1FZEB

Crystal structure of fragment double-d from human fibrin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
309
structure length
309
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN
publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 94
structure length 309
sequence length 309
chains with identical sequence E
ec nomenclature
pdb deposition date 1998-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzeB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzeB02
2J0GA 2D39A 1RE3B 2J3OA 1RF1C 3E1IC 1LT9B 2FIBA 1FIDA 2OYHB 1N86C 2J1GA 4ZFGA 2J3GA 2Q9IC 1M1JB 2XNXB 1LT9C 1RE4B 1N73C 3HUSB 1Z3UA 3FIBA 2J3FA 2OYIB 2HLOC 2JHHC 1FZFB 1FICA 1LTJC 1FZDA 2J3UA 2J3FD 1RE4C 1LWUB 1FZBC 3GHGC 2GY7A 1FZAB 4M7HA 2HODC 4NYTA 4R9JA 4M7FA 2FFDB 1RE3C 1FZEB 2JHIF 2JHLF 2Z4EB 2J61B 3BVHB 2OYHC 2J64A 1FZGB 2WNPF 2H43B 1FIBA 1M1JC 1RF0B 2J61A 2J2PA 2J60A 2XNXC 2HPCB 2J5ZA 2JHMF 4JYOX 3HUSC 2OYIC 3H32B 1FZCB 1FZFC 2JHKF 1LWUC 1RF1B 3H32C 1FZAC 2FFDC 2J0YA 2J0HA 1N86B 4R9TA 1JC9A 2Q9IB 1FZEC 4JZCA 1N73B 2Z4EC 3BVHC 2HLOB 4EPUA 1FZGC 2H43C 1RF0C 2HPCC 1LTJB 1FZBB 1Z3SA 3E1IB 1FZCC 2HODB
chains in the Genus database with same CATH superfamily
2J0GA 2D39A 1RE3B 2J3OA 1RF1C 3E1IC 1LT9B 2FIBA 1FIDA 2OYHB 1N86C 2J1GA 4ZFGA 2J3GA 2Q9IC 1M1JB 2XNXB 1LT9C 1RE4B 1N73C 3HUSB 1Z3UA 3FIBA 2J3FA 2OYIB 2HLOC 2JHHC 1FZFB 1FICA 1LTJC 1FZDA 2J3UA 2J3FD 1RE4C 1LWUB 1FZBC 3GHGC 2GY7A 1FZAB 4M7HA 2HODC 4NYTA 4R9JA 4M7FA 2FFDB 1RE3C 1FZEB 2JHIF 2JHLF 2Z4EB 2J61B 3BVHB 2OYHC 2J64A 1FZGB 2WNPF 2H43B 1FIBA 1M1JC 1RF0B 2J61A 2J2PA 2J60A 2XNXC 2HPCB 2J5ZA 2JHMF 4JYOX 3HUSC 2OYIC 3H32B 1FZCB 1FZFC 2JHKF 1LWUC 1RF1B 3H32C 1FZAC 2FFDC 2J0YA 2J0HA 1N86B 4R9TA 1JC9A 2Q9IB 1FZEC 4JZCA 1N73B 2Z4EC 3BVHC 2HLOB 4EPUA 1FZGC 2H43C 1RF0C 2HPCC 1LTJB 1FZBB 1Z3SA 3GHGB 3E1IB 1FZCC 2HODB
chains in the Genus database with same CATH topology
2J0GA 2D39A 1RE3B 2J3OA 1RF1C 3E1IC 1LT9B 2FIBA 1FIDA 2OYHB 1N86C 2J1GA 4ZFGA 2J3GA 2Q9IC 1M1JB 2XNXB 1LT9C 1RE4B 1N73C 3HUSB 1Z3UA 3FIBA 2J3FA 2OYIB 2HLOC 2JHHC 1FZFB 1FICA 1LTJC 1FZDA 2J3UA 2J3FD 1RE4C 1LWUB 1FZBC 3GHGC 2GY7A 1FZAB 4M7HA 2HODC 4NYTA 4R9JA 4M7FA 2FFDB 1RE3C 1FZEB 2JHIF 2JHLF 2Z4EB 2J61B 3BVHB 2OYHC 2J64A 1FZGB 2WNPF 2H43B 1FIBA 1M1JC 1RF0B 2J61A 2J2PA 2J60A 2XNXC 2HPCB 2J5ZA 2JHMF 4JYOX 3HUSC 2OYIC 3H32B 1FZCB 1FZFC 2JHKF 1LWUC 1RF1B 3H32C 1FZAC 2FFDC 2J0YA 2J0HA 1N86B 4R9TA 1JC9A 2Q9IB 1FZEC 4JZCA 1N73B 2Z4EC 3BVHC 2HLOB 4EPUA 1FZGC 2H43C 1RF0C 2HPCC 1LTJB 1FZBB 1Z3SA 3E1IB 1FZCC 2HODB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0G A;  2D39 A;  1RE3 B;  2J3O A;  1RF1 C;  3E1I C;  1LT9 B;  2FIB A;  1FID A;  2OYH B;  1N86 C;  2J1G A;  4ZFG A;  2J3G A;  2Q9I C;  1M1J B;  2XNX B;  1LT9 C;  1RE4 B;  1N73 C;  3HUS B;  1Z3U A;  3FIB A;  2J3F A;  2OYI B;  2HLO C;  2JHH C;  1FZF B;  1FIC A;  1LTJ C;  1FZD A;  2J3U A;  2J3F D;  1RE4 C;  1LWU B;  1FZB C;  3GHG C;  2GY7 A;  1FZA B;  4M7H A;  2HOD C;  4NYT A;  4R9J A;  4M7F A;  2FFD B;  1RE3 C;  1FZE B;  2JHI F;  2JHL F;  2Z4E B;  2J61 B;  3BVH B;  2OYH C;  2J64 A;  1FZG B;  2WNP F;  2H43 B;  1FIB A;  1M1J C;  1RF0 B;  2J61 A;  2J2P A;  2J60 A;  2XNX C;  2HPC B;  2J5Z A;  2JHM F;  4JYO X;  3HUS C;  2OYI C;  3H32 B;  1FZC B;  1FZF C;  2JHK F;  1LWU C;  1RF1 B;  3H32 C;  1FZA C;  2FFD C;  2J0Y A;  2J0H A;  1N86 B;  4R9T A;  1JC9 A;  2Q9I B;  1FZE C;  4JZC A;  1N73 B;  2Z4E C;  3BVH C;  2HLO B;  4EPU A;  1FZG C;  2H43 C;  1RF0 C;  2HPC C;  1LTJ B;  1FZB B;  1Z3S A;  3E1I B;  1FZC C;  2HOD B; 
#chains in the Genus database with same CATH topology
 2J0G A;  2D39 A;  1RE3 B;  2J3O A;  1RF1 C;  3E1I C;  1LT9 B;  2FIB A;  1FID A;  2OYH B;  1N86 C;  2J1G A;  4ZFG A;  2J3G A;  2Q9I C;  1M1J B;  2XNX B;  1LT9 C;  1RE4 B;  1N73 C;  3HUS B;  1Z3U A;  3FIB A;  2J3F A;  2OYI B;  2HLO C;  2JHH C;  1FZF B;  1FIC A;  1LTJ C;  1FZD A;  2J3U A;  2J3F D;  1RE4 C;  1LWU B;  1FZB C;  3GHG C;  2GY7 A;  1FZA B;  4M7H A;  2HOD C;  4NYT A;  4R9J A;  4M7F A;  2FFD B;  1RE3 C;  1FZE B;  2JHI F;  2JHL F;  2Z4E B;  2J61 B;  3BVH B;  2OYH C;  2J64 A;  1FZG B;  2WNP F;  2H43 B;  1FIB A;  1M1J C;  1RF0 B;  2J61 A;  2J2P A;  2J60 A;  2XNX C;  2HPC B;  2J5Z A;  2JHM F;  4JYO X;  3HUS C;  2OYI C;  3H32 B;  1FZC B;  1FZF C;  2JHK F;  1LWU C;  1RF1 B;  3H32 C;  1FZA C;  2FFD C;  2J0Y A;  2J0H A;  1N86 B;  4R9T A;  1JC9 A;  2Q9I B;  1FZE C;  4JZC A;  1N73 B;  2Z4E C;  3BVH C;  2HLO B;  4EPU A;  1FZG C;  2H43 C;  1RF0 C;  2HPC C;  1LTJ B;  1FZB B;  1Z3S A;  3GHG B;  3E1I B;  1FZC C;  2HOD B; 
#chains in the Genus database with same CATH homology
 2J0G A;  2D39 A;  1RE3 B;  2J3O A;  1RF1 C;  3E1I C;  1LT9 B;  2FIB A;  1FID A;  2OYH B;  1N86 C;  2J1G A;  4ZFG A;  2J3G A;  2Q9I C;  1M1J B;  2XNX B;  1LT9 C;  1RE4 B;  1N73 C;  3HUS B;  1Z3U A;  3FIB A;  2J3F A;  2OYI B;  2HLO C;  2JHH C;  1FZF B;  1FIC A;  1LTJ C;  1FZD A;  2J3U A;  2J3F D;  1RE4 C;  1LWU B;  1FZB C;  3GHG C;  2GY7 A;  1FZA B;  4M7H A;  2HOD C;  4NYT A;  4R9J A;  4M7F A;  2FFD B;  1RE3 C;  1FZE B;  2JHI F;  2JHL F;  2Z4E B;  2J61 B;  3BVH B;  2OYH C;  2J64 A;  1FZG B;  2WNP F;  2H43 B;  1FIB A;  1M1J C;  1RF0 B;  2J61 A;  2J2P A;  2J60 A;  2XNX C;  2HPC B;  2J5Z A;  2JHM F;  4JYO X;  3HUS C;  2OYI C;  3H32 B;  1FZC B;  1FZF C;  2JHK F;  1LWU C;  1RF1 B;  3H32 C;  1FZA C;  2FFD C;  2J0Y A;  2J0H A;  1N86 B;  4R9T A;  1JC9 A;  2Q9I B;  1FZE C;  4JZC A;  1N73 B;  2Z4E C;  3BVH C;  2HLO B;  4EPU A;  1FZG C;  2H43 C;  1RF0 C;  2HPC C;  1LTJ B;  1FZB B;  1Z3S A;  3E1I B;  1FZC C;  2HOD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...