3E1IC

Crystal structure of bbetad432a variant fibrinogen fragment d with the peptide ligand gly-his-arg-pro-amide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
288
structure length
288
Chain Sequence
SSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Fibrinogen variant BbetaD432A has normal polymerization but does not bind knob "B".
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 288
sequence length 288
chains with identical sequence F
ec nomenclature
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3e1iC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3e1iC02
1M1JB 1RF0C 2GY7A 1FZGC 4ZFGA 4R9JA 2J0YA 2WNPF 2J3OA 2OYHC 2JHMF 1RF0B 2J3FD 2Z4EC 1FZCC 2J61A 2HLOC 1FZGB 2JHIF 4EPUA 2HPCC 1N73C 1RE3C 1JC9A 2OYHB 2Z4EB 2FFDC 1FZCB 2J0GA 2J60A 2HLOB 1FZDA 4JZCA 3E1IC 1LT9C 2HPCB 1N73B 2JHKF 2JHHC 2J0HA 1RE3B 2J64A 1N86C 2XNXC 2J2PA 2FFDB 1Z3UA 1FICA 2D39A 4R9TA 3E1IB 1LT9B 2H43C 1RE4C 2J5ZA 1N86B 2XNXB 4NYTA 1FZFC 1FIBA 1Z3SA 3HUSC 2J1GA 2Q9IC 3H32C 1FZAC 2FIBA 3GHGC 4M7HA 1RF1C 2J3UA 2H43B 2J61B 1RE4B 2HODC 1FZEC 1LWUC 1FZFB 3HUSB 2J3FA 3BVHC 2Q9IB 3H32B 1FZAB 1LTJC 1RF1B 2J3GA 1FZBC 2JHLF 2HODB 2OYIC 1FZEB 3FIBA 1LWUB 4M7FA 4JYOX 3BVHB 1M1JC 1LTJB 1FZBB 2OYIB 1FIDA
chains in the Genus database with same CATH superfamily
1M1JB 1RF0C 2GY7A 1FZGC 4ZFGA 4R9JA 2J0YA 2WNPF 2J3OA 2OYHC 2JHMF 1RF0B 2J3FD 2Z4EC 1FZCC 2J61A 2HLOC 1FZGB 2JHIF 4EPUA 2HPCC 1N73C 1RE3C 1JC9A 2OYHB 2Z4EB 2FFDC 1FZCB 2J0GA 2J60A 2HLOB 1FZDA 4JZCA 3E1IC 1LT9C 2HPCB 1N73B 2JHKF 2JHHC 2J0HA 1RE3B 2J64A 1N86C 2XNXC 2J2PA 2FFDB 1Z3UA 1FICA 2D39A 4R9TA 3E1IB 1LT9B 2H43C 1RE4C 2J5ZA 1N86B 2XNXB 4NYTA 1FZFC 1FIBA 1Z3SA 3HUSC 2J1GA 2Q9IC 3H32C 1FZAC 2FIBA 3GHGC 4M7HA 1RF1C 2J3UA 2H43B 2J61B 1RE4B 2HODC 1FZEC 1LWUC 1FZFB 3HUSB 2J3FA 3BVHC 2Q9IB 3H32B 1FZAB 1LTJC 3GHGB 1RF1B 2J3GA 1FZBC 2JHLF 2HODB 2OYIC 1FZEB 3FIBA 1LWUB 4M7FA 4JYOX 3BVHB 1M1JC 1LTJB 1FZBB 2OYIB 1FIDA
chains in the Genus database with same CATH topology
1M1JB 1RF0C 2GY7A 1FZGC 4ZFGA 4R9JA 2J0YA 2WNPF 2J3OA 2OYHC 2JHMF 1RF0B 2J3FD 2Z4EC 1FZCC 2J61A 2HLOC 1FZGB 2JHIF 4EPUA 2HPCC 1N73C 1RE3C 1JC9A 2OYHB 2Z4EB 2FFDC 1FZCB 2J0GA 2J60A 2HLOB 1FZDA 4JZCA 3E1IC 1LT9C 2HPCB 1N73B 2JHKF 2JHHC 2J0HA 1RE3B 2J64A 1N86C 2XNXC 2J2PA 2FFDB 1Z3UA 1FICA 2D39A 4R9TA 3E1IB 1LT9B 2H43C 1RE4C 2J5ZA 1N86B 2XNXB 4NYTA 1FZFC 1FIBA 1Z3SA 3HUSC 2J1GA 2Q9IC 3H32C 1FZAC 2FIBA 3GHGC 4M7HA 1RF1C 2J3UA 2H43B 2J61B 1RE4B 2HODC 1FZEC 1LWUC 1FZFB 3HUSB 2J3FA 3BVHC 2Q9IB 3H32B 1FZAB 1LTJC 1RF1B 2J3GA 1FZBC 2JHLF 2HODB 2OYIC 1FZEB 3FIBA 1LWUB 4M7FA 4JYOX 3BVHB 1M1JC 1LTJB 1FZBB 2OYIB 1FIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J B;  1RF0 C;  2GY7 A;  1FZG C;  4ZFG A;  4R9J A;  2J0Y A;  2WNP F;  2J3O A;  2OYH C;  2JHM F;  1RF0 B;  2J3F D;  2Z4E C;  1FZC C;  2J61 A;  2HLO C;  1FZG B;  2JHI F;  4EPU A;  2HPC C;  1N73 C;  1RE3 C;  1JC9 A;  2OYH B;  2Z4E B;  2FFD C;  1FZC B;  2J0G A;  2J60 A;  2HLO B;  1FZD A;  4JZC A;  3E1I C;  1LT9 C;  2HPC B;  1N73 B;  2JHK F;  2JHH C;  2J0H A;  1RE3 B;  2J64 A;  1N86 C;  2XNX C;  2J2P A;  2FFD B;  1Z3U A;  1FIC A;  2D39 A;  4R9T A;  3E1I B;  1LT9 B;  2H43 C;  1RE4 C;  2J5Z A;  1N86 B;  2XNX B;  4NYT A;  1FZF C;  1FIB A;  1Z3S A;  3HUS C;  2J1G A;  2Q9I C;  3H32 C;  1FZA C;  2FIB A;  3GHG C;  4M7H A;  1RF1 C;  2J3U A;  2H43 B;  2J61 B;  1RE4 B;  2HOD C;  1FZE C;  1LWU C;  1FZF B;  3HUS B;  2J3F A;  3BVH C;  2Q9I B;  3H32 B;  1FZA B;  1LTJ C;  1RF1 B;  2J3G A;  1FZB C;  2JHL F;  2HOD B;  2OYI C;  1FZE B;  3FIB A;  1LWU B;  4M7F A;  4JYO X;  3BVH B;  1M1J C;  1LTJ B;  1FZB B;  2OYI B;  1FID A; 
#chains in the Genus database with same CATH topology
 1M1J B;  1RF0 C;  2GY7 A;  1FZG C;  4ZFG A;  4R9J A;  2J0Y A;  2WNP F;  2J3O A;  2OYH C;  2JHM F;  1RF0 B;  2J3F D;  2Z4E C;  1FZC C;  2J61 A;  2HLO C;  1FZG B;  2JHI F;  4EPU A;  2HPC C;  1N73 C;  1RE3 C;  1JC9 A;  2OYH B;  2Z4E B;  2FFD C;  1FZC B;  2J0G A;  2J60 A;  2HLO B;  1FZD A;  4JZC A;  3E1I C;  1LT9 C;  2HPC B;  1N73 B;  2JHK F;  2JHH C;  2J0H A;  1RE3 B;  2J64 A;  1N86 C;  2XNX C;  2J2P A;  2FFD B;  1Z3U A;  1FIC A;  2D39 A;  4R9T A;  3E1I B;  1LT9 B;  2H43 C;  1RE4 C;  2J5Z A;  1N86 B;  2XNX B;  4NYT A;  1FZF C;  1FIB A;  1Z3S A;  3HUS C;  2J1G A;  2Q9I C;  3H32 C;  1FZA C;  2FIB A;  3GHG C;  4M7H A;  1RF1 C;  2J3U A;  2H43 B;  2J61 B;  1RE4 B;  2HOD C;  1FZE C;  1LWU C;  1FZF B;  3HUS B;  2J3F A;  3BVH C;  2Q9I B;  3H32 B;  1FZA B;  1LTJ C;  3GHG B;  1RF1 B;  2J3G A;  1FZB C;  2JHL F;  2HOD B;  2OYI C;  1FZE B;  3FIB A;  1LWU B;  4M7F A;  4JYO X;  3BVH B;  1M1J C;  1LTJ B;  1FZB B;  2OYI B;  1FID A; 
#chains in the Genus database with same CATH homology
 1M1J B;  1RF0 C;  2GY7 A;  1FZG C;  4ZFG A;  4R9J A;  2J0Y A;  2WNP F;  2J3O A;  2OYH C;  2JHM F;  1RF0 B;  2J3F D;  2Z4E C;  1FZC C;  2J61 A;  2HLO C;  1FZG B;  2JHI F;  4EPU A;  2HPC C;  1N73 C;  1RE3 C;  1JC9 A;  2OYH B;  2Z4E B;  2FFD C;  1FZC B;  2J0G A;  2J60 A;  2HLO B;  1FZD A;  4JZC A;  3E1I C;  1LT9 C;  2HPC B;  1N73 B;  2JHK F;  2JHH C;  2J0H A;  1RE3 B;  2J64 A;  1N86 C;  2XNX C;  2J2P A;  2FFD B;  1Z3U A;  1FIC A;  2D39 A;  4R9T A;  3E1I B;  1LT9 B;  2H43 C;  1RE4 C;  2J5Z A;  1N86 B;  2XNX B;  4NYT A;  1FZF C;  1FIB A;  1Z3S A;  3HUS C;  2J1G A;  2Q9I C;  3H32 C;  1FZA C;  2FIB A;  3GHG C;  4M7H A;  1RF1 C;  2J3U A;  2H43 B;  2J61 B;  1RE4 B;  2HOD C;  1FZE C;  1LWU C;  1FZF B;  3HUS B;  2J3F A;  3BVH C;  2Q9I B;  3H32 B;  1FZA B;  1LTJ C;  1RF1 B;  2J3G A;  1FZB C;  2JHL F;  2HOD B;  2OYI C;  1FZE B;  3FIB A;  1LWU B;  4M7F A;  4JYO X;  3BVH B;  1M1J C;  1LTJ B;  1FZB B;  2OYI B;  1FID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...