;  4BWN A;  3V2N A;  1JUN A;  2R32 A;  3GLM A;  2Q3E A;  3WU2 E;  4JQ0 D;  2HG5 D;  1RE3 B;  5APW A;  2JO1 A;  1G2C B;  2V7Q H;  3D70 A;  5CJ4 A;  3Q1M A;  1PGO A;  1KQS O;  2H43 B;  2QM7 A;  5AW4 B;  3D71 A;  1N7L A;  4GT1 A;  1FZF C;  1SQP G;  3I5C A;  3HD7 C;  1OIP A;  1VQK P;  1ZLL A;  2WSF H;  5DJU B;  3H1I E;  3PLN A;  1SQX D;  4KJM A;  1SQP K;  2J3F D;  5AW9 B;  1CI6 A;  3R2P A;  2MJZ A;  5AVW B;  4EYY Q;  2YKO A;  1FZC B;  2J64 A;  1QLE D;  3WMM 0;  3QWO C;  2Y0C A;  3AE4 C;  1K8A Q;  1OFC X;  2IBZ D;  3HE4 B;  3S4R A;  3GHG C;  3VOP A;  1NHL A;  3RGU A;  1YQ3 C;  1S1C X;  2K1A A;  1OVR A;  1FE6 A;  3BCC G;  2R3C A;  1H0T A;  2ZYD A;  3L4F A;  4YTP C;  3IAO A;  1NTK G;  1FS0 E;  2FYN B;  1IFN A;  3F89 A;  4U3F D;  2FYU D;  2D2C D;  3L70 G;  5E79 H;  3AEF C;  3VMY A;  1NU1 D;  4RES B;  1FIB A;  1PP9 G;  1NTK K;  4PJ0 E;  4K35 A;  1L0L J;  4OH8 B;  1SQV K;  4U3F E;  2FYU E;  4DOJ A;  4ASV A;  4OGQ C;  1EDI A;  1FOS F;  1NU1 E;  2A45 G;  2J58 A;  1KD1 Q;  2E74 B;  1LTJ C;  1SFC C;  1EDJ A;  3KQG A;  4PD4 E;  2GY7 A;  1VQN P;  1JEK A;  1PGJ A;  4L76 A;  1J1D C;  1HBW A;  3BAT A;  3RK2 D;  2Y9Y A;  3LIE A;  1LTG C;  2YO2 A;  1NTZ K;  1ZW0 A;  1FZE C;  5AVX B;  1SQX J;  5AW3 B;  3HE5 A;  2VRS A;  4I1L A;  3L35 A;  1AVY A;  1RY3 A;  2W8Z A;  4UB6 H;  1FZB B;  1L4A C;  5H2F H;  3VYI A;  1ZME C;  5M1B A;  2B87 A;  1Z3U A;  2O1J A;  3H1J D;  2V7Q J;  2A06 G;  1N73 C;  4HYT B;  3RL0 g;  5B66 E;  1T2K D;  2YNY A;  2J0H A;  4WBA A;  1NVO A;  3B71 A;  1VQO P;  2N1T B;  4U3F J;  3V2Q A;  3B5N D;  1IK7 A;  2OTK E;  2WSF J;  2KB7 P;  2Y9Z A;  1BE3 G;  4H0L D;  1KB9 H;  1JTH A;  3G4S P;  2WVR A;  1DX7 A;  1PV3 A;  2OYH A;  1D7M A;  2FIB A;  3I56 P;  1Q90 D;  3CI9 A;  1ZR4 A;  4Y99 C;  4C7N B;  1JY2 P;  5AVQ B;  2WIT A;  4R4M A;  3CC2 P;  3IR9 A;  3FWN A;  4JF7 A;  3G9R A;  1S5L X;  2NZ2 A;  2BEZ F;  1YTZ I;  3P8M C;  1PFI A;  1KIL C;  1RQU A;  3L37 A;  1WT6 A;  1QL1 A;  5APU A;  2E5T A;  1VQM P;  3K5B A;  2QJP B;  3Q2Y A;  1LT9 B;  1GTW A;  3EWK A;  5TIS H;  3SFE C;  1SQV E;  4ASW A;  1X79 B;  3H1J J;  4D6T E;  1FZG A;  2ZVN B;  2ZT9 D;  3L75 G;  1JY3 N;  2KZJ A;  3CWB G;  1RF1 B;  2YMK A;  3P32 A;  2K9Y A;  2NPS B;  3H1H E;  4HB1 A;  5CCG A;  3H1L G;  1URQ B;  1NAF A;  2R5D A;  4DT0 A;  5APT A;  2J0G A;  1JC9 A;  1DH3 A;  3CCL P;  2KI7 B;  2C0W A;  1KFM A;  1NTZ E;  3Q5R A;  1Q81 Q;  1HWT C;  1FZA C;  1OWA A;  5KJ7 A;  1IFP A;  1ZXG A;  3Q3D A;  1JY2 O;  2O1K A;  1J1E B;  3RK2 B;  3ABV C;  2Q3I A;  3L73 D;  3JC2 2;  3CCM P;  3RK3 C;  2WQY C;  2KLV A;  1T8Z A;  1LWU B;  3CCS P;  3M9B A;  3D6Z A;  3H6P A;  2BCC G;  3L73 E;  1RF0 B;  2XKM A;  2MKV A;  1SQQ D;  1XTC C;  2J59 M;  2R3S A;  3HUS A;  3CX5 I;  1X9V A;  1YTZ T;  1BCC D;  1IK9 A;  3SWF A;  4GKG A;  1SQQ E;  4JBZ A;  2KP8 A;  1AV1 A;  2YKP A;  3L72 G;  1RE3 C;  1N7S A;  1BCC E;  3VTP C;  2KK7 A;  5B5E H;  3CCU P;  4M7H A;  1LT1 A;  4H0L B;  1H89 A;  2Z5H A;  2C9L Y;  2H43 C;  3NFQ A;  1VF5 D;  2K9J A;  1VQP P;  2OYH C;  4TLF A;  5KAF E;  2I8D A;  1P84 I;  1YJ9 P;  3HD7 A;  2J5Z A;  2J0Y A;  2N9Y B;  2O3J A;  3N7N A;  1JCD A;  2QM8 A;  2C9N Y;  1NKN A;  3UIA A;  4H13 B;  3H1I G;  1K9M Q;  1VQ5 P;  1KQL A;  3KDP B;  3TK1 A;  2KYV A;  1FZC C;  4YXW H;  1BGY D;  3CC7 P;  2AEJ A;  1YYC A;  3GHG A;  3U59 A;  2YO3 A;  4I7Z B;  2QJK C;  1RE4 B;  4IFM A;  2HOD B;  3BVH B;  1PL5 A;  1SQQ J;  3A0B H;  2FYN C;  5GTH H;  1FJK A;  3E7K A;  3L71 D;  1SQB J;  3BRV B;  2KS1 B;  2OYI B;  3HRN A;  1S2E A;  2AXC A;  3TNU A;  2PRR A;  3WUT A;  3V5B A;  1KMI Z;  2E76 D;  2W83 C;  2OAR A;  3L71 E;  1NYH A;  1W2E A;  3SWK A;  3MGN A;  4U3F G;  4ZKU A;  2FYU G;  5K5G B;  2E74 C;  1FC2 C;  1FDM A;  2LXC B;  4IL6 H;  1NU1 G;  1LTJ A;  3AEC C;  1JY2 N;  3EFG A;  3USS A;  2JDI H;  3CCE P;  1AVO A;  2FYU K;  3FXD A;  1M1J B;  2JHI F;  2OGU A;  2WSS H;  5KAI E;  3MTU E;  1NU1 K;  3B8E B;  5CCH C;  2GUV A;  1FZE A;  1IFJ A;  5APS A;  5KJ7 D;  1E79 H;  1VQ4 P;  1EDL A;  3G3Z A;  1FZB C;  4JPZ B;  3M0A A;  1LTA C;  2QJY C;  2WPS A;  1BGY J;  1ZV8 A;  1L4A A;  2K88 A;  2RMZ A;  4ZFG A;  1AQT A;  2JHH C;  2M5A B;  1N73 A;  1HH0 A;  1P84 H;  1K04 A;  2ZJS E;  5BVZ A;  5KLV D;  3CX5 D;  2N1T C;  2WZ7 A;  2KZI A;  3H1K D;  1L0L D;  1N7S C;  2KSJ A;  3L71 J;  1Y9B A;  3ZDM A;  4YPC A;  5KLV E;  3CX5 E;  2ZVO B;  2XDJ A;  2KSE A;  1AQ5 A;  1JY3 P;  3FGA D;  2E43 A;  1L0L E;  3L74 J;  2H7H A;  1W2B O;  1JMB A;  3HTK B;  2O01 N;  1L0N J;  1K73 Q;  1H8A A;  1P84 D;  3AE6 C;  4QMA A;  1KYO I;  3O6Q A;  3LW5 H;  4PV1 C;  1KIL A;  1SQX E;  2IPP A;  1KB9 I;  3Q5S A;  2KNC B;  3CCJ P;  1UIX A;  3U1C A;  1HJB A;  1YJN P;  4JYC A;  1PZQ A;  2Q9I B;  2IBZ E;  4N78 D;  2IYP A;  5KLI B;  1HVV A;  2FXO A;  1FID A;  2Z5I A;  1SQV G;  4WVZ A;  3SSU A;  4D6T G;  1RF1 C;  1GK4 A;  2NPS C;  1URQ C;  5KLV J;  1QVG O;  4N78 E;  1EZV I;  2A45 I;  3II6 A;  2CK3 H;  3H1K J;  2GM4 A;  2HR3 A;  3H1H G;  2FY8 A;  1JY3 O;  2L91 A;  4EPU A;  2RN0 A;  1M56 D;  2RH0 A;  3AE9 C;  2GUS A;  3W67 A;  3H25 A;  2E75 D;  1IJD B;  1FZA A;  4R9T A;  1NTZ G;  2HPC B;  1UII A;  1J1E C;  3JCU H;  3FIB A;  3RK2 C;  4Y28 J;  1T3U A;  3N4X A;  3Q5P A;  2J5U A;  1SVF A;  3AE8 C;  3BRT B;  4BRY B;  1LWU C;  3AE2 C;  1GL2 D;  4AYC A;  1SFC D;  3IF4 A;  2J61 B;  3MUD C;  3NTN A;  3H32 B;  3BAS A;  1X22 A;  4GOD A;  1NAY A;  1RF0 C;  1NTM D;  3L73 G;  2IZ1 A;  4OWF A;  5E79 E;  4UB8 H;  3M91 A;  1HF9 A;  1G1I A;  1T2K C;  1NO4 A;  1VPC A;  2AXT H;  1Y8A A;  3CC4 P;  2XNX B;  3OJA B;  5CJ0 A;  5AW7 B;  2WT7 B;  1N86 B;  1GDT A;  3VMZ A;  3KZI H;  3H1J E;  1SQQ G;  2WPQ A;  1RE3 A;  4H44 D;  1L4A D; 
#chains in the Genus database with same CATH homology
 4B86 A;  1NWQ A;  1GU5 A;  3HD7 D;  4JZC A;  4LLH A;  3RK3 C;  1G2C A;  2KLV A;  1MV8 A;  1T8Z A;  1LWU B;  2JHL F;  3M9B A;  5CCG C;  3H6P A;  5AVT B;  4WB4 A;  4AUW A;  1SQQ K;  4WY4 D;  1DEB A;  1RE4 A;  4EOT A;  2WWW A;  2HOD A;  3BVH A;  1LT9 C;  1NH4 A;  2C0X A;  2H43 A;  2E42 A;  4JYB A;  2FFD A;  1HGZ A;  1RF0 B;  1OXZ A;  1FZD A;  2O01 H;  1Z56 A;  2XKM A;  3O8Z A;  1G1J A;  1IFD A;  1LTB C;  2FKW B;  1XTC C;  2J59 M;  3HUS A;  1IO4 A;  1X9V A;  1ZN5 A;  1GL2 A;  2IFM A;  1SFC A;  2OYI A;  3MIW A;  5APQ A;  2HLO A;  3V4W A;  5KJ7 C;  1YTZ T;  2JEE A;  1FZA B;  1CW5 A;  1IK9 A;  3SWF A;  1A02 J;  4GKG A;  2KP8 A;  2D39 A;  2IFN A;  3H32 C;  2CPB A;  2YKP A;  1MUU A;  1GZL A;  5AVV B;  3MD0 A;  1RE3 C;  1FZC A;  1N7S A;  1FZF B;  2A45 H;  4LGD E;  1FZG B;  3VTP C;  3HE4 A;  2HFE D;  2P7J A;  3RK3 B;  2XU6 A;  5CCH D;  2XNX C;  2R5B A;  4M7H A;  2NPS D;  1RE4 C;  3IFM A;  2LKM A;  1N86 C;  1URQ D;  3M0D A;  1H89 A;  3BVH C;  1WRG A;  1M1J A;  2XV5 A;  2Z5H A;  2C9L Y;  2H43 C;  1ZR2 A;  3NFQ A;  2FFD C;  5BU5 A;  4IFD K;  2OYH C;  3RL0 C;  1VDF A;  3L36 A;  4IFF A;  3VP9 A;  4DZO A;  3B5N A;  5APY A;  5AW8 B;  1S9K D;  3HD7 A;  1LGH B;  3HUS C;  2P2U A;  1NOH A;  1GL2 C;  1KIL D;  2J5Z A;  2J0Y A;  3N7N A;  5AW2 B;  2OYI C;  2HLO C;  5AVU B;  1CZQ A;  1JCD A;  2IX7 C;  4N3Y B;  4WY4 A;  1NTM K;  2QM8 A;  1NKZ B;  3V2R A;  2Z4E A;  2C9N Y;  1NKN A;  3UIA A;  1S9K E;  3V2N A;  1JUN A;  1KQL A;  2R32 A;  3KDP B;  3TK1 A;  2KYV A;  1JMM A;  1FZC C;  2J3O A;  2HG5 D;  5APV A;  1RE3 B;  5APW A;  2J1G A;  1G2C B;  1YYC A;  3GHG A;  3U59 A;  1HTL C;  2YO3 A;  5CJ4 A;  3V4Q A;  3M0D C;  1RE4 B;  4IFM A;  2HOD B;  3BVH B;  2H43 B;  1FJP A;  2QM7 A;  5AW4 B;  2FFD B;  4GIF A;  5AW0 B;  1N7L A;  4GT1 A;  3RL0 B;  1FZF C;  3B5N C;  3I5C A;  3HD7 C;  1FJK A;  2W6A A;  3HUS B;  5CCH A;  5AVZ B;  1GL2 B;  3BRV B;  3PP5 A;  5AVR B;  1SFC B;  1ZLL A;  4WY4 C;  2OYI B;  2HLO B;  3HRN A;  1T3J A;  2WSF H;  2Z4E C;  3TNU A;  1SQP K;  2J3F D;  2I1K A;  2Q5U A;  3V5B A;  1FZB A;  1CI6 A;  5AW9 B;  3VMX A;  3P8C D;  1J1D B;  2OAR A;  3R2P A;  5AW5 B;  3A2A A;  1W2E A;  1J2J B;  2MJZ A;  5AVW B;  4JYO X;  3MGN A;  2YKO A;  4ZKU A;  1FZC B;  2J64 A;  1SQB K;  3WMM 0;  1N7S B;  5CMZ A;  1FDM A;  3HTK A;  3HE4 B;  3GHG C;  3VOP A;  1NHL A;  1LTJ A;  1JY2 N;  1MFZ A;  3P8C E;  3EFG A;  4O9B A;  3RK3 D;  4NYT A;  2W6B A;  4XA4 A;  3P7K A;  2FYU K;  3SWY A;  1M1J B;  4M7F A;  2R3C A;  3KPE A;  2N1T A;  2JHI F;  3L4F A;  5CHX A;  3MTU E;  1NU1 K;  4W80 A;  3OA7 A;  3B8E B;  3B5N B;  1IFN A;  3HD7 B;  5CCH C;  2GUV A;  1FZE A;  3LID A;  1IFJ A;  1GD2 E;  5APS A;  3VMY A;  2P67 A;  2CPS A;  4WY4 B;  1FIC A;  5KJ7 D;  4RES B;  1FIB A;  1NTK K;  1JOC A;  2Z4E B;  3G3Z A;  2HOD C;  3M9Q A;  4OH8 B;  1FZB C;  1SQV K;  2Q9I A;  3M0A A;  4DOJ A;  1LTA C;  5BU8 B;  2WPS A;  1ZV8 A;  1L4A A;  3EQ2 A;  1FOS F;  2A45 G;  2KOG A;  2J58 A;  4ZFG A;  1FU1 A;  5KLV K;  1HUC A;  4C7N A;  1LTJ C;  1SFC C;  2JHH C;  1N73 A;  1L0L K;  3GHG B;  3VP8 A;  2P1J A;  1HH0 A;  2J3F A;  3KQG A;  5BVZ A;  2FYZ A;  2GY7 A;  1N2D C;  2JHK F;  2N1T C;  1J1D C;  1X8Y A;  1HBW A;  2WZ7 A;  1JCC A;  3BAT A;  3RK2 D;  1N7S C;  2M8R A;  3LIE A;  2KSJ A;  1LTG C;  1LTT C;  2YO2 A;  1NTZ K;  3M06 A;  1FZE C;  1GW4 A;  4M3L A;  1A02 F;  1GK6 A;  4Y99 B;  5AVX B;  4R9J A;  2XDJ A;  1AQ5 A;  1JY3 P;  5AW3 B;  2E43 A;  2ZFC A;  3HE5 A;  4I6M C;  2VRS A;  4I1L A;  2HPC A;  3L35 A;  3NMD A;  3TNU B;  1JO5 A;  1LT9 A;  1M1J C;  1RY3 A;  2J3G A;  2H7H A;  1FZB B;  5AVY B;  1H88 A;  1L4A C;  2WNP F;  1MZ9 A;  3VYI A;  3E1I B;  1SQX K;  1HGV A;  1Z3U A;  2O1J A;  1CSB A;  3HTK B;  2N9B A;  1N73 C;  1RF1 A;  2FXM A;  4HYT B;  1LTJ B;  2NPS A;  2J61 A;  1T2K D;  1URQ A;  2YNY A;  2J0H A;  1H8A A;  3H32 A;  4WBA A;  2WTY A;  3U1A A;  2N1T B;  5AVS B;  1LTI C;  1M7L A;  4KHX A;  3LW5 H;  5AW1 B;  3V2Q A;  1KIL A;  3B5N D;  1LTS C;  2IPP A;  2L5G B;  2J60 A;  1L0N K;  1FZE B;  1EQ7 A;  3NXS A;  2KB7 P;  1FAV A;  2W27 A;  2XNX A;  3U1C A;  3V2P A;  4N6J A;  5AW6 B;  1QL2 A;  2WT7 A;  2HPC C;  1N86 A;  4LC1 A;  1HJB A;  5CCG D;  1JTH A;  3TSI A;  3A7O A;  4JYC A;  2Q9I B;  1DX7 A;  1JNM A;  2OYH A;  2FIB A;  2BAS A;  4N78 D;  3E1I A;  1L4A B;  4EIJ A;  1HVV A;  1FID A;  2Z5I A;  3CI9 A;  1ZR4 A;  4Y99 C;  2JJL A;  1RF1 C;  1LWU A;  1GK4 A;  1JY2 P;  2NPS C;  3OAK A;  5AVQ B;  4C7N B;  1N73 B;  1URQ C;  2H8P D;  2WIT A;  2XZR A;  3IR9 A;  4N78 E;  4AQR D;  3MUD A;  2A45 I;  3II6 A;  4JF7 A;  3VN0 A;  2GM4 A;  4C46 A;  2HYN A;  1RF0 A;  1JY3 O;  2J2P A;  4EPU A;  3M9H A;  3P8M C;  1YTZ I;  1KFN A;  1PFI A;  1KIL C;  2GUS A;  1FOS E;  3L37 A;  3A3Y B;  2WPR A;  1IJD B;  1WT6 A;  5APX A;  1QL1 A;  1FZA A;  5APU A;  1SLQ A;  1FBM A;  4R9T A;  2PAJ A;  3HE5 B;  2HPC B;  2Q7C A;  3CL3 D;  4ZKP A;  1J1E C;  3T97 A;  1LT9 B;  1GTW A;  3FIB A;  3RK2 C;  5KTB A;  4HH2 A;  1X79 B;  1FZF A;  1T3U A;  1KZU B;  3N4X A;  3E1I C;  2ZXE B;  3TYY A;  3RL0 D;  1FZG A;  1SVF A;  2JHM F;  3BRT B;  1SP4 A;  1LWU C;  1E5W A;  1GL2 D;  1JY3 N;  4AYC A;  2WSE H;  1RF1 B;  1SFC D;  3P32 A;  2NPS B;  5CCG A;  2J61 B;  1IFI A;  1URQ B;  2PP6 A;  4I2L C;  3NTN A;  3H32 B;  3BAS A;  1NAF A;  1GU4 A;  1RF0 C;  2R5D A;  4W7Z A;  5APT A;  1IFM A;  2Q9I C;  1XTG B;  1CI6 B;  2YKQ A;  2N1T D;  2J0G A;  1JC9 A;  3A5T A;  1KIL B;  1N7S D;  4W7Y A;  2I1J A;  1GW3 A;  3M91 A;  1DH3 A;  1G1I A;  2C0W A;  2WSC H;  1KFM A;  1IC2 A;  3KYQ A;  1T2K C;  1NO4 A;  1VPC A;  1HWT C;  1FZA C;  1Z3S A;  1OWA A;  5KJ7 A;  2XNX B;  3OJA B;  2M3B A;  5CJ0 A;  5AW7 B;  4C7R A;  2WT7 B;  1N86 B;  1GDT A;  3VMZ A;  4XE5 B;  1JY2 O;  2POH A;  1JTH B;  2O1K A;  3CLQ A;  1J1E B;  1AFO A;  2J3U A;  2YMY A;  3RK2 B;  2OYH B;  2Q3I A;  3C9I A;  2WPQ A;  1RE3 A;  1FZG C;  1L4A D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...