3BVHC

Crystal structure of recombinant gammad364a fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
293
structure length
293
Chain Sequence
THDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYANGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Polymerization-defective fibrinogen variant gammaD364A binds knob "A" peptide mimic.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 88
structure length 293
sequence length 293
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3bvhC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3bvhC02
1RF0C 2J0YA 1RF1C 2WNPF 3FIBA 1JC9A 2OYIC 1LT9C 1FIBA 1N86C 1M1JC 2Q9IC 2HPCB 2D39A 1RF0B 1RF1B 4NYTA 2XNXC 3E1IC 3GHGC 2J64A 2OYHC 2HODC 2OYIB 1LT9B 2JHMF 1N86B 1M1JB 1N73C 2Q9IB 1FZAC 3H32C 3BVHC 1FZGC 2GY7A 1LWUC 2XNXB 2J60A 3E1IB 2Z4EC 3HUSC 4ZFGA 2OYHB 2HODB 1FZBC 2J0HA 2JHIF 1RE3C 4M7FA 1N73B 2H43C 2HLOC 2J2PA 1FZAB 3H32B 1FZFC 1FICA 3BVHB 1FZGB 2J3FD 4JYOX 1FZCC 4R9JA 1LWUB 2Z4EB 3HUSB 1RE4C 2FIBA 1FZDA 1FZBB 2FFDC 1RE3B 1Z3UA 4R9TA 2H43B 2HLOB 2J5ZA 4M7HA 1FZFB 1FZEC 1FZCB 1FIDA 1RE4B 2J0GA 2J3UA 2J1GA 2FFDB 2J61A 1LTJC 2JHHC 2J61B 2JHKF 4EPUA 1FZEB 2J3OA 2J3FA 4JZCA 2J3GA 2HPCC 2JHLF 1Z3SA 1LTJB
chains in the Genus database with same CATH superfamily
1RF0C 2J0YA 1RF1C 2WNPF 3FIBA 1JC9A 2OYIC 1LT9C 1FIBA 1N86C 1M1JC 2Q9IC 2HPCB 2D39A 1RF0B 1RF1B 4NYTA 2XNXC 3E1IC 3GHGC 2J64A 2OYHC 2HODC 2OYIB 1LT9B 2JHMF 1N86B 1M1JB 1N73C 2Q9IB 1FZAC 3H32C 3BVHC 1FZGC 2GY7A 1LWUC 2XNXB 2J60A 3E1IB 2Z4EC 3HUSC 3GHGB 4ZFGA 2OYHB 2HODB 1FZBC 2J0HA 2JHIF 1RE3C 4M7FA 1N73B 2H43C 2HLOC 2J2PA 1FZAB 3H32B 1FZFC 1FICA 3BVHB 1FZGB 2J3FD 4JYOX 1FZCC 4R9JA 1LWUB 2Z4EB 3HUSB 1RE4C 2FIBA 1FZDA 1FZBB 2FFDC 1RE3B 1Z3UA 4R9TA 2H43B 2HLOB 2J5ZA 4M7HA 1FZFB 1FZEC 1FZCB 1FIDA 1RE4B 2J0GA 2J3UA 2J1GA 2FFDB 2J61A 1LTJC 2JHHC 2J61B 2JHKF 4EPUA 1FZEB 2J3OA 2J3FA 4JZCA 2J3GA 2HPCC 2JHLF 1Z3SA 1LTJB
chains in the Genus database with same CATH topology
1RF0C 2J0YA 1RF1C 2WNPF 3FIBA 1JC9A 2OYIC 1LT9C 1FIBA 1N86C 1M1JC 2Q9IC 2HPCB 2D39A 1RF0B 1RF1B 4NYTA 2XNXC 3E1IC 3GHGC 2J64A 2OYHC 2HODC 2OYIB 1LT9B 2JHMF 1N86B 1M1JB 1N73C 2Q9IB 1FZAC 3H32C 3BVHC 1FZGC 2GY7A 1LWUC 2XNXB 2J60A 3E1IB 2Z4EC 3HUSC 4ZFGA 2OYHB 2HODB 1FZBC 2J0HA 2JHIF 1RE3C 4M7FA 1N73B 2H43C 2HLOC 2J2PA 1FZAB 3H32B 1FZFC 1FICA 3BVHB 1FZGB 2J3FD 4JYOX 1FZCC 4R9JA 1LWUB 2Z4EB 3HUSB 1RE4C 2FIBA 1FZDA 1FZBB 2FFDC 1RE3B 1Z3UA 4R9TA 2H43B 2HLOB 2J5ZA 4M7HA 1FZFB 1FZEC 1FZCB 1FIDA 1RE4B 2J0GA 2J3UA 2J1GA 2FFDB 2J61A 1LTJC 2JHHC 2J61B 2JHKF 4EPUA 1FZEB 2J3OA 2J3FA 4JZCA 2J3GA 2HPCC 2JHLF 1Z3SA 1LTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 C;  2J0Y A;  1RF1 C;  2WNP F;  3FIB A;  1JC9 A;  2OYI C;  1LT9 C;  1FIB A;  1N86 C;  1M1J C;  2Q9I C;  2HPC B;  2D39 A;  1RF0 B;  1RF1 B;  4NYT A;  2XNX C;  3E1I C;  3GHG C;  2J64 A;  2OYH C;  2HOD C;  2OYI B;  1LT9 B;  2JHM F;  1N86 B;  1M1J B;  1N73 C;  2Q9I B;  1FZA C;  3H32 C;  3BVH C;  1FZG C;  2GY7 A;  1LWU C;  2XNX B;  2J60 A;  3E1I B;  2Z4E C;  3HUS C;  4ZFG A;  2OYH B;  2HOD B;  1FZB C;  2J0H A;  2JHI F;  1RE3 C;  4M7F A;  1N73 B;  2H43 C;  2HLO C;  2J2P A;  1FZA B;  3H32 B;  1FZF C;  1FIC A;  3BVH B;  1FZG B;  2J3F D;  4JYO X;  1FZC C;  4R9J A;  1LWU B;  2Z4E B;  3HUS B;  1RE4 C;  2FIB A;  1FZD A;  1FZB B;  2FFD C;  1RE3 B;  1Z3U A;  4R9T A;  2H43 B;  2HLO B;  2J5Z A;  4M7H A;  1FZF B;  1FZE C;  1FZC B;  1FID A;  1RE4 B;  2J0G A;  2J3U A;  2J1G A;  2FFD B;  2J61 A;  1LTJ C;  2JHH C;  2J61 B;  2JHK F;  4EPU A;  1FZE B;  2J3O A;  2J3F A;  4JZC A;  2J3G A;  2HPC C;  2JHL F;  1Z3S A;  1LTJ B; 
#chains in the Genus database with same CATH topology
 1RF0 C;  2J0Y A;  1RF1 C;  2WNP F;  3FIB A;  1JC9 A;  2OYI C;  1LT9 C;  1FIB A;  1N86 C;  1M1J C;  2Q9I C;  2HPC B;  2D39 A;  1RF0 B;  1RF1 B;  4NYT A;  2XNX C;  3E1I C;  3GHG C;  2J64 A;  2OYH C;  2HOD C;  2OYI B;  1LT9 B;  2JHM F;  1N86 B;  1M1J B;  1N73 C;  2Q9I B;  1FZA C;  3H32 C;  3BVH C;  1FZG C;  2GY7 A;  1LWU C;  2XNX B;  2J60 A;  3E1I B;  2Z4E C;  3HUS C;  3GHG B;  4ZFG A;  2OYH B;  2HOD B;  1FZB C;  2J0H A;  2JHI F;  1RE3 C;  4M7F A;  1N73 B;  2H43 C;  2HLO C;  2J2P A;  1FZA B;  3H32 B;  1FZF C;  1FIC A;  3BVH B;  1FZG B;  2J3F D;  4JYO X;  1FZC C;  4R9J A;  1LWU B;  2Z4E B;  3HUS B;  1RE4 C;  2FIB A;  1FZD A;  1FZB B;  2FFD C;  1RE3 B;  1Z3U A;  4R9T A;  2H43 B;  2HLO B;  2J5Z A;  4M7H A;  1FZF B;  1FZE C;  1FZC B;  1FID A;  1RE4 B;  2J0G A;  2J3U A;  2J1G A;  2FFD B;  2J61 A;  1LTJ C;  2JHH C;  2J61 B;  2JHK F;  4EPU A;  1FZE B;  2J3O A;  2J3F A;  4JZC A;  2J3G A;  2HPC C;  2JHL F;  1Z3S A;  1LTJ B; 
#chains in the Genus database with same CATH homology
 1RF0 C;  2J0Y A;  1RF1 C;  2WNP F;  3FIB A;  1JC9 A;  2OYI C;  1LT9 C;  1FIB A;  1N86 C;  1M1J C;  2Q9I C;  2HPC B;  2D39 A;  1RF0 B;  1RF1 B;  4NYT A;  2XNX C;  3E1I C;  3GHG C;  2J64 A;  2OYH C;  2HOD C;  2OYI B;  1LT9 B;  2JHM F;  1N86 B;  1M1J B;  1N73 C;  2Q9I B;  1FZA C;  3H32 C;  3BVH C;  1FZG C;  2GY7 A;  1LWU C;  2XNX B;  2J60 A;  3E1I B;  2Z4E C;  3HUS C;  4ZFG A;  2OYH B;  2HOD B;  1FZB C;  2J0H A;  2JHI F;  1RE3 C;  4M7F A;  1N73 B;  2H43 C;  2HLO C;  2J2P A;  1FZA B;  3H32 B;  1FZF C;  1FIC A;  3BVH B;  1FZG B;  2J3F D;  4JYO X;  1FZC C;  4R9J A;  1LWU B;  2Z4E B;  3HUS B;  1RE4 C;  2FIB A;  1FZD A;  1FZB B;  2FFD C;  1RE3 B;  1Z3U A;  4R9T A;  2H43 B;  2HLO B;  2J5Z A;  4M7H A;  1FZF B;  1FZE C;  1FZC B;  1FID A;  1RE4 B;  2J0G A;  2J3U A;  2J1G A;  2FFD B;  2J61 A;  1LTJ C;  2JHH C;  2J61 B;  2JHK F;  4EPU A;  1FZE B;  2J3O A;  2J3F A;  4JZC A;  2J3G A;  2HPC C;  2JHL F;  1Z3S A;  1LTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...