1LWUC

Crystal structure of fragment d from lamprey fibrinogen complexed with the peptide gly-his-arg-pro-amide
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
317
structure length
317
Chain Sequence
KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRPCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of fragment D from lamprey fibrinogen complexed with the peptide Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha-1 chain
total genus 84
structure length 317
sequence length 317
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2002-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lwuC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1lwuC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1lwuC02
1LT9B 1FZAB 2HODA 2J3UA 2OYIA 1RF0B 1FZCC 1LWUB 2HLOC 2HPCC 2XNXA 1N73A 2HLOA 2A45I 1FZEB 3FIBA 2HPCB 2A45G 3E1IA 1RE4C 1RE3C 2J0YA 2Z4EA 2JHKF 2OYHA 1RE4B 2Q9IB 4ZFGA 1W2EA 2J61B 1N86B 2GY7A 1FZFB 2OYIB 1RF0A 1LTJB 2H43C 1LT9C 1Z3SA 1LWUC 2HLOB 1JY3P 1RF1C 3E1IB 4EPUA 2J1GA 4M7HA 3HUSB 1Z3UA 1RE4A 3H32C 2H43A 4JZCA 1N86A 1FZEC 2JHLF 2HODC 4R9JA 1FZFA 4M7FA 1FZGC 1N73C 3H32A 2XNXC 1FZBC 1LTJA 1JY2P 1FZGB 1T3UA 4JYOX 1N86C 1FIBA 2FFDC 2D39A 2Z4EC 2FFDB 3GHGC 1RF1B 3HUSA 1FZAC 2JHMF 2JHHC 1JC9A 2H43B 2J3FA 1RF0C 3HUSC 3H32B 2A45H 1FZGA 2J60A 3BVHA 2WNPF 2J64A 1M1JB 2FFDA 1RF1A 2OYIC 1RE3A 1FZBA 1FICA 2J0GA 1LTJC 1FIDA 3BVHC 1JY2O 2J3GA 2JHIF 1JY3N 2J0HA 3BVHB 1FZCA 3GHGA 2J2PA 1LT9A 1FZAA 2HODB 1M1JA 2J5ZA 1LWUA 1FZDA 2Q9IC 2FIBA 1N73B 2XNXB 1RE3B 2J3FD 1FZBB 1FZEA 1JY2N 2HPCA 2OYHC 1JY3O 4NYTA 1FZFC 2Z4EB 2OYHB 1M1JC 2Q9IA 2J61A 2J3OA 4R9TA 3E1IC 1FZCB 3GHGB
chains in the Genus database with same CATH superfamily
1RF0B 2HLOA 3SWKA 3FIBA 3G3ZA 3GG2A 3IF4A 3KYQA 2NRGA 2B89A 1ZR4A 3TF5A 3PLNA 2IBZI 3E1RA 1GU5A 3RGUA 1EZVD 2YIUB 3HE4B 1ZR2A 2D2CD 2XKMA 4XFJA 1OZHA 2QSIA 3M9QA 1Y47A 1NHLA 2RKLA 5KJ7D 5H2FE 2CPBA 3H1LG 4AYCA 2HODC 2QE7H 3KXDA 1L0LG 2WPRA 4PV1B 3U59A 2WQYC 1P84I 3B5NA 5CHXA 1JC9A 2Y9ZA 2NPSA 1H88A 1KB9I 1SQVK 3HRNA 2WSFJ 2LR2A 2QJPB 1S4XA 2KZJA 1VF5B 5M1BA 2YKOA 1GTWA 2WSSH 4RJTA 3L75D 2RMZA 3WUUA 2QJKB 1CI6A 4PD4D 1FIDA 1PPJG 2J0HA 1PP9D 2KI7B 2B88A 2Y9YA 1URQD 5APTA 5AVQB 1L2PA 5AW1B 5KLIC 1JCCA 3GHGB 3T97B 5AVTB 2AEMA 1W5CE 2D2CB 1VQ6P 3CI9A 1X22A 2ZT9C 2NPSC 2ZYDA 1KC8Q 5AW5B 1FS0E 3B5NC 1FDIA 2PGDA 1G2CB 2W6AA 4AUWA 5L8RJ 1G1JA 2V4HA 1NTKJ 1OFCX 5KLVE 4YXWH 1VQKP 2O1KA 2FKWB 2FYNB 2GUVA 1PGOA 1OXZA 1SQBK 1ZOYC 4ASWA 2E76C 1OW7A 4BWNA 2W83C 4IOIH 4Y99B 2W8ZA 4XA4A 4M7FA 1FZBC 4OH8B 1N86C 4TLFA 2BEZF 1YJNP 1LTBC 5KLIB 1YJWP 3BCCG 5CJ0A 1OX3A 1SQBJ 2IFNA 3JSVC 3VP8A 1Y8AA 2N9YB 4U3FD 3L70E 4Y28J 1KD1Q 3CWBJ 4R4MA 2FXPA 2E5TA 2JHIF 3BVHB 2HODB 2J5ZA 1KFMA 2IBZD 1VQ8P 2XNXB 2WZ7A 2YMKA 3GMAA 3TDKA 3CCVP 1IC2A 1VQ7P 5E79E 2KNCB 1R5SA 2XNDH 1T2KD 1A02J 5AVWB 1IFDA 3L72E 3AE1C 1BE3J 3L71E 2M5AA 2JHKF 3CXHE 1IZNB 3UIAA 3L71G 2I1KA 4H44D 3A5TA 4N78E 1GZLA 3E1IB 1M90Q 3A0HE 4GOEA 2Q3EA 5KAIH 1SQPD 3TNUA 1N86A 1KZUB 3EFGA 1YJ9P 1NTZD 2IPPA 1J1EB 2WMMA 1FZGC 1N73C 2R5DA 3H1HJ 3GHGC 3TGUG 1NTKK 2JHHC 1BDCA 1KB9H 2Q1KA 2HR3A 4XE5B 1VPCA 2R5BA 1PPJD 1XTCC 3CCEP 2FYUE 3CX5E 1SQXD 2J64A 3LIEA 4WY4A 2KSEA 5CMZA 3AE6C 1BE3G 1RY3A 1ZP0C 4IL6X 1DD3A 3AE8C 1JTHB 1KFNA 1IFMA 2ZT9D 1LJ2A 2YXQB 4RKUJ 3KZIE 3NMDA 5AVRB 2KLVA 3D71A 2P1JA 3KPEA 2OARA 2BCCD 1LTTC 1NU1E 5AW3B 3ABVC 4R4LA 2E43A 2Q9IB 1W2EA 3SWFA 2YXRB 3GW6A 2OGUA 1VQLP 2OYIB 3CPWO 1KQLA 4WVZA 4WY4C 5E79H 3D6YA 2ZVNB 2H43A 3AEGC 1HWTC 1L4AB 1DH3A 1IK9A 1P84H 2MKVA 1DEEG 3B71A 4ASVA 3M0DA 2FFDC 1PGJA 2RN0A 2M3EA 1RF1B 1SFCD 3CCQP 2B9BA 1FAVA 1SQBE 1AQ5A 4LGDE 1FDMA 3H32B 3CMEP 2J60A 3RK2C 2WVRA 1MFTA 1S72P 5CCHA 4GODA 2WSCH 5AW2B 5CJ4A 1ZLLA 4HKZH 3IR9A 5B5EE 4TT3H 3H1JE 3H1LE 2H88C 2NPSD 2ZXXA 2H7HA 2WWWA 1BGYD 1NTMK 4GOFA 3RBXA 4IL6E 3HTKA 3L71D 1FZCC 2E76B 3L71J 1BCCE 1K04A 2FBWC 1KYOH 2E74B 5AVYB 1MZ9A 3RK3C 3H1JD 1N7LA 3MUDA 1VQNP 4OWFA 1Q90D 1M56D 1NAFA 2J1GA 2ZXEB 1PGPA 3PRJA 1DEBA 1EZVI 1EQ7A 1FZFA 3PTZA 5TISE 1LTJA 1NAYA 1J1EC 1FZGB 4ZKUA 4D6TD 5CCHC 1JCDA 3MUDC 1KILC 3AE7C 1Q7YQ 1URQC 3HUSA 1JNMA 3CX5H 1LP1A 2A06D 4JYBA 3L75E 5KAFE 1JEKA 4YXDC 1OW6A 2E42A 3R4YA 3M06A 3RL0C 2FFDA 1FJPA 4U3FJ 3W68A 2CK3H 3N4XA 2Y0DA 1ZXGA 3NXSA 3HD7C 3MZWB 2K9JA 1H0TB 1S3JA 2IZ1A 1NKNA 1M1JA 3OAKA 1ZMEC 1FJKA 4OGQB 4PD4H 2J61A 3L74E 4N6JA 3P7KA 2AXTE 2QJYC 3N7NA 1NU1J 2O01H 1SQQK 2QEXP 4HJGH 3USSA 4JQ0D 2WT7A 3L73E 1VQOP 3O6QB 2OTLP 2K37A 3M0DC 3LW5H 4M7HA 3V4QA 1VQ9P 3L72D 4NPFX 3VTPC 1PL5A 2E5YA 1OMIA 1NVOA 4H44C 4ZMDA 1KYOE 3H1HE 1FIBA 2D39A 1RH5B 1SP4A 1FOSF 3QWOC 2QA4P 4C7NA 3RK2B 4EI2A 1PIXA 3JCUH 1Q2NA 1OW8A 5B5EH 2AEJA 3EWKA 1LGHB 4YPCA 2J3GA 3MIWA 3AE5C 2OQQA 3H1LJ 5CCHD 1VF5C 3FX0A 3A0BH 2HG5D 3L70D 2KSJA 2J3OA 1U57A 3G71P 3H1KG 4DJGA 1SQXK 1LWUB 2HPCC 1A02F 1KMIZ 3PHLA 1MUUA 4H44B 2HPCB 5KTBA 1RE4B 1HJBA 4W7ZA 3PH0A 4Y99C 3M9BA 1OIPA 2KS1B 1NTKG 2YMYA 4OGQC 1RF0A 5B66H 5GTIH 2HLOB 3G9RA 1NGMB 1S9KE 1SFCC 1BCCG 4JZCA 2ZAEB 3H1KD 5DJUB 5APQA 3CCUP 3HE4A 3QH9A 1GDTA 1T3UA 2UWJE 4JYOX 2KIKA 2ITAA 5AW9B 3AEDC 5AW8B 2JHMF 2H89C 1RQUA 1Q82Q 2WPVB 1JMMA 2J3FA 3BRTB 4PJ0E 1W2BO 1KB9E 2WSFH 5KJ7A 3A7OA 3B5NB 3G6EP 1NTZG 2K3RA 1KB9D 1RE3A 1FZBA 1YHQP 4PV1C 4GDOA 2O1JA 2M0BA 2O3JA 5BU5A 3OW2O 2JJLA 2B87B 2IYOA 2ZYAA 1JY3N 1FZCA 1FZAA 2Q9IC 1FZDA 3L73J 1N73B 1FZEA 4WWIA 1H8AA 4L76A 3V2RA 2Z4EB 2P58A 3L36A 1KQGB 2O01N 1BGYJ 1CI6B 1K8AQ 4R9TA 2FXOA 2YO3A 2IBZE 4RESB 1YBKA 3B8EB 2O01J 1HGZA 1OVRA 2IX7C 1S2EA 2HYNA 1L0NG 2W6BA 3CC7P 2KZIA 1HGVA 2XV5A 2JKVA 2PFXA 1AV1A 1HJ0A 2K1AA 2KK7A 3A0HH 3EFFK 3I5CA 1SQPK 3LW5J 3V2PA 2H43C 2HFED 1EC5A 1SFCB 1BCCD 5DJTB 1SQVD 3W67A 2ZFCA 1FBMA 1JUNA 1EDIA 2IZ0A 1R8EA 2C9LY 1J1DB 2XNXC 1G2CA 1JY2P 3TK1A 1QLED 1LTAC 1EXIA 5GTHE 3CX5D 4CPGA 1NU1K 3VMXA 4IL6H 4RO0A 5TISH 1T6AA 3L75J 1YQ4C 3KZIH 1IFNA 1JB0J 4I7ZC 3SSUA 1WRGA 3L74D 1USEA 4ZNCA 2E74D 4U3FE 3L4FA 1IK7A 4D6TE 3VMAA 4W80A 2KLUA 1ZV8A 1VF5D 5KAFH 1NTMG 2CPSA 4EYYQ 2DW3A 1LTGC 3AE9C 5GTHH 2C9NY 1EDKA 3B4SA 2JO1A 4C46A 1SQBD 1FOSE 4K35A 1LT9A 4O9BA 1N8RQ 1HUCA 5KLVG 2ZT9B 3P8CD 4NYTA 3RK3B 2OYHB 1BSNA 2N9BA 4EOTA 4H13C 1PP9G 3HD7D 3F89A 3E1IC 3VP9A 4A7PA 2HODA 2HLOC 2Y0CA 1GD2E 1NTKD 1KILD 2XNXA 1IFPA 1DX7A 3CWBG 2J59M 3VYIA 2JEEA 1M8OB 5EFWB 2NZ2A 2GY7A 1T2KC 1MV8A 2JWDA 2QJKC 4NPDA 1LWUC 1ZN5A 1YQ3C 2IYPA 3CWBE 1WMKA 5AVXB 3FXEA 1MKMA 2R32A 3D6ZA 5AVVB 1L4AD 2WPQA 1PP9E 2YKPA 3HE5B 3S4RA 3M0AA 1YYCA 3TNUB 1URQA 1SQPJ 4BRYB 2K9YA 3H1IG 2A45H 3MGNA 1BGYE 4N78D 4I2LC 3WUVA 3H1HD 1L0LK 1SQQE 1EDJA 3A3YB 3II6A 4I6MC 3BRVB 4DCKA 2YIUC 4U3FG 3U1AA 5APSA 2Z5HA 5KAIE 3HD7B 2WSCJ 4H0LC 1KILA 2C0XA 1M1KQ 1SQXJ 3V2NA 2FIBA 2FYUG 2WITA 2Z5IA 3KQGA 1Q81Q 2MJZA 1FZFC 3B5ND 5B66E 3P8CE 1L0LJ 1S5LH 1L0LD 3M9HA 1T8ZA 3KDPB 2G8YA 1QEXA 1JTHA 1GL2B 2A45G 4H0LB 3Q5RA 3M91A 3AEEC 3TYYA 1VQ4P 3SFEC 2FYUD 2FYUJ 2L91A 3WU2H 2QM7A 1AA0A 1Z3SA 1PZQA 2A06E 2YNYA 2E75C 4JF7A 2N1TB 2OTKE 2JHLF 2QJPC 3AEAC 2E74C 2LXCB 1KQFB 1KYOI 1L0NJ 4MN4C 2BCCG 1WT6A 1N7SA 2H43B 1NTMD 1L4AA 1U7MA 3MHVA 2PP6A 2C0WA 3V4WA 3H1IE 1RF1A 1FICA 1LTIC 1SQXG 1KQSO 1KILE 3JCUE 4LLHA 2BCCJ 3CC4P 1CZQA 2YO2A 3BCCD 5TJHA 4L73A 1ZRTE 1JY3O 3RL0B 3BCCE 4HH2A 3MP7B 3I55P 3CXHI 3C9IA 1XTGB 3K5BA 3RK2D 2D2CC 1PP9J 2J0YA 1OWAA 4KHXA 3GLMA 2L5GB 2IBZG 2QVAA 3CLQA 3VMZA 1E79H 3HTKB 4H0LD 3V2QA 2KYVA 1SVFA 3O8ZA 4L75A 5AW4B 4PD4I 1P84D 2NPSB 1SQVJ 1NTZK 1D7MA 4M3LA 3H1JG 1HVVA 3H1JJ 4UB6E 2WSEJ 2N1TD 2PAJA 3S1KA 1NTZE 1FZAC 3H1HG 4DOJA 1YTZI 1K73Q 4U7JA 1X79B 3FXDA 2I8DA 1FE6A 3RK3E 3Q5SA 1FZGA 1L0LE 2WNPF 3Q3DA 1SQQD 1K9MQ 1SQQJ 1AQTA 2KOGA 3D70A 3P32A 3ZDMA 2J0GA 1LTJC 2IDBA 3CC2P 4LC1A 1JY2O 3RK3D 2R3CA 2KXPB 5H2FH 1M57D 1AJYA 3GHGA 3T97A 3I56P 1NJIQ 2ZYGA 4WB4A 3CCSP 2ZVOB 1ZRTD 3L74G 1DD4A 1GK4A 1H0TA 4DZOA 2N1TC 1NWQA 3GF7A 2R44A 3TSIA 2J61B 1L0NE 2Q7CA 3L73G 1JOCA 4H13B 3C8VA 1QVGO 3WMM0 4JBZA 4HB1A 5APYA 2WT7B 1EZVE 1KV4A 3O6QA 5AVUB 2K88A 3CCJP 3JC22 1X9VA 1SQPE 1BE3E 2BCCE 3CWBD 1JM0A 1Z56A 1BGYG 3CX5I 3BVHA 4N3YB 1VQPP 2I1JA 3CXHH 1N2DC 3L37A 1VQMP 2AXTH 1NOHA 2AXCA 2KNCA 5BVZA 4WY4D 2J2PA 2V7QH 2BASA 2RH0A 2JWAA 1YIJP 2H8PD 1CSBA 1NYHA 4K3AA 2M5AB 1GMJA 1IO4A 2FXMA 1KYOD 3CCMP 1UIIA 3FWNA 1S5LE 3CCLP 2PRRA 1AVOA 3E1IA 1RE4C 4PJ0H 2E76D 1FC2C 3H25A 1NTZJ 1HH0A 1N86B 3AE4C 4QMAA 1FU1A 1LT9C 2A06G 1RF1C 2IFMA 1SQVE 3VN0A 2XU6A 2JR8A 1Z3UA 1RE4A 1JO5A 1SLQA 2FYZA 4H13D 4DT0A 1GK6A 4OGQD 5AVSB 3PP5A 3PJSK 2P2UA 2QRXA 2WSEH 2P10A 4WY4B 2ZJSE 4UB6H 3H1KJ 2FYUK 1JMBA 1S1CX 3H1IJ 3FGAD 1AFOA 3H1LD 4IFMA 3CMAP 3AEBC 1N7SC 3IAOA 3BVHC 1SQQG 3VOPA 5APVA 3CCRP 1NKZB 3GF3A 1SQVG 4AQRD 1RE3B 2BEQD 1FZBB 3BCCJ 2W6JH 3AE3C 4C7RA 2XZRA 2Q9IA 2B87A 4JPZB 4HYTB 1LT1A 1UIXA 1FZCB 3NFQA 1FZAB 2OYIA 2GM4A 1N73A 2J58A 1LTSC 1FZEB 2YKQA 1RE3C 4I7ZB 3AE2C 5AW0B 2OYOA 2Z4EA 3H6PA 3IN6A 3IFMA 5KJ7C 4ZFGA 4UB8H 1DIPA 1IFIA 1FDOA 1PV3A 3KHUA 1H89A 2R3SA 3RL0D 3RBZA 1R5LA 1S5LX 3R2PA 1JY3P 3MD0A 4W7YA 3NTNA 4YTPC 5CBOA 1T3JA 2POHA 4D6TG 1VQ5P 3H32A 3TGUE 2Z4EC 1PPJE 1SFCA 3LIDA 3WU2E 1BCCJ 4KJMA 2JP3A 1S9KD 3U1CA 1RF0C 2FYNC 4KT0J 5KKZB 1KORA 1SQBG 3CL3D 2M8RA 1MFZA 2WTYA 1Q86Q 1OVVA 3Q1MA 3L73D 3FWLA 1QL2A 1BDDA 3EQ2A 5AW7B 3L75G 1KTMA 3V5BA 1GU4A 1EZVG 4GT1A 1YI2P 1HBWA 1NTME 1QX8A 2GUSA 1QGKB 4BXLA 2J3FD 2AEFA 4Z1MH 1QL1A 4I1LA 1RHZB 5K5GB 2FY8A 1LT9B 2J3UA 1GL2C 3Q5PA 2WPSA 5C39A 2QIWA 1USDA 3Q2YA 2OYHA 2KUBA 5CCGC 4L74A 2J5UA 1FZFB 1AVYA 3H1KE 1LTJB 4D6TJ 4WBAA 3L70G 2E75B 4EDFA 1NU1D 5APXA 1X0TA 2P7JA 1VDFA 2OTJP 3HUSB 1LP1B 1GW4A 4R9JA 3L74J 2KB7P 3WUTA 4ZKPA 2M3BA 1HTLC 3RL0g 2E75D 2FFDB 2QJYB 2LKMA 2W27A 2XDJA 4B86A 2K9JB 3HE5A 1M1JB 1IFJA 2P67A 1J2JB 1YITP 1URQB 4BRYA 3G4SP 5GTIE 1QVFO 2Q3IA 1Y9BA 2KP8A 3A0BE 1YTZT 5KKZC 4PD4E 1L4AC 3BASA 5CCGA 1JY2N 2OYHC 1SQPG 1M1JC 1LNQA 3OJAB 3OA7A 3AECC 3HD7A 1KILB 3AEFC 3ITKA 1BSHA 1EXJA 1BE3D 2A45I 1TU3F 1E5WA 3BATA 1OVUA 3CD6P 3L72J 3TGUJ 2Q6QA 2QG4A 3TGUD 3L72G 2QM8A 3F5HA 3P8MC 2GA1A 3SWYA 1NU1G 1ZW0A 3A2AA 4IFFA 1NO4A 3E7KA 4UB8E 4JYCA 4NPEA 4GKGA 1GL2A 2W90A 4EPUA 1U7JA 4PV1D 5KLVD 1P84E 1NTKE 5BU8B 5KLVJ 3H32C 1KN7A 1EDLA 1FZEC 1L0NK 5APWA 1SQXE 1J1DC 3C1LA 4GIFA 4C7NB 4OVNF 5APUA 1VL2A 3CXHD 5AW6B 2N1TA 3SFDC 1IJDB 1PFIA 4IFDK 5CCGD 5KLVK 3S9OA 2LXBA 1NH4A 3HUSC 1SS1A 3MTUE 1HF9A 2JDIH 1GL2D 1K05A 3H1ID 3V6IA 4EIJA 1PGQA 2SPZA 2VRSA 2OYIC 1L0ND 1N7SB 1X8YA 3L70J 1GW3A 1NTMJ 5AVZB 1G1IA 1M7LA 2G3AA 1LWUA 2Y0EA 1CW5A 2Q5UA 2HPCA 3L35A 1N7SD 5CBNA 2V7QJ 3VMYA 2KS1A 1RQVA
chains in the Genus database with same CATH topology
3VP9A 3HTKA 2HODA 1RF0B 1FZCC 2HLOC 1GD2E 1KILD 2XNXA 2HLOA 3FIBA 1DX7A 3E1IA 1RE4C 3G3ZA 3KYQA 2J59M 3VYIA 2JEEA 1ZR4A 1HH0A 1N86B 2GY7A 1T2KC 5AVYB 1MV8A 1GU5A 1MZ9A 3RK3C 1FU1A 1N7LA 3HE4B 3MUDA 1LT9C 1ZR2A 1LWUC 1ZN5A 2XKMA 1RF1C 3M9QA 2IFMA 1NAFA 3VN0A 2J1GA 2XU6A 1Z3UA 1RE4A 1NHLA 1JO5A 5AVXB 5KJ7D 2ZXEB 2CPBA 2R32A 1SLQA 2FYZA 4AYCA 1DEBA 2HODC 1EQ7A 1FZFA 5AVVB 1GK6A 2WPRA 1LTJA 1L4AD 2WPQA 2YKPA 1J1EC 1FZGB 3U59A 4ZKUA 5CCHC 5AVSB 3HE5B 1JCDA 3PP5A 1KILC 3B5NA 3M0AA 1URQC 2P2UA 3HUSA 5CHXA 1JNMA 2WSEH 1YYCA 1JC9A 2NPSA 3TNUB 4WY4B 1URQA 1H88A 1SQVK 2FYUK 3HRNA 4JYBA 2A45H 3MGNA 4N78D 2E42A 1AFOA 4I2LC 3M06A 3RL0C 4IFMA 2FFDA 1FJPA 2YKOA 1L0LK 1GTWA 3A3YB 3II6A 1N7SC 3N4XA 4I6MC 3BRVB 3NXSA 1CI6A 3U1AA 1FIDA 3BVHC 3HD7C 5APSA 2Z5HA 3VOPA 2J0HA 3HD7B 5APVA 1KILA 2C0XA 1NKNA 1M1JA 1NKZB 3V2NA 2FIBA 4AQRD 2WITA 3OAKA 1RE3B 1FZBB 2Z5IA 3KQGA 1FJKA 2MJZA 1URQD 1FZFC 5APTA 4C7RA 2XZRA 5AVQB 2Q9IA 3B5ND 2J61A 3P8CE 4HYTB 5AW1B 4N6JA 3P7KA 1JCCA 3M9HA 1FZCB 3GHGB 1T8ZA 3NFQA 3KDPB 1FZAB 2OYIA 2GM4A 3N7NA 5AVTB 1N73A 2J58A 1LTSC 1JTHA 1GL2B 2O01H 1FZEB 2YKQA 2A45G 1SQQK 1RE3C 3CI9A 5AW0B 2Z4EA 2NPSC 3H6PA 3M91A 3IFMA 5KJ7C 4ZFGA 5AW5B 3TYYA 3B5NC 1IFIA 2WT7A 1H89A 1G2CB 2W6AA 4AUWA 2QM7A 3RL0D 1Z3SA 1G1JA 2YNYA 3R2PA 1JY3P 3M0DC 3LW5H 2O1KA 4JF7A 2FKWB 4M7HA 3MD0A 3V4QA 2GUVA 4W7YA 1OXZA 1SQBK 3VTPC 3NTNA 2N1TB 1T3JA 2POHA 2JHLF 4Y99B 4XA4A 4M7FA 3H32A 1FZBC 4OH8B 1N86C 1FIBA 2D39A 2Z4EC 1SFCA 3LIDA 1WT6A 1N7SA 2H43B 1LTBC 1SP4A 1S9KD 3U1CA 1FOSF 1L4AA 5CJ0A 1RF0C 2PP6A 3CL3D 2IFNA 2M8RA 1MFZA 2C0WA 3VP8A 4C7NA 2WTYA 3V4WA 3RK2B 1QL2A 1RF1A 3EQ2A 5AW7B 1FICA 1LTIC 3V5BA 1GU4A 1LGHB 4LLHA 4GT1A 1HBWA 2J3GA 2JHIF 3BVHB 3MIWA 2GUSA 2HODB 1CZQA 2J5ZA 2YO2A 1KFMA 5CCHD 2XNXB 2J3FD 2WZ7A 1QL1A 1JY3O 2HG5D 1IC2A 3RL0B 2KSJA 4I1LA 4HH2A 2J3OA 1A02J 1T2KD 5AVWB 1IFDA 3C9IA 1LT9B 2J3UA 1XTGB 1SQXK 1LWUB 1GL2C 3RK2D 2HPCC 1A02F 1MUUA 2HPCB 2WPSA 2J0YA 2JHKF 5KTBA 2OYHA 1RE4B 1HJBA 4W7ZA 1OWAA 4KHXA 5CCGC 4Y99C 3M9BA 3UIAA 2I1KA 2L5GB 3CLQA 2YMYA 3VMZA 3A5TA 1FZFB 3HTKB 1RF0A 4N78E 1LTJB 4WBAA 2HLOB 3V2QA 5APXA 1GZLA 3E1IB 2KYVA 1S9KE 1SVFA 3O8ZA 2P7JA 1VDFA 5AW4B 3HUSB 1SFCC 2NPSB 3TNUA 4JZCA 1N86A 1KZUB 3EFGA 1GW4A 1NTZK 4R9JA 5APQA 4M3LA 2KB7P 2IPPA 1J1EB 4ZKPA 1FZGC 1HVVA 1N73C 3HE4A 2R5DA 2M3BA 1GDTA 1T3UA 4JYOX 5AW9B 1HTLC 2N1TD 2PAJA 2FFDB 3GHGC 5AW8B 1FZAC 1NTKK 2LKMA 2JHMF 2JHHC 4DOJA 1YTZI 1X79B 1JMMA 2J3FA 3BRTB 2W27A 2XDJA 4XE5B 1VPCA 2R5BA 4B86A 1XTCC 1FZGA 2WSFH 2WNPF 3HE5A 2J64A 1M1JB 3LIEA 5KJ7A 3A7OA 1IFJA 2P67A 3B5NB 1J2JB 1RE3A 1FZBA 2KOGA 4WY4A 1URQB 3P32A 5CMZA 2O1JA 2J0GA 5BU5A 2JJLA 1LTJC 4LC1A 1JY2O 3RK3D 1JY3N 2Q3IA 2R3CA 2KP8A 1YTZT 1RY3A 1FZCA 3GHGA 3T97A 1FZAA 1L4AC 2Q9IC 1FZDA 3BASA 5CCGA 1N73B 1FZEA 1JTHB 1JY2N 1KFNA 1H8AA 1IFMA 2OYHC 3V2RA 2Z4EB 3L36A 4WB4A 1M1JC 1CI6B 3OJAB 4R9TA 2YO3A 3OA7A 4RESB 3HD7A 1GK4A 1KILB 3B8EB 3NMDA 5AVRB 2KLVA 2P1JA 1HGZA 2IX7C 3KPEA 2N1TC 2OARA 4DZOA 2HYNA 2A45I 1NWQA 1E5WA 1LTTC 3BATA 2W6BA 5AW3B 1HGVA 2E43A 2QM8A 2Q9IB 3TSIA 1W2EA 2XV5A 2J61B 3P8MC 3SWFA 3SWYA 2Q7CA 3A2AA 4IFFA 2OYIB 3I5CA 1SQPK 3V2PA 1NO4A 2H43C 1KQLA 1JOCA 4WY4C 2HFED 4JYCA 4GKGA 1GL2A 4EPUA 1SFCB 3WMM0 5BU8B 3H32C 2H43A 2ZFCA 1FBMA 1HWTC 1FZEC 1JUNA 5APYA 1L4AB 1IK9A 1DH3A 2C9LY 2WT7B 1J1DB 5AVUB 2XNXC 1G2CA 1L0NK 5APWA 1JY2P 3TK1A 3M0DA 1J1DC 1LTAC 2FFDC 4GIFA 4C7NB 5APUA 1X9VA 1NU1K 3VMXA 1RF1B 5AW6B 1SFCD 2N1TA 1IJDB 1IFNA 1PFIA 1FAVA 1AQ5A 4IFDK 4LGDE 5CCGD 1FDMA 5KLVK 1Z56A 1NH4A 1WRGA 3HUSC 3H32B 3MTUE 2J60A 3BVHA 1GL2D 3RK2C 4N3YB 3L4FA 2I1JA 4EIJA 5CCHA 3L37A 1N2DC 4W80A 2WSCH 1ZV8A 2OYIC 2VRSA 1N7SB 1X8YA 5AW2B 2CPSA 5CJ4A 1NOHA 1GW3A 1LTGC 2C9NY 1ZLLA 5AVZB 4C46A 3IR9A 1FOSE 5BVZA 4WY4D 1G1IA 1M7LA 2J2PA 1LT9A 2BASA 4O9BA 1LWUA 1HUCA 2H8PD 1CW5A 1CSBA 2Q5UA 2HPCA 3P8CD 3L35A 2NPSD 2H7HA 4NYTA 1N7SD 1IO4A 2WWWA 2FXMA 3RK3B 2OYHB 2N9BA 4EOTA 3HD7D 3E1IC 1NTMK 3VMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT9 B;  1FZA B;  2HOD A;  2J3U A;  2OYI A;  1RF0 B;  1FZC C;  1LWU B;  2HLO C;  2HPC C;  2XNX A;  1N73 A;  2HLO A;  2A45 I;  1FZE B;  3FIB A;  2HPC B;  2A45 G;  3E1I A;  1RE4 C;  1RE3 C;  2J0Y A;  2Z4E A;  2JHK F;  2OYH A;  1RE4 B;  2Q9I B;  4ZFG A;  1W2E A;  2J61 B;  1N86 B;  2GY7 A;  1FZF B;  2OYI B;  1RF0 A;  1LTJ B;  2H43 C;  1LT9 C;  1Z3S A;  1LWU C;  2HLO B;  1JY3 P;  1RF1 C;  3E1I B;  4EPU A;  2J1G A;  4M7H A;  3HUS B;  1Z3U A;  1RE4 A;  3H32 C;  2H43 A;  4JZC A;  1N86 A;  1FZE C;  2JHL F;  2HOD C;  4R9J A;  1FZF A;  4M7F A;  1FZG C;  1N73 C;  3H32 A;  2XNX C;  1FZB C;  1LTJ A;  1JY2 P;  1FZG B;  1T3U A;  4JYO X;  1N86 C;  1FIB A;  2FFD C;  2D39 A;  2Z4E C;  2FFD B;  3GHG C;  1RF1 B;  3HUS A;  1FZA C;  2JHM F;  2JHH C;  1JC9 A;  2H43 B;  2J3F A;  1RF0 C;  3HUS C;  3H32 B;  2A45 H;  1FZG A;  2J60 A;  3BVH A;  2WNP F;  2J64 A;  1M1J B;  2FFD A;  1RF1 A;  2OYI C;  1RE3 A;  1FZB A;  1FIC A;  2J0G A;  1LTJ C;  1FID A;  3BVH C;  1JY2 O;  2J3G A;  2JHI F;  1JY3 N;  2J0H A;  3BVH B;  1FZC A;  3GHG A;  2J2P A;  1LT9 A;  1FZA A;  2HOD B;  1M1J A;  2J5Z A;  1LWU A;  1FZD A;  2Q9I C;  2FIB A;  1N73 B;  2XNX B;  1RE3 B;  2J3F D;  1FZB B;  1FZE A;  1JY2 N;  2HPC A;  2OYH C;  1JY3 O;  4NYT A;  1FZF C;  2Z4E B;  2OYH B;  1M1J C;  2Q9I A;  2J61 A;  2J3O A;  4R9T A;  3E1I C;  1FZC B;  3GHG B; 
#chains in the Genus database with same CATH topology
 1RF0 B;  2HLO A;  3SWK A;  3FIB A;  3G3Z A;  3GG2 A;  3IF4 A;  3KYQ A;  2NRG A;  2B89 A;  1ZR4 A;  3TF5 A;  3PLN A;  2IBZ I;  3E1R A;  1GU5 A;  3RGU A;  1EZV D;  2YIU B;  3HE4 B;  1ZR2 A;  2D2C D;  2XKM A;  4XFJ A;  1OZH A;  2QSI A;  3M9Q A;  1Y47 A;  1NHL A;  2RKL A;  5KJ7 D;  5H2F E;  2CPB A;  3H1L G;  4AYC A;  2HOD C;  2QE7 H;  3KXD A;  1L0L G;  2WPR A;  4PV1 B;  3U59 A;  2WQY C;  1P84 I;  3B5N A;  5CHX A;  1JC9 A;  2Y9Z A;  2NPS A;  1H88 A;  1KB9 I;  1SQV K;  3HRN A;  2WSF J;  2LR2 A;  2QJP B;  1S4X A;  2KZJ A;  1VF5 B;  5M1B A;  2YKO A;  1GTW A;  2WSS H;  4RJT A;  3L75 D;  2RMZ A;  3WUU A;  2QJK B;  1CI6 A;  4PD4 D;  1FID A;  1PPJ G;  2J0H A;  1PP9 D;  2KI7 B;  2B88 A;  2Y9Y A;  1URQ D;  5APT A;  5AVQ B;  1L2P A;  5AW1 B;  5KLI C;  1JCC A;  3GHG B;  3T97 B;  5AVT B;  2AEM A;  1W5C E;  2D2C B;  1VQ6 P;  3CI9 A;  1X22 A;  2ZT9 C;  2NPS C;  2ZYD A;  1KC8 Q;  5AW5 B;  1FS0 E;  3B5N C;  1FDI A;  2PGD A;  1G2C B;  2W6A A;  4AUW A;  5L8R J;  1G1J A;  2V4H A;  1NTK J;  1OFC X;  5KLV E;  4YXW H;  1VQK P;  2O1K A;  2FKW B;  2FYN B;  2GUV A;  1PGO A;  1OXZ A;  1SQB K;  1ZOY C;  4ASW A;  2E76 C;  1OW7 A;  4BWN A;  2W83 C;  4IOI H;  4Y99 B;  2W8Z A;  4XA4 A;  4M7F A;  1FZB C;  4OH8 B;  1N86 C;  4TLF A;  2BEZ F;  1YJN P;  1LTB C;  5KLI B;  1YJW P;  3BCC G;  5CJ0 A;  1OX3 A;  1SQB J;  2IFN A;  3JSV C;  3VP8 A;  1Y8A A;  2N9Y B;  4U3F D;  3L70 E;  4Y28 J;  1KD1 Q;  3CWB J;  4R4M A;  2FXP A;  2E5T A;  2JHI F;  3BVH B;  2HOD B;  2J5Z A;  1KFM A;  2IBZ D;  1VQ8 P;  2XNX B;  2WZ7 A;  2YMK A;  3GMA A;  3TDK A;  3CCV P;  1IC2 A;  1VQ7 P;  5E79 E;  2KNC B;  1R5S A;  2XND H;  1T2K D;  1A02 J;  5AVW B;  1IFD A;  3L72 E;  3AE1 C;  1BE3 J;  3L71 E;  2M5A A;  2JHK F;  3CXH E;  1IZN B;  3UIA A;  3L71 G;  2I1K A;  4H44 D;  3A5T A;  4N78 E;  1GZL A;  3E1I B;  1M90 Q;  3A0H E;  4GOE A;  2Q3E A;  5KAI H;  1SQP D;  3TNU A;  1N86 A;  1KZU B;  3EFG A;  1YJ9 P;  1NTZ D;  2IPP A;  1J1E B;  2WMM A;  1FZG C;  1N73 C;  2R5D A;  3H1H J;  3GHG C;  3TGU G;  1NTK K;  2JHH C;  1BDC A;  1KB9 H;  2Q1K A;  2HR3 A;  4XE5 B;  1VPC A;  2R5B A;  1PPJ D;  1XTC C;  3CCE P;  2FYU E;  3CX5 E;  1SQX D;  2J64 A;  3LIE A;  4WY4 A;  2KSE A;  5CMZ A;  3AE6 C;  1BE3 G;  1RY3 A;  1ZP0 C;  4IL6 X;  1DD3 A;  3AE8 C;  1JTH B;  1KFN A;  1IFM A;  2ZT9 D;  1LJ2 A;  2YXQ B;  4RKU J;  3KZI E;  3NMD A;  5AVR B;  2KLV A;  3D71 A;  2P1J A;  3KPE A;  2OAR A;  2BCC D;  1LTT C;  1NU1 E;  5AW3 B;  3ABV C;  4R4L A;  2E43 A;  2Q9I B;  1W2E A;  3SWF A;  2YXR B;  3GW6 A;  2OGU A;  1VQL P;  2OYI B;  3CPW O;  1KQL A;  4WVZ A;  4WY4 C;  5E79 H;  3D6Y A;  2ZVN B;  2H43 A;  3AEG C;  1HWT C;  1L4A B;  1DH3 A;  1IK9 A;  1P84 H;  2MKV A;  1DEE G;  3B71 A;  4ASV A;  3M0D A;  2FFD C;  1PGJ A;  2RN0 A;  2M3E A;  1RF1 B;  1SFC D;  3CCQ P;  2B9B A;  1FAV A;  1SQB E;  1AQ5 A;  4LGD E;  1FDM A;  3H32 B;  3CME P;  2J60 A;  3RK2 C;  2WVR A;  1MFT A;  1S72 P;  5CCH A;  4GOD A;  2WSC H;  5AW2 B;  5CJ4 A;  1ZLL A;  4HKZ H;  3IR9 A;  5B5E E;  4TT3 H;  3H1J E;  3H1L E;  2H88 C;  2NPS D;  2ZXX A;  2H7H A;  2WWW A;  1BGY D;  1NTM K;  4GOF A;  3RBX A;  4IL6 E;  3HTK A;  3L71 D;  1FZC C;  2E76 B;  3L71 J;  1BCC E;  1K04 A;  2FBW C;  1KYO H;  2E74 B;  5AVY B;  1MZ9 A;  3RK3 C;  3H1J D;  1N7L A;  3MUD A;  1VQN P;  4OWF A;  1Q90 D;  1M56 D;  1NAF A;  2J1G A;  2ZXE B;  1PGP A;  3PRJ A;  1DEB A;  1EZV I;  1EQ7 A;  1FZF A;  3PTZ A;  5TIS E;  1LTJ A;  1NAY A;  1J1E C;  1FZG B;  4ZKU A;  4D6T D;  5CCH C;  1JCD A;  3MUD C;  1KIL C;  3AE7 C;  1Q7Y Q;  1URQ C;  3HUS A;  1JNM A;  3CX5 H;  1LP1 A;  2A06 D;  4JYB A;  3L75 E;  5KAF E;  1JEK A;  4YXD C;  1OW6 A;  2E42 A;  3R4Y A;  3M06 A;  3RL0 C;  2FFD A;  1FJP A;  4U3F J;  3W68 A;  2CK3 H;  3N4X A;  2Y0D A;  1ZXG A;  3NXS A;  3HD7 C;  3MZW B;  2K9J A;  1H0T B;  1S3J A;  2IZ1 A;  1NKN A;  1M1J A;  3OAK A;  1ZME C;  1FJK A;  4OGQ B;  4PD4 H;  2J61 A;  3L74 E;  4N6J A;  3P7K A;  2AXT E;  2QJY C;  3N7N A;  1NU1 J;  2O01 H;  1SQQ K;  2QEX P;  4HJG H;  3USS A;  4JQ0 D;  2WT7 A;  3L73 E;  1VQO P;  3O6Q B;  2OTL P;  2K37 A;  3M0D C;  3LW5 H;  4M7H A;  3V4Q A;  1VQ9 P;  3L72 D;  4NPF X;  3VTP C;  1PL5 A;  2E5Y A;  1OMI A;  1NVO A;  4H44 C;  4ZMD A;  1KYO E;  3H1H E;  1FIB A;  2D39 A;  1RH5 B;  1SP4 A;  1FOS F;  3QWO C;  2QA4 P;  4C7N A;  3RK2 B;  4EI2 A;  1PIX A;  3JCU H;  1Q2N A;  1OW8 A;  5B5E H;  2AEJ A;  3EWK A;  1LGH B;  4YPC A;  2J3G A;  3MIW A;  3AE5 C;  2OQQ A;  3H1L J;  5CCH D;  1VF5 C;  3FX0 A;  3A0B H;  2HG5 D;  3L70 D;  2KSJ A;  2J3O A;  1U57 A;  3G71 P;  3H1K G;  4DJG A;  1SQX K;  1LWU B;  2HPC C;  1A02 F;  1KMI Z;  3PHL A;  1MUU A;  4H44 B;  2HPC B;  5KTB A;  1RE4 B;  1HJB A;  4W7Z A;  3PH0 A;  4Y99 C;  3M9B A;  1OIP A;  2KS1 B;  1NTK G;  2YMY A;  4OGQ C;  1RF0 A;  5B66 H;  5GTI H;  2HLO B;  3G9R A;  1NGM B;  1S9K E;  1SFC C;  1BCC G;  4JZC A;  2ZAE B;  3H1K D;  5DJU B;  5APQ A;  3CCU P;  3HE4 A;  3QH9 A;  1GDT A;  1T3U A;  2UWJ E;  4JYO X;  2KIK A;  2ITA A;  5AW9 B;  3AED C;  5AW8 B;  2JHM F;  2H89 C;  1RQU A;  1Q82 Q;  2WPV B;  1JMM A;  2J3F A;  3BRT B;  4PJ0 E;  1W2B O;  1KB9 E;  2WSF H;  5KJ7 A;  3A7O A;  3B5N B;  3G6E P;  1NTZ G;  2K3R A;  1KB9 D;  1RE3 A;  1FZB A;  1YHQ P;  4PV1 C;  4GDO A;  2O1J A;  2M0B A;  2O3J A;  5BU5 A;  3OW2 O;  2JJL A;  2B87 B;  2IYO A;  2ZYA A;  1JY3 N;  1FZC A;  1FZA A;  2Q9I C;  1FZD A;  3L73 J;  1N73 B;  1FZE A;  4WWI A;  1H8A A;  4L76 A;  3V2R A;  2Z4E B;  2P58 A;  3L36 A;  1KQG B;  2O01 N;  1BGY J;  1CI6 B;  1K8A Q;  4R9T A;  2FXO A;  2YO3 A;  2IBZ E;  4RES B;  1YBK A;  3B8E B;  2O01 J;  1HGZ A;  1OVR A;  2IX7 C;  1S2E A;  2HYN A;  1L0N G;  2W6B A;  3CC7 P;  2KZI A;  1HGV A;  2XV5 A;  2JKV A;  2PFX A;  1AV1 A;  1HJ0 A;  2K1A A;  2KK7 A;  3A0H H;  3EFF K;  3I5C A;  1SQP K;  3LW5 J;  3V2P A;  2H43 C;  2HFE D;  1EC5 A;  1SFC B;  1BCC D;  5DJT B;  1SQV D;  3W67 A;  2ZFC A;  1FBM A;  1JUN A;  1EDI A;  2IZ0 A;  1R8E A;  2C9L Y;  1J1D B;  2XNX C;  1G2C A;  1JY2 P;  3TK1 A;  1QLE D;  1LTA C;  1EXI A;  5GTH E;  3CX5 D;  4CPG A;  1NU1 K;  3VMX A;  4IL6 H;  4RO0 A;  5TIS H;  1T6A A;  3L75 J;  1YQ4 C;  3KZI H;  1IFN A;  1JB0 J;  4I7Z C;  3SSU A;  1WRG A;  3L74 D;  1USE A;  4ZNC A;  2E74 D;  4U3F E;  3L4F A;  1IK7 A;  4D6T E;  3VMA A;  4W80 A;  2KLU A;  1ZV8 A;  1VF5 D;  5KAF H;  1NTM G;  2CPS A;  4EYY Q;  2DW3 A;  1LTG C;  3AE9 C;  5GTH H;  2C9N Y;  1EDK A;  3B4S A;  2JO1 A;  4C46 A;  1SQB D;  1FOS E;  4K35 A;  1LT9 A;  4O9B A;  1N8R Q;  1HUC A;  5KLV G;  2ZT9 B;  3P8C D;  4NYT A;  3RK3 B;  2OYH B;  1BSN A;  2N9B A;  4EOT A;  4H13 C;  1PP9 G;  3HD7 D;  3F89 A;  3E1I C;  3VP9 A;  4A7P A;  2HOD A;  2HLO C;  2Y0C A;  1GD2 E;  1NTK D;  1KIL D;  2XNX A;  1IFP A;  1DX7 A;  3CWB G;  2J59 M;  3VYI A;  2JEE A;  1M8O B;  5EFW B;  2NZ2 A;  2GY7 A;  1T2K C;  1MV8 A;  2JWD A;  2QJK C;  4NPD A;  1LWU C;  1ZN5 A;  1YQ3 C;  2IYP A;  3CWB E;  1WMK A;  5AVX B;  3FXE A;  1MKM A;  2R32 A;  3D6Z A;  5AVV B;  1L4A D;  2WPQ A;  1PP9 E;  2YKP A;  3HE5 B;  3S4R A;  3M0A A;  1YYC A;  3TNU B;  1URQ A;  1SQP J;  4BRY B;  2K9Y A;  3H1I G;  2A45 H;  3MGN A;  1BGY E;  4N78 D;  4I2L C;  3WUV A;  3H1H D;  1L0L K;  1SQQ E;  1EDJ A;  3A3Y B;  3II6 A;  4I6M C;  3BRV B;  4DCK A;  2YIU C;  4U3F G;  3U1A A;  5APS A;  2Z5H A;  5KAI E;  3HD7 B;  2WSC J;  4H0L C;  1KIL A;  2C0X A;  1M1K Q;  1SQX J;  3V2N A;  2FIB A;  2FYU G;  2WIT A;  2Z5I A;  3KQG A;  1Q81 Q;  2MJZ A;  1FZF C;  3B5N D;  5B66 E;  3P8C E;  1L0L J;  1S5L H;  1L0L D;  3M9H A;  1T8Z A;  3KDP B;  2G8Y A;  1QEX A;  1JTH A;  1GL2 B;  2A45 G;  4H0L B;  3Q5R A;  3M91 A;  3AEE C;  3TYY A;  1VQ4 P;  3SFE C;  2FYU D;  2FYU J;  2L91 A;  3WU2 H;  2QM7 A;  1AA0 A;  1Z3S A;  1PZQ A;  2A06 E;  2YNY A;  2E75 C;  4JF7 A;  2N1T B;  2OTK E;  2JHL F;  2QJP C;  3AEA C;  2E74 C;  2LXC B;  1KQF B;  1KYO I;  1L0N J;  4MN4 C;  2BCC G;  1WT6 A;  1N7S A;  2H43 B;  1NTM D;  1L4A A;  1U7M A;  3MHV A;  2PP6 A;  2C0W A;  3V4W A;  3H1I E;  1RF1 A;  1FIC A;  1LTI C;  1SQX G;  1KQS O;  1KIL E;  3JCU E;  4LLH A;  2BCC J;  3CC4 P;  1CZQ A;  2YO2 A;  3BCC D;  5TJH A;  4L73 A;  1ZRT E;  1JY3 O;  3RL0 B;  3BCC E;  4HH2 A;  3MP7 B;  3I55 P;  3CXH I;  3C9I A;  1XTG B;  3K5B A;  3RK2 D;  2D2C C;  1PP9 J;  2J0Y A;  1OWA A;  4KHX A;  3GLM A;  2L5G B;  2IBZ G;  2QVA A;  3CLQ A;  3VMZ A;  1E79 H;  3HTK B;  4H0L D;  3V2Q A;  2KYV A;  1SVF A;  3O8Z A;  4L75 A;  5AW4 B;  4PD4 I;  1P84 D;  2NPS B;  1SQV J;  1NTZ K;  1D7M A;  4M3L A;  3H1J G;  1HVV A;  3H1J J;  4UB6 E;  2WSE J;  2N1T D;  2PAJ A;  3S1K A;  1NTZ E;  1FZA C;  3H1H G;  4DOJ A;  1YTZ I;  1K73 Q;  4U7J A;  1X79 B;  3FXD A;  2I8D A;  1FE6 A;  3RK3 E;  3Q5S A;  1FZG A;  1L0L E;  2WNP F;  3Q3D A;  1SQQ D;  1K9M Q;  1SQQ J;  1AQT A;  2KOG A;  3D70 A;  3P32 A;  3ZDM A;  2J0G A;  1LTJ C;  2IDB A;  3CC2 P;  4LC1 A;  1JY2 O;  3RK3 D;  2R3C A;  2KXP B;  5H2F H;  1M57 D;  1AJY A;  3GHG A;  3T97 A;  3I56 P;  1NJI Q;  2ZYG A;  4WB4 A;  3CCS P;  2ZVO B;  1ZRT D;  3L74 G;  1DD4 A;  1GK4 A;  1H0T A;  4DZO A;  2N1T C;  1NWQ A;  3GF7 A;  2R44 A;  3TSI A;  2J61 B;  1L0N E;  2Q7C A;  3L73 G;  1JOC A;  4H13 B;  3C8V A;  1QVG O;  3WMM 0;  4JBZ A;  4HB1 A;  5APY A;  2WT7 B;  1EZV E;  1KV4 A;  3O6Q A;  5AVU B;  2K88 A;  3CCJ P;  3JC2 2;  1X9V A;  1SQP E;  1BE3 E;  2BCC E;  3CWB D;  1JM0 A;  1Z56 A;  1BGY G;  3CX5 I;  3BVH A;  4N3Y B;  1VQP P;  2I1J A;  3CXH H;  1N2D C;  3L37 A;  1VQM P;  2AXT H;  1NOH A;  2AXC A;  2KNC A;  5BVZ A;  4WY4 D;  2J2P A;  2V7Q H;  2BAS A;  2RH0 A;  2JWA A;  1YIJ P;  2H8P D;  1CSB A;  1NYH A;  4K3A A;  2M5A B;  1GMJ A;  1IO4 A;  2FXM A;  1KYO D;  3CCM P;  1UII A;  3FWN A;  1S5L E;  3CCL P;  2PRR A;  1AVO A;  3E1I A;  1RE4 C;  4PJ0 H;  2E76 D;  1FC2 C;  3H25 A;  1NTZ J;  1HH0 A;  1N86 B;  3AE4 C;  4QMA A;  1FU1 A;  1LT9 C;  2A06 G;  1RF1 C;  2IFM A;  1SQV E;  3VN0 A;  2XU6 A;  2JR8 A;  1Z3U A;  1RE4 A;  1JO5 A;  1SLQ A;  2FYZ A;  4H13 D;  4DT0 A;  1GK6 A;  4OGQ D;  5AVS B;  3PP5 A;  3PJS K;  2P2U A;  2QRX A;  2WSE H;  2P10 A;  4WY4 B;  2ZJS E;  4UB6 H;  3H1K J;  2FYU K;  1JMB A;  1S1C X;  3H1I J;  3FGA D;  1AFO A;  3H1L D;  4IFM A;  3CMA P;  3AEB C;  1N7S C;  3IAO A;  3BVH C;  1SQQ G;  3VOP A;  5APV A;  3CCR P;  1NKZ B;  3GF3 A;  1SQV G;  4AQR D;  1RE3 B;  2BEQ D;  1FZB B;  3BCC J;  2W6J H;  3AE3 C;  4C7R A;  2XZR A;  2Q9I A;  2B87 A;  4JPZ B;  4HYT B;  1LT1 A;  1UIX A;  1FZC B;  3NFQ A;  1FZA B;  2OYI A;  2GM4 A;  1N73 A;  2J58 A;  1LTS C;  1FZE B;  2YKQ A;  1RE3 C;  4I7Z B;  3AE2 C;  5AW0 B;  2OYO A;  2Z4E A;  3H6P A;  3IN6 A;  3IFM A;  5KJ7 C;  4ZFG A;  4UB8 H;  1DIP A;  1IFI A;  1FDO A;  1PV3 A;  3KHU A;  1H89 A;  2R3S A;  3RL0 D;  3RBZ A;  1R5L A;  1S5L X;  3R2P A;  1JY3 P;  3MD0 A;  4W7Y A;  3NTN A;  4YTP C;  5CBO A;  1T3J A;  2POH A;  4D6T G;  1VQ5 P;  3H32 A;  3TGU E;  2Z4E C;  1PPJ E;  1SFC A;  3LID A;  3WU2 E;  1BCC J;  4KJM A;  2JP3 A;  1S9K D;  3U1C A;  1RF0 C;  2FYN C;  4KT0 J;  5KKZ B;  1KOR A;  1SQB G;  3CL3 D;  2M8R A;  1MFZ A;  2WTY A;  1Q86 Q;  1OVV A;  3Q1M A;  3L73 D;  3FWL A;  1QL2 A;  1BDD A;  3EQ2 A;  5AW7 B;  3L75 G;  1KTM A;  3V5B A;  1GU4 A;  1EZV G;  4GT1 A;  1YI2 P;  1HBW A;  1NTM E;  1QX8 A;  2GUS A;  1QGK B;  4BXL A;  2J3F D;  2AEF A;  4Z1M H;  1QL1 A;  4I1L A;  1RHZ B;  5K5G B;  2FY8 A;  1LT9 B;  2J3U A;  1GL2 C;  3Q5P A;  2WPS A;  5C39 A;  2QIW A;  1USD A;  3Q2Y A;  2OYH A;  2KUB A;  5CCG C;  4L74 A;  2J5U A;  1FZF B;  1AVY A;  3H1K E;  1LTJ B;  4D6T J;  4WBA A;  3L70 G;  2E75 B;  4EDF A;  1NU1 D;  5APX A;  1X0T A;  2P7J A;  1VDF A;  2OTJ P;  3HUS B;  1LP1 B;  1GW4 A;  4R9J A;  3L74 J;  2KB7 P;  3WUT A;  4ZKP A;  2M3B A;  1HTL C;  3RL0 g;  2E75 D;  2FFD B;  2QJY B;  2LKM A;  2W27 A;  2XDJ A;  4B86 A;  2K9J B;  3HE5 A;  1M1J B;  1IFJ A;  2P67 A;  1J2J B;  1YIT P;  1URQ B;  4BRY A;  3G4S P;  5GTI E;  1QVF O;  2Q3I A;  1Y9B A;  2KP8 A;  3A0B E;  1YTZ T;  5KKZ C;  4PD4 E;  1L4A C;  3BAS A;  5CCG A;  1JY2 N;  2OYH C;  1SQP G;  1M1J C;  1LNQ A;  3OJA B;  3OA7 A;  3AEC C;  3HD7 A;  1KIL B;  3AEF C;  3ITK A;  1BSH A;  1EXJ A;  1BE3 D;  2A45 I;  1TU3 F;  1E5W A;  3BAT A;  1OVU A;  3CD6 P;  3L72 J;  3TGU J;  2Q6Q A;  2QG4 A;  3TGU D;  3L72 G;  2QM8 A;  3F5H A;  3P8M C;  2GA1 A;  3SWY A;  1NU1 G;  1ZW0 A;  3A2A A;  4IFF A;  1NO4 A;  3E7K A;  4UB8 E;  4JYC A;  4NPE A;  4GKG A;  1GL2 A;  2W90 A;  4EPU A;  1U7J A;  4PV1 D;  5KLV D;  1P84 E;  1NTK E;  5BU8 B;  5KLV J;  3H32 C;  1KN7 A;  1EDL A;  1FZE C;  1L0N K;  5APW A;  1SQX E;  1J1D C;  3C1L A;  4GIF A;  4C7N B;  4OVN F;  5APU A;  1VL2 A;  3CXH D;  5AW6 B;  2N1T A;  3SFD C;  1IJD B;  1PFI A;  4IFD K;  5CCG D;  5KLV K;  3S9O A;  2LXB A;  1NH4 A;  3HUS C;  1SS1 A;  3MTU E;  1HF9 A;  2JDI H;  1GL2 D;  1K05 A;  3H1I D;  3V6I A;  4EIJ A;  1PGQ A;  2SPZ A;  2VRS A;  2OYI C;  1L0N D;  1N7S B;  1X8Y A;  3L70 J;  1GW3 A;  1NTM J;  5AVZ B;  1G1I A;  1M7L A;  2G3A A;  1LWU A;  2Y0E A;  1CW5 A;  2Q5U A;  2HPC A;  3L35 A;  1N7S D;  5CBN A;  2V7Q J;  3VMY A;  2KS1 A;  1RQV A; 
#chains in the Genus database with same CATH homology
 3VP9 A;  3HTK A;  2HOD A;  1RF0 B;  1FZC C;  2HLO C;  1GD2 E;  1KIL D;  2XNX A;  2HLO A;  3FIB A;  1DX7 A;  3E1I A;  1RE4 C;  3G3Z A;  3KYQ A;  2J59 M;  3VYI A;  2JEE A;  1ZR4 A;  1HH0 A;  1N86 B;  2GY7 A;  1T2K C;  5AVY B;  1MV8 A;  1GU5 A;  1MZ9 A;  3RK3 C;  1FU1 A;  1N7L A;  3HE4 B;  3MUD A;  1LT9 C;  1ZR2 A;  1LWU C;  1ZN5 A;  2XKM A;  1RF1 C;  3M9Q A;  2IFM A;  1NAF A;  3VN0 A;  2J1G A;  2XU6 A;  1Z3U A;  1RE4 A;  1NHL A;  1JO5 A;  5AVX B;  5KJ7 D;  2ZXE B;  2CPB A;  2R32 A;  1SLQ A;  2FYZ A;  4AYC A;  1DEB A;  2HOD C;  1EQ7 A;  1FZF A;  5AVV B;  1GK6 A;  2WPR A;  1LTJ A;  1L4A D;  2WPQ A;  2YKP A;  1J1E C;  1FZG B;  3U59 A;  4ZKU A;  5CCH C;  5AVS B;  3HE5 B;  1JCD A;  3PP5 A;  1KIL C;  3B5N A;  3M0A A;  1URQ C;  2P2U A;  3HUS A;  5CHX A;  1JNM A;  2WSE H;  1YYC A;  1JC9 A;  2NPS A;  3TNU B;  4WY4 B;  1URQ A;  1H88 A;  1SQV K;  2FYU K;  3HRN A;  4JYB A;  2A45 H;  3MGN A;  4N78 D;  2E42 A;  1AFO A;  4I2L C;  3M06 A;  3RL0 C;  4IFM A;  2FFD A;  1FJP A;  2YKO A;  1L0L K;  1GTW A;  3A3Y B;  3II6 A;  1N7S C;  3N4X A;  4I6M C;  3BRV B;  3NXS A;  1CI6 A;  3U1A A;  1FID A;  3BVH C;  3HD7 C;  5APS A;  2Z5H A;  3VOP A;  2J0H A;  3HD7 B;  5APV A;  1KIL A;  2C0X A;  1NKN A;  1M1J A;  1NKZ B;  3V2N A;  2FIB A;  4AQR D;  2WIT A;  3OAK A;  1RE3 B;  1FZB B;  2Z5I A;  3KQG A;  1FJK A;  2MJZ A;  1URQ D;  1FZF C;  5APT A;  4C7R A;  2XZR A;  5AVQ B;  2Q9I A;  3B5N D;  2J61 A;  3P8C E;  4HYT B;  5AW1 B;  4N6J A;  3P7K A;  1JCC A;  3M9H A;  1FZC B;  3GHG B;  1T8Z A;  3NFQ A;  3KDP B;  1FZA B;  2OYI A;  2GM4 A;  3N7N A;  5AVT B;  1N73 A;  2J58 A;  1LTS C;  1JTH A;  1GL2 B;  2O01 H;  1FZE B;  2YKQ A;  2A45 G;  1SQQ K;  1RE3 C;  3CI9 A;  5AW0 B;  2Z4E A;  2NPS C;  3H6P A;  3M91 A;  3IFM A;  5KJ7 C;  4ZFG A;  5AW5 B;  3TYY A;  3B5N C;  1IFI A;  2WT7 A;  1H89 A;  1G2C B;  2W6A A;  4AUW A;  2QM7 A;  3RL0 D;  1Z3S A;  1G1J A;  2YNY A;  3R2P A;  1JY3 P;  3M0D C;  3LW5 H;  2O1K A;  4JF7 A;  2FKW B;  4M7H A;  3MD0 A;  3V4Q A;  2GUV A;  4W7Y A;  1OXZ A;  1SQB K;  3VTP C;  3NTN A;  2N1T B;  1T3J A;  2POH A;  2JHL F;  4Y99 B;  4XA4 A;  4M7F A;  3H32 A;  1FZB C;  4OH8 B;  1N86 C;  1FIB A;  2D39 A;  2Z4E C;  1SFC A;  3LID A;  1WT6 A;  1N7S A;  2H43 B;  1LTB C;  1SP4 A;  1S9K D;  3U1C A;  1FOS F;  1L4A A;  5CJ0 A;  1RF0 C;  2PP6 A;  3CL3 D;  2IFN A;  2M8R A;  1MFZ A;  2C0W A;  3VP8 A;  4C7N A;  2WTY A;  3V4W A;  3RK2 B;  1QL2 A;  1RF1 A;  3EQ2 A;  5AW7 B;  1FIC A;  1LTI C;  3V5B A;  1GU4 A;  1LGH B;  4LLH A;  4GT1 A;  1HBW A;  2J3G A;  2JHI F;  3BVH B;  3MIW A;  2GUS A;  2HOD B;  1CZQ A;  2J5Z A;  2YO2 A;  1KFM A;  5CCH D;  2XNX B;  2J3F D;  2WZ7 A;  1QL1 A;  1JY3 O;  2HG5 D;  1IC2 A;  3RL0 B;  2KSJ A;  4I1L A;  4HH2 A;  2J3O A;  1A02 J;  1T2K D;  5AVW B;  1IFD A;  3C9I A;  1LT9 B;  2J3U A;  1XTG B;  1SQX K;  1LWU B;  1GL2 C;  3RK2 D;  2HPC C;  1A02 F;  1MUU A;  2HPC B;  2WPS A;  2J0Y A;  2JHK F;  5KTB A;  2OYH A;  1RE4 B;  1HJB A;  4W7Z A;  1OWA A;  4KHX A;  5CCG C;  4Y99 C;  3M9B A;  3UIA A;  2I1K A;  2L5G B;  3CLQ A;  2YMY A;  3VMZ A;  3A5T A;  1FZF B;  3HTK B;  1RF0 A;  4N78 E;  1LTJ B;  4WBA A;  2HLO B;  3V2Q A;  5APX A;  1GZL A;  3E1I B;  2KYV A;  1S9K E;  1SVF A;  3O8Z A;  2P7J A;  1VDF A;  5AW4 B;  3HUS B;  1SFC C;  2NPS B;  3TNU A;  4JZC A;  1N86 A;  1KZU B;  3EFG A;  1GW4 A;  1NTZ K;  4R9J A;  5APQ A;  4M3L A;  2KB7 P;  2IPP A;  1J1E B;  4ZKP A;  1FZG C;  1HVV A;  1N73 C;  3HE4 A;  2R5D A;  2M3B A;  1GDT A;  1T3U A;  4JYO X;  5AW9 B;  1HTL C;  2N1T D;  2PAJ A;  2FFD B;  3GHG C;  5AW8 B;  1FZA C;  1NTK K;  2LKM A;  2JHM F;  2JHH C;  4DOJ A;  1YTZ I;  1X79 B;  1JMM A;  2J3F A;  3BRT B;  2W27 A;  2XDJ A;  4XE5 B;  1VPC A;  2R5B A;  4B86 A;  1XTC C;  1FZG A;  2WSF H;  2WNP F;  3HE5 A;  2J64 A;  1M1J B;  3LIE A;  5KJ7 A;  3A7O A;  1IFJ A;  2P67 A;  3B5N B;  1J2J B;  1RE3 A;  1FZB A;  2KOG A;  4WY4 A;  1URQ B;  3P32 A;  5CMZ A;  2O1J A;  2J0G A;  5BU5 A;  2JJL A;  1LTJ C;  4LC1 A;  1JY2 O;  3RK3 D;  1JY3 N;  2Q3I A;  2R3C A;  2KP8 A;  1YTZ T;  1RY3 A;  1FZC A;  3GHG A;  3T97 A;  1FZA A;  1L4A C;  2Q9I C;  1FZD A;  3BAS A;  5CCG A;  1N73 B;  1FZE A;  1JTH B;  1JY2 N;  1KFN A;  1H8A A;  1IFM A;  2OYH C;  3V2R A;  2Z4E B;  3L36 A;  4WB4 A;  1M1J C;  1CI6 B;  3OJA B;  4R9T A;  2YO3 A;  3OA7 A;  4RES B;  3HD7 A;  1GK4 A;  1KIL B;  3B8E B;  3NMD A;  5AVR B;  2KLV A;  2P1J A;  1HGZ A;  2IX7 C;  3KPE A;  2N1T C;  2OAR A;  4DZO A;  2HYN A;  2A45 I;  1NWQ A;  1E5W A;  1LTT C;  3BAT A;  2W6B A;  5AW3 B;  1HGV A;  2E43 A;  2QM8 A;  2Q9I B;  3TSI A;  1W2E A;  2XV5 A;  2J61 B;  3P8M C;  3SWF A;  3SWY A;  2Q7C A;  3A2A A;  4IFF A;  2OYI B;  3I5C A;  1SQP K;  3V2P A;  1NO4 A;  2H43 C;  1KQL A;  1JOC A;  4WY4 C;  2HFE D;  4JYC A;  4GKG A;  1GL2 A;  4EPU A;  1SFC B;  3WMM 0;  5BU8 B;  3H32 C;  2H43 A;  2ZFC A;  1FBM A;  1HWT C;  1FZE C;  1JUN A;  5APY A;  1L4A B;  1IK9 A;  1DH3 A;  2C9L Y;  2WT7 B;  1J1D B;  5AVU B;  2XNX C;  1G2C A;  1L0N K;  5APW A;  1JY2 P;  3TK1 A;  3M0D A;  1J1D C;  1LTA C;  2FFD C;  4GIF A;  4C7N B;  5APU A;  1X9V A;  1NU1 K;  3VMX A;  1RF1 B;  5AW6 B;  1SFC D;  2N1T A;  1IJD B;  1IFN A;  1PFI A;  1FAV A;  1AQ5 A;  4IFD K;  4LGD E;  5CCG D;  1FDM A;  5KLV K;  1Z56 A;  1NH4 A;  1WRG A;  3HUS C;  3H32 B;  3MTU E;  2J60 A;  3BVH A;  1GL2 D;  3RK2 C;  4N3Y B;  3L4F A;  2I1J A;  4EIJ A;  5CCH A;  3L37 A;  1N2D C;  4W80 A;  2WSC H;  1ZV8 A;  2OYI C;  2VRS A;  1N7S B;  1X8Y A;  5AW2 B;  2CPS A;  5CJ4 A;  1NOH A;  1GW3 A;  1LTG C;  2C9N Y;  1ZLL A;  5AVZ B;  4C46 A;  3IR9 A;  1FOS E;  5BVZ A;  4WY4 D;  1G1I A;  1M7L A;  2J2P A;  1LT9 A;  2BAS A;  4O9B A;  1LWU A;  1HUC A;  2H8P D;  1CW5 A;  1CSB A;  2Q5U A;  2HPC A;  3P8C D;  3L35 A;  2NPS D;  2H7H A;  4NYT A;  1N7S D;  1IO4 A;  2WWW A;  2FXM A;  3RK3 B;  2OYH B;  2N9B A;  4EOT A;  3HD7 D;  3E1I C;  1NTM K;  3VMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...