2XNXC

Bc1 fragment of streptococcal m1 protein in complex with human fibrinogen
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
302
structure length
302
Chain Sequence
EEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Streptococcal M1 Protein Constructs a Pathological Host Fibrinogen Network
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 75
structure length 302
sequence length 302
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2xnxC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2xnxC02
4NYTA 2XNXB 1RE4B 2WNPF 2HLOB 2FFDB 1M1JB 4JYOX 1FZGB 1LTJB 1N73C 4JZCA 1FZDA 2J1GA 1RE4C 2Q9IB 1RE3B 2FFDC 2HLOC 4R9TA 1M1JC 1RF0C 3BVHC 4R9JA 1FZGC 2Z4EC 1LTJC 1RF1B 2JHHC 1Z3UA 2J3GA 2J60A 1N73B 4M7HA 4EPUA 1FZCC 1LT9C 1RF0B 2HODC 3BVHB 1N86C 2Z4EB 1FZFB 2OYIC 1FZEC 4M7FA 2J61B 2J0GA 1FIDA 1FZFC 1FZCB 2J0YA 3H32C 1LT9B 2HODB 1FIBA 1N86B 2J3UA 2JHKF 2OYIB 2J3OA 1FZEB 1Z3SA 2J61A 3E1IC 2OYHB 1FZBC 2D39A 2JHLF 3GHGC 1LWUC 3H32B 2HPCB 2OYHC 2J5ZA 2JHIF 2J2PA 2JHMF 2J3FA 3E1IB 2HPCC 2GY7A 1FZBB 2J3FD 1LWUB 2H43B 1FICA 1JC9A 1FZAB 2XNXC 3HUSB 2J64A 2FIBA 2H43C 4ZFGA 1FZAC 2J0HA 2Q9IC 3HUSC 1RE3C 3FIBA 1RF1C
chains in the Genus database with same CATH superfamily
4NYTA 2XNXB 1RE4B 2WNPF 2HLOB 2FFDB 1M1JB 4JYOX 1FZGB 1LTJB 1N73C 4JZCA 1FZDA 2J1GA 1RE4C 2Q9IB 1RE3B 2FFDC 2HLOC 4R9TA 1M1JC 1RF0C 3BVHC 4R9JA 1FZGC 2Z4EC 1LTJC 1RF1B 2JHHC 1Z3UA 2J3GA 2J60A 1N73B 4M7HA 4EPUA 1FZCC 1LT9C 1RF0B 2HODC 3BVHB 1N86C 2Z4EB 1FZFB 2OYIC 1FZEC 4M7FA 2J61B 2J0GA 1FIDA 1FZFC 1FZCB 2J0YA 3H32C 1LT9B 2HODB 1FIBA 1N86B 2J3UA 2JHKF 3GHGB 2OYIB 2J3OA 1FZEB 1Z3SA 2J61A 3E1IC 2OYHB 1FZBC 2D39A 2JHLF 3GHGC 1LWUC 3H32B 2HPCB 2OYHC 2J5ZA 2JHIF 2J2PA 2JHMF 2J3FA 3E1IB 2HPCC 2GY7A 1FZBB 2J3FD 1LWUB 2H43B 1FICA 1JC9A 1FZAB 2XNXC 3HUSB 2J64A 2FIBA 2H43C 4ZFGA 1FZAC 2J0HA 2Q9IC 3HUSC 1RE3C 3FIBA 1RF1C
chains in the Genus database with same CATH topology
4NYTA 2XNXB 1RE4B 2WNPF 2HLOB 2FFDB 1M1JB 4JYOX 1FZGB 1LTJB 1N73C 4JZCA 1FZDA 2J1GA 1RE4C 2Q9IB 1RE3B 2FFDC 2HLOC 4R9TA 1M1JC 1RF0C 3BVHC 4R9JA 1FZGC 2Z4EC 1LTJC 1RF1B 2JHHC 1Z3UA 2J3GA 2J60A 1N73B 4M7HA 4EPUA 1FZCC 1LT9C 1RF0B 2HODC 3BVHB 1N86C 2Z4EB 1FZFB 2OYIC 1FZEC 4M7FA 2J61B 2J0GA 1FIDA 1FZFC 1FZCB 2J0YA 3H32C 1LT9B 2HODB 1FIBA 1N86B 2J3UA 2JHKF 2OYIB 2J3OA 1FZEB 1Z3SA 2J61A 3E1IC 2OYHB 1FZBC 2D39A 2JHLF 3GHGC 1LWUC 3H32B 2HPCB 2OYHC 2J5ZA 2JHIF 2J2PA 2JHMF 2J3FA 3E1IB 2HPCC 2GY7A 1FZBB 2J3FD 1LWUB 2H43B 1FICA 1JC9A 1FZAB 2XNXC 3HUSB 2J64A 2FIBA 2H43C 4ZFGA 1FZAC 2J0HA 2Q9IC 3HUSC 1RE3C 3FIBA 1RF1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYT A;  2XNX B;  1RE4 B;  2WNP F;  2HLO B;  2FFD B;  1M1J B;  4JYO X;  1FZG B;  1LTJ B;  1N73 C;  4JZC A;  1FZD A;  2J1G A;  1RE4 C;  2Q9I B;  1RE3 B;  2FFD C;  2HLO C;  4R9T A;  1M1J C;  1RF0 C;  3BVH C;  4R9J A;  1FZG C;  2Z4E C;  1LTJ C;  1RF1 B;  2JHH C;  1Z3U A;  2J3G A;  2J60 A;  1N73 B;  4M7H A;  4EPU A;  1FZC C;  1LT9 C;  1RF0 B;  2HOD C;  3BVH B;  1N86 C;  2Z4E B;  1FZF B;  2OYI C;  1FZE C;  4M7F A;  2J61 B;  2J0G A;  1FID A;  1FZF C;  1FZC B;  2J0Y A;  3H32 C;  1LT9 B;  2HOD B;  1FIB A;  1N86 B;  2J3U A;  2JHK F;  2OYI B;  2J3O A;  1FZE B;  1Z3S A;  2J61 A;  3E1I C;  2OYH B;  1FZB C;  2D39 A;  2JHL F;  3GHG C;  1LWU C;  3H32 B;  2HPC B;  2OYH C;  2J5Z A;  2JHI F;  2J2P A;  2JHM F;  2J3F A;  3E1I B;  2HPC C;  2GY7 A;  1FZB B;  2J3F D;  1LWU B;  2H43 B;  1FIC A;  1JC9 A;  1FZA B;  2XNX C;  3HUS B;  2J64 A;  2FIB A;  2H43 C;  4ZFG A;  1FZA C;  2J0H A;  2Q9I C;  3HUS C;  1RE3 C;  3FIB A;  1RF1 C; 
#chains in the Genus database with same CATH topology
 4NYT A;  2XNX B;  1RE4 B;  2WNP F;  2HLO B;  2FFD B;  1M1J B;  4JYO X;  1FZG B;  1LTJ B;  1N73 C;  4JZC A;  1FZD A;  2J1G A;  1RE4 C;  2Q9I B;  1RE3 B;  2FFD C;  2HLO C;  4R9T A;  1M1J C;  1RF0 C;  3BVH C;  4R9J A;  1FZG C;  2Z4E C;  1LTJ C;  1RF1 B;  2JHH C;  1Z3U A;  2J3G A;  2J60 A;  1N73 B;  4M7H A;  4EPU A;  1FZC C;  1LT9 C;  1RF0 B;  2HOD C;  3BVH B;  1N86 C;  2Z4E B;  1FZF B;  2OYI C;  1FZE C;  4M7F A;  2J61 B;  2J0G A;  1FID A;  1FZF C;  1FZC B;  2J0Y A;  3H32 C;  1LT9 B;  2HOD B;  1FIB A;  1N86 B;  2J3U A;  2JHK F;  3GHG B;  2OYI B;  2J3O A;  1FZE B;  1Z3S A;  2J61 A;  3E1I C;  2OYH B;  1FZB C;  2D39 A;  2JHL F;  3GHG C;  1LWU C;  3H32 B;  2HPC B;  2OYH C;  2J5Z A;  2JHI F;  2J2P A;  2JHM F;  2J3F A;  3E1I B;  2HPC C;  2GY7 A;  1FZB B;  2J3F D;  1LWU B;  2H43 B;  1FIC A;  1JC9 A;  1FZA B;  2XNX C;  3HUS B;  2J64 A;  2FIB A;  2H43 C;  4ZFG A;  1FZA C;  2J0H A;  2Q9I C;  3HUS C;  1RE3 C;  3FIB A;  1RF1 C; 
#chains in the Genus database with same CATH homology
 4NYT A;  2XNX B;  1RE4 B;  2WNP F;  2HLO B;  2FFD B;  1M1J B;  4JYO X;  1FZG B;  1LTJ B;  1N73 C;  4JZC A;  1FZD A;  2J1G A;  1RE4 C;  2Q9I B;  1RE3 B;  2FFD C;  2HLO C;  4R9T A;  1M1J C;  1RF0 C;  3BVH C;  4R9J A;  1FZG C;  2Z4E C;  1LTJ C;  1RF1 B;  2JHH C;  1Z3U A;  2J3G A;  2J60 A;  1N73 B;  4M7H A;  4EPU A;  1FZC C;  1LT9 C;  1RF0 B;  2HOD C;  3BVH B;  1N86 C;  2Z4E B;  1FZF B;  2OYI C;  1FZE C;  4M7F A;  2J61 B;  2J0G A;  1FID A;  1FZF C;  1FZC B;  2J0Y A;  3H32 C;  1LT9 B;  2HOD B;  1FIB A;  1N86 B;  2J3U A;  2JHK F;  2OYI B;  2J3O A;  1FZE B;  1Z3S A;  2J61 A;  3E1I C;  2OYH B;  1FZB C;  2D39 A;  2JHL F;  3GHG C;  1LWU C;  3H32 B;  2HPC B;  2OYH C;  2J5Z A;  2JHI F;  2J2P A;  2JHM F;  2J3F A;  3E1I B;  2HPC C;  2GY7 A;  1FZB B;  2J3F D;  1LWU B;  2H43 B;  1FIC A;  1JC9 A;  1FZA B;  2XNX C;  3HUS B;  2J64 A;  2FIB A;  2H43 C;  4ZFG A;  1FZA C;  2J0H A;  2Q9I C;  3HUS C;  1RE3 C;  3FIB A;  1RF1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...