1FICA

Structure of human gamma fibrinogen 30 kd carboxyl terminal fragment
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
260
structure length
260
Chain Sequence
QIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEGQQHHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood coagulation factor
molecule keywords GAMMA FIBRINOGEN
publication title Crystal structure of a 30 kDa C-terminal fragment from the gamma chain of human fibrinogen.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ficA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ficA02
1Z3UA 1FZBB 1FIBA 2J3OA 2JHMF 1M1JB 2JHHC 3E1IB 2D39A 1FZBC 1LT9B 2J1GA 4NYTA 1RE4B 1M1JC 2J0YA 2J3GA 3E1IC 2Z4EB 2J0GA 1LT9C 2FFDB 2J61B 3HUSB 4M7HA 2Z4EC 2FFDC 3HUSC 4JYOX 1RF0B 2H43B 1FIDA 2J60A 1N73B 1RF0C 2Q9IC 2H43C 2OYIB 2JHLF 2HPCB 4ZFGA 2OYIC 2HPCC 1FZEB 1FZAB 2JHIF 1RF1B 1Z3SA 3GHGC 1RE4C 1FZEC 1FZAC 2OYHB 1RF1C 2J0HA 2J61A 2HODB 4R9JA 1FZFB 3H32B 2HLOB 2HODC 1FZFC 1JC9A 3H32C 1LTJB 3FIBA 2HLOC 1FZCB 3BVHB 1N73C 2J3FA 1LWUB 1FZCC 1FZDA 4EPUA 1RE3B 1FZGB 1N86B 4JZCA 2OYHC 2J3UA 1FZGC 1N86C 2WNPF 4M7FA 2GY7A 1LTJC 2J5ZA 3BVHC 4R9TA 1LWUC 2XNXB 2J2PA 2XNXC 1FICA 2J64A 2FIBA 2JHKF 2Q9IB 2J3FD 1RE3C
chains in the Genus database with same CATH superfamily
1Z3UA 1FZBB 1FIBA 2J3OA 2JHMF 1M1JB 2JHHC 3E1IB 2D39A 1FZBC 1LT9B 2J1GA 4NYTA 1RE4B 1M1JC 2J0YA 2J3GA 3E1IC 2Z4EB 2J0GA 1LT9C 2FFDB 2J61B 3HUSB 4M7HA 2Z4EC 2FFDC 3HUSC 4JYOX 1RF0B 2H43B 1FIDA 2J60A 1N73B 1RF0C 2Q9IC 2H43C 2OYIB 2JHLF 2HPCB 4ZFGA 2OYIC 2HPCC 3GHGB 1FZEB 1FZAB 2JHIF 1RF1B 1Z3SA 3GHGC 1RE4C 1FZEC 1FZAC 2OYHB 1RF1C 2J0HA 2J61A 2HODB 4R9JA 1FZFB 3H32B 2HLOB 2HODC 1FZFC 1JC9A 3H32C 1LTJB 3FIBA 2HLOC 1FZCB 3BVHB 1N73C 2J3FA 1LWUB 1FZCC 1FZDA 4EPUA 1RE3B 1FZGB 1N86B 4JZCA 2OYHC 2J3UA 1FZGC 1N86C 2WNPF 4M7FA 2GY7A 1LTJC 2J5ZA 3BVHC 4R9TA 1LWUC 2XNXB 2J2PA 2XNXC 1FICA 2J64A 2FIBA 2JHKF 2Q9IB 2J3FD 1RE3C
chains in the Genus database with same CATH topology
1Z3UA 1FZBB 1FIBA 2J3OA 2JHMF 1M1JB 2JHHC 3E1IB 2D39A 1FZBC 1LT9B 2J1GA 4NYTA 1RE4B 1M1JC 2J0YA 2J3GA 3E1IC 2Z4EB 2J0GA 1LT9C 2FFDB 2J61B 3HUSB 4M7HA 2Z4EC 2FFDC 3HUSC 4JYOX 1RF0B 2H43B 1FIDA 2J60A 1N73B 1RF0C 2Q9IC 2H43C 2OYIB 2JHLF 2HPCB 4ZFGA 2OYIC 2HPCC 1FZEB 1FZAB 2JHIF 1RF1B 1Z3SA 3GHGC 1RE4C 1FZEC 1FZAC 2OYHB 1RF1C 2J0HA 2J61A 2HODB 4R9JA 1FZFB 3H32B 2HLOB 2HODC 1FZFC 1JC9A 3H32C 1LTJB 3FIBA 2HLOC 1FZCB 3BVHB 1N73C 2J3FA 1LWUB 1FZCC 1FZDA 4EPUA 1RE3B 1FZGB 1N86B 4JZCA 2OYHC 2J3UA 1FZGC 1N86C 2WNPF 4M7FA 2GY7A 1LTJC 2J5ZA 3BVHC 4R9TA 1LWUC 2XNXB 2J2PA 2XNXC 1FICA 2J64A 2FIBA 2JHKF 2Q9IB 2J3FD 1RE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3U A;  1FZB B;  1FIB A;  2J3O A;  2JHM F;  1M1J B;  2JHH C;  3E1I B;  2D39 A;  1FZB C;  1LT9 B;  2J1G A;  4NYT A;  1RE4 B;  1M1J C;  2J0Y A;  2J3G A;  3E1I C;  2Z4E B;  2J0G A;  1LT9 C;  2FFD B;  2J61 B;  3HUS B;  4M7H A;  2Z4E C;  2FFD C;  3HUS C;  4JYO X;  1RF0 B;  2H43 B;  1FID A;  2J60 A;  1N73 B;  1RF0 C;  2Q9I C;  2H43 C;  2OYI B;  2JHL F;  2HPC B;  4ZFG A;  2OYI C;  2HPC C;  1FZE B;  1FZA B;  2JHI F;  1RF1 B;  1Z3S A;  3GHG C;  1RE4 C;  1FZE C;  1FZA C;  2OYH B;  1RF1 C;  2J0H A;  2J61 A;  2HOD B;  4R9J A;  1FZF B;  3H32 B;  2HLO B;  2HOD C;  1FZF C;  1JC9 A;  3H32 C;  1LTJ B;  3FIB A;  2HLO C;  1FZC B;  3BVH B;  1N73 C;  2J3F A;  1LWU B;  1FZC C;  1FZD A;  4EPU A;  1RE3 B;  1FZG B;  1N86 B;  4JZC A;  2OYH C;  2J3U A;  1FZG C;  1N86 C;  2WNP F;  4M7F A;  2GY7 A;  1LTJ C;  2J5Z A;  3BVH C;  4R9T A;  1LWU C;  2XNX B;  2J2P A;  2XNX C;  1FIC A;  2J64 A;  2FIB A;  2JHK F;  2Q9I B;  2J3F D;  1RE3 C; 
#chains in the Genus database with same CATH topology
 1Z3U A;  1FZB B;  1FIB A;  2J3O A;  2JHM F;  1M1J B;  2JHH C;  3E1I B;  2D39 A;  1FZB C;  1LT9 B;  2J1G A;  4NYT A;  1RE4 B;  1M1J C;  2J0Y A;  2J3G A;  3E1I C;  2Z4E B;  2J0G A;  1LT9 C;  2FFD B;  2J61 B;  3HUS B;  4M7H A;  2Z4E C;  2FFD C;  3HUS C;  4JYO X;  1RF0 B;  2H43 B;  1FID A;  2J60 A;  1N73 B;  1RF0 C;  2Q9I C;  2H43 C;  2OYI B;  2JHL F;  2HPC B;  4ZFG A;  2OYI C;  2HPC C;  3GHG B;  1FZE B;  1FZA B;  2JHI F;  1RF1 B;  1Z3S A;  3GHG C;  1RE4 C;  1FZE C;  1FZA C;  2OYH B;  1RF1 C;  2J0H A;  2J61 A;  2HOD B;  4R9J A;  1FZF B;  3H32 B;  2HLO B;  2HOD C;  1FZF C;  1JC9 A;  3H32 C;  1LTJ B;  3FIB A;  2HLO C;  1FZC B;  3BVH B;  1N73 C;  2J3F A;  1LWU B;  1FZC C;  1FZD A;  4EPU A;  1RE3 B;  1FZG B;  1N86 B;  4JZC A;  2OYH C;  2J3U A;  1FZG C;  1N86 C;  2WNP F;  4M7F A;  2GY7 A;  1LTJ C;  2J5Z A;  3BVH C;  4R9T A;  1LWU C;  2XNX B;  2J2P A;  2XNX C;  1FIC A;  2J64 A;  2FIB A;  2JHK F;  2Q9I B;  2J3F D;  1RE3 C; 
#chains in the Genus database with same CATH homology
 1Z3U A;  1FZB B;  1FIB A;  2J3O A;  2JHM F;  1M1J B;  2JHH C;  3E1I B;  2D39 A;  1FZB C;  1LT9 B;  2J1G A;  4NYT A;  1RE4 B;  1M1J C;  2J0Y A;  2J3G A;  3E1I C;  2Z4E B;  2J0G A;  1LT9 C;  2FFD B;  2J61 B;  3HUS B;  4M7H A;  2Z4E C;  2FFD C;  3HUS C;  4JYO X;  1RF0 B;  2H43 B;  1FID A;  2J60 A;  1N73 B;  1RF0 C;  2Q9I C;  2H43 C;  2OYI B;  2JHL F;  2HPC B;  4ZFG A;  2OYI C;  2HPC C;  1FZE B;  1FZA B;  2JHI F;  1RF1 B;  1Z3S A;  3GHG C;  1RE4 C;  1FZE C;  1FZA C;  2OYH B;  1RF1 C;  2J0H A;  2J61 A;  2HOD B;  4R9J A;  1FZF B;  3H32 B;  2HLO B;  2HOD C;  1FZF C;  1JC9 A;  3H32 C;  1LTJ B;  3FIB A;  2HLO C;  1FZC B;  3BVH B;  1N73 C;  2J3F A;  1LWU B;  1FZC C;  1FZD A;  4EPU A;  1RE3 B;  1FZG B;  1N86 B;  4JZC A;  2OYH C;  2J3U A;  1FZG C;  1N86 C;  2WNP F;  4M7F A;  2GY7 A;  1LTJ C;  2J5Z A;  3BVH C;  4R9T A;  1LWU C;  2XNX B;  2J2P A;  2XNX C;  1FIC A;  2J64 A;  2FIB A;  2JHK F;  2Q9I B;  2J3F D;  1RE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...