2XNXB

Bc1 fragment of streptococcal m1 protein in complex with human fibrinogen
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
312
structure length
312
Chain Sequence
HQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN ALPHA CHAIN
publication title Streptococcal M1 Protein Constructs a Pathological Host Fibrinogen Network
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 72
structure length 312
sequence length 312
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2xnxB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2xnxB02
2JHHC 2J3FA 1LTJB 1FZEC 1RF0B 2HPCB 4M7FA 3GHGC 3HUSB 2J61A 4JYOX 1RF0C 2J2PA 2HPCC 1FZAC 2J1GA 2J3UA 3HUSC 3BVHC 1RE4B 2FIBA 3E1IB 2OYHC 2HODB 2JHLF 1M1JC 1RE3C 1RE4C 3E1IC 1FICA 2HODC 1Z3UA 2XNXC 2JHKF 4R9TA 1FIBA 1LTJC 4R9JA 2Z4EB 2OYIB 1FZGB 2J60A 2Z4EC 2J64A 1FZGC 1RF1B 2H43B 2GY7A 2WNPF 1FZBB 1Z3SA 4M7HA 2J0HA 1RF1C 1FZCB 2H43C 2JHMF 1FZBC 1FZFB 2FFDB 1FZCC 1JC9A 2D39A 2Q9IB 1LT9B 1LWUB 1FIDA 1FZFC 2FFDC 2JHIF 2J3OA 2Q9IC 2J61B 1FZEB 1FZDA 1LT9C 1LWUC 2OYIC 3H32B 4NYTA 4ZFGA 3FIBA 4EPUA 2HLOB 2J0GA 1FZAB 3H32C 1N86B 3BVHB 2OYHB 2HLOC 1M1JB 1N73B 1N86C 1RE3B 2J3GA 4JZCA 2J3FD 2J5ZA 1N73C 2XNXB 2J0YA
chains in the Genus database with same CATH superfamily
2JHHC 2J3FA 1LTJB 1FZEC 1RF0B 2HPCB 4M7FA 3GHGC 3HUSB 2J61A 4JYOX 1RF0C 2J2PA 2HPCC 1FZAC 2J1GA 2J3UA 3HUSC 3BVHC 1RE4B 2FIBA 3E1IB 2OYHC 2HODB 2JHLF 1M1JC 1RE3C 1RE4C 3E1IC 1FICA 2HODC 1Z3UA 2XNXC 2JHKF 4R9TA 1FIBA 1LTJC 4R9JA 2Z4EB 2OYIB 1FZGB 2J60A 2Z4EC 2J64A 1FZGC 1RF1B 2H43B 2GY7A 2WNPF 1FZBB 1Z3SA 4M7HA 2J0HA 1RF1C 1FZCB 2H43C 2JHMF 1FZBC 1FZFB 2FFDB 1FZCC 1JC9A 2D39A 2Q9IB 1LT9B 1LWUB 1FIDA 1FZFC 2FFDC 2JHIF 2J3OA 2Q9IC 2J61B 1FZEB 1FZDA 1LT9C 1LWUC 2OYIC 3H32B 3GHGB 4NYTA 4ZFGA 3FIBA 4EPUA 2HLOB 2J0GA 1FZAB 3H32C 1N86B 3BVHB 2OYHB 2HLOC 1M1JB 1N73B 1N86C 1RE3B 2J3GA 4JZCA 2J3FD 2J5ZA 1N73C 2XNXB 2J0YA
chains in the Genus database with same CATH topology
2JHHC 2J3FA 1LTJB 1FZEC 1RF0B 2HPCB 4M7FA 3GHGC 3HUSB 2J61A 4JYOX 1RF0C 2J2PA 2HPCC 1FZAC 2J1GA 2J3UA 3HUSC 3BVHC 1RE4B 2FIBA 3E1IB 2OYHC 2HODB 2JHLF 1M1JC 1RE3C 1RE4C 3E1IC 1FICA 2HODC 1Z3UA 2XNXC 2JHKF 4R9TA 1FIBA 1LTJC 4R9JA 2Z4EB 2OYIB 1FZGB 2J60A 2Z4EC 2J64A 1FZGC 1RF1B 2H43B 2GY7A 2WNPF 1FZBB 1Z3SA 4M7HA 2J0HA 1RF1C 1FZCB 2H43C 2JHMF 1FZBC 1FZFB 2FFDB 1FZCC 1JC9A 2D39A 2Q9IB 1LT9B 1LWUB 1FIDA 1FZFC 2FFDC 2JHIF 2J3OA 2Q9IC 2J61B 1FZEB 1FZDA 1LT9C 1LWUC 2OYIC 3H32B 4NYTA 4ZFGA 3FIBA 4EPUA 2HLOB 2J0GA 1FZAB 3H32C 1N86B 3BVHB 2OYHB 2HLOC 1M1JB 1N73B 1N86C 1RE3B 2J3GA 4JZCA 2J3FD 2J5ZA 1N73C 2XNXB 2J0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHH C;  2J3F A;  1LTJ B;  1FZE C;  1RF0 B;  2HPC B;  4M7F A;  3GHG C;  3HUS B;  2J61 A;  4JYO X;  1RF0 C;  2J2P A;  2HPC C;  1FZA C;  2J1G A;  2J3U A;  3HUS C;  3BVH C;  1RE4 B;  2FIB A;  3E1I B;  2OYH C;  2HOD B;  2JHL F;  1M1J C;  1RE3 C;  1RE4 C;  3E1I C;  1FIC A;  2HOD C;  1Z3U A;  2XNX C;  2JHK F;  4R9T A;  1FIB A;  1LTJ C;  4R9J A;  2Z4E B;  2OYI B;  1FZG B;  2J60 A;  2Z4E C;  2J64 A;  1FZG C;  1RF1 B;  2H43 B;  2GY7 A;  2WNP F;  1FZB B;  1Z3S A;  4M7H A;  2J0H A;  1RF1 C;  1FZC B;  2H43 C;  2JHM F;  1FZB C;  1FZF B;  2FFD B;  1FZC C;  1JC9 A;  2D39 A;  2Q9I B;  1LT9 B;  1LWU B;  1FID A;  1FZF C;  2FFD C;  2JHI F;  2J3O A;  2Q9I C;  2J61 B;  1FZE B;  1FZD A;  1LT9 C;  1LWU C;  2OYI C;  3H32 B;  4NYT A;  4ZFG A;  3FIB A;  4EPU A;  2HLO B;  2J0G A;  1FZA B;  3H32 C;  1N86 B;  3BVH B;  2OYH B;  2HLO C;  1M1J B;  1N73 B;  1N86 C;  1RE3 B;  2J3G A;  4JZC A;  2J3F D;  2J5Z A;  1N73 C;  2XNX B;  2J0Y A; 
#chains in the Genus database with same CATH topology
 2JHH C;  2J3F A;  1LTJ B;  1FZE C;  1RF0 B;  2HPC B;  4M7F A;  3GHG C;  3HUS B;  2J61 A;  4JYO X;  1RF0 C;  2J2P A;  2HPC C;  1FZA C;  2J1G A;  2J3U A;  3HUS C;  3BVH C;  1RE4 B;  2FIB A;  3E1I B;  2OYH C;  2HOD B;  2JHL F;  1M1J C;  1RE3 C;  1RE4 C;  3E1I C;  1FIC A;  2HOD C;  1Z3U A;  2XNX C;  2JHK F;  4R9T A;  1FIB A;  1LTJ C;  4R9J A;  2Z4E B;  2OYI B;  1FZG B;  2J60 A;  2Z4E C;  2J64 A;  1FZG C;  1RF1 B;  2H43 B;  2GY7 A;  2WNP F;  1FZB B;  1Z3S A;  4M7H A;  2J0H A;  1RF1 C;  1FZC B;  2H43 C;  2JHM F;  1FZB C;  1FZF B;  2FFD B;  1FZC C;  1JC9 A;  2D39 A;  2Q9I B;  1LT9 B;  1LWU B;  1FID A;  1FZF C;  2FFD C;  2JHI F;  2J3O A;  2Q9I C;  2J61 B;  1FZE B;  1FZD A;  1LT9 C;  1LWU C;  2OYI C;  3H32 B;  3GHG B;  4NYT A;  4ZFG A;  3FIB A;  4EPU A;  2HLO B;  2J0G A;  1FZA B;  3H32 C;  1N86 B;  3BVH B;  2OYH B;  2HLO C;  1M1J B;  1N73 B;  1N86 C;  1RE3 B;  2J3G A;  4JZC A;  2J3F D;  2J5Z A;  1N73 C;  2XNX B;  2J0Y A; 
#chains in the Genus database with same CATH homology
 2JHH C;  2J3F A;  1LTJ B;  1FZE C;  1RF0 B;  2HPC B;  4M7F A;  3GHG C;  3HUS B;  2J61 A;  4JYO X;  1RF0 C;  2J2P A;  2HPC C;  1FZA C;  2J1G A;  2J3U A;  3HUS C;  3BVH C;  1RE4 B;  2FIB A;  3E1I B;  2OYH C;  2HOD B;  2JHL F;  1M1J C;  1RE3 C;  1RE4 C;  3E1I C;  1FIC A;  2HOD C;  1Z3U A;  2XNX C;  2JHK F;  4R9T A;  1FIB A;  1LTJ C;  4R9J A;  2Z4E B;  2OYI B;  1FZG B;  2J60 A;  2Z4E C;  2J64 A;  1FZG C;  1RF1 B;  2H43 B;  2GY7 A;  2WNP F;  1FZB B;  1Z3S A;  4M7H A;  2J0H A;  1RF1 C;  1FZC B;  2H43 C;  2JHM F;  1FZB C;  1FZF B;  2FFD B;  1FZC C;  1JC9 A;  2D39 A;  2Q9I B;  1LT9 B;  1LWU B;  1FID A;  1FZF C;  2FFD C;  2JHI F;  2J3O A;  2Q9I C;  2J61 B;  1FZE B;  1FZD A;  1LT9 C;  1LWU C;  2OYI C;  3H32 B;  4NYT A;  4ZFG A;  3FIB A;  4EPU A;  2HLO B;  2J0G A;  1FZA B;  3H32 C;  1N86 B;  3BVH B;  2OYH B;  2HLO C;  1M1J B;  1N73 B;  1N86 C;  1RE3 B;  2J3G A;  4JZC A;  2J3F D;  2J5Z A;  1N73 C;  2XNX B;  2J0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...