2FFDC

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E Chain
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 83
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2ffdC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2ffdC03
2HPCB 2J5ZA 2A45H 1FZBA 2HODB 1N86C 1RF1C 2H43A 1N73B 1RE3C 1FIDA 1LWUC 1LTJC 4NYTA 3GHGC 1FIBA 2J60A 4M7HA 2FFDA 1M1JB 2Q9IA 2J3FD 1FZFC 1T3UA 1RF0B 2JHKF 3HUSC 1FZCA 2J3GA 1LT9A 2J3OA 4ZFGA 3E1IB 1FZEC 2J61B 2HLOC 2JHIF 3BVHC 1N86A 2OYIB 1RF1A 2J0YA 1RE3A 1FZAC 1FZBB 1LWUA 3H32C 1LTJA 1JY2P 2H43B 1FZGB 2J0GA 1FICA 2XNXB 3GHGA 1JY3O 2Z4EC 4JZCA 1JY3N 3HUSA 4R9TA 1JC9A 1FZEA 1RF0C 1LT9B 2HLOA 2OYHB 1RE4B 3E1IC 1FZAA 1N86B 3H32A 4R9JA 2D39A 2OYIC 1FZBC 2WNPF 2HPCC 2HODC 2Z4EA 1FZGC 1N73C 2J3UA 2XNXC 2FFDB 1FZFA 1Z3UA 2J64A 2Q9IB 1RF0A 1M1JC 1FZEB 3FIBA 1FZCB 1JY2O 3E1IA 3BVHA 2OYHC 1RE4C 2OYIA 1JY2N 1RF1B 4M7FA 2HPCA 1RE3B 1LWUB 2HODA 2JHHC 1FZGA 1LTJB 2J2PA 1N73A 4EPUA 2JHMF 2Z4EB 2A45G 2GY7A 2H43C 2XNXA 3GHGB 2J1GA 2FIBA 1W2EA 2A45I 1FZDA 1FZFB 1M1JA 3HUSB 4JYOX 2FFDC 1Z3SA 2Q9IC 1JY3P 2OYHA 2HLOB 1RE4A 2J3FA 1FZCC 3BVHB 2J61A 1LT9C 2JHLF 2J0HA 1FZAB 3H32B
chains in the Genus database with same CATH superfamily
2D2CC 2K9JA 4UB8H 1SQXG 3AEAC 3CCQP 2WMMA 1NAFA 1USDA 2GA1A 3RK2B 1FOSE 1RH5B 3HUSC 1A02J 2JHIF 3JCUE 3A0BH 1RE3A 4OH8B 1FZBB 1GTWA 4D6TG 1Q90D 2A06G 1DEEG 2C0WA 1T2KC 1LGHB 1AA0A 1U7JA 1JC9A 2M0BA 2IBZE 2GUSA 2XKMA 2KP8A 3P32A 1AQ5A 1VQOP 3Q5SA 2WZ7A 5KJ7D 1DIPA 2R3CA 2WPVB 3GW6A 3V2PA 2BCCG 5KTBA 1L4AB 3S4RA 2LXCB 2Q9IB 2HR3A 1LP1B 1JY2O 2IDBA 1FJKA 2WSSH 2FXMA 2N9YB 1KYOH 2XU6A 2O01N 2VRSA 1FAVA 1K04A 3HTKA 3G4SP 1DD3A 1LTJB 1S1CX 2Z4EB 2AEJA 4HH2A 2R5BA 4DZOA 1JTHA 1FZFB 3NMDA 2WPQA 5KAIH 2ZVNB 2FFDC 1IFIA 3IAOA 3SWKA 4IFMA 1JUNA 1PP9G 1QGKB 1LTBC 3W68A 1DX7A 3M9BA 2MKVA 2XNDH 4ZNCA 3EWKA 1YTZT 3KZIH 1BE3G 5CHXA 1KD1Q 1H0TB 1M1JB 1VQNP 5APXA 2FYUG 1Q81Q 4EIJA 1RF1A 2QM7A 1IFJA 1LWUA 3H32C 2QJKB 1BSNA 3H1JJ 3H1JE 3A0HE 4PJ0H 1SLQA 1RQUA 3KHUA 5APTA 2OYOA 2ZT9B 2E74C 2ZXEB 2Q6QA 2KLVA 1YJ9P 1NHLA 5GTIE 4C7RA 2KB7P 5B5EE 3HD7C 1T3JA 1HTLC 2QA4P 1E79H 3LIEA 3V4WA 3CCJP 3EFFK 1DH3A 3GF3A 3JC22 1ZLLA 4C7NA 4GOEA 5BU5A 4GIFA 1Q2NA 1NWQA 3CCLP 2XNXC 2OTKE 3M9HA 2WVRA 3HE4B 4JPZB 3BCCJ 2HPCA 5AVZB 4U3FJ 3BCCE 2HODA 4U3FE 1ZXGA 1URQD 2P7JA 3GHGB 5H2FH 2O01H 1Y8AA 3H1LJ 1RHZB 3H1LE 1J1EC 2L5GB 2C0XA 4H0LD 1M1KQ 2J3FA 3S1KA 1L0NJ 3VMAA 3CWBE 5APUA 5K5GB 1CI6B 1JOCA 3HE5B 1N73B 2K1AA 3GF7A 1L0LD 3CCVP 3BASA 1SQPJ 1MKMA 1SQPE 1HWTC 1S9KE 4WB4A 5AVUB 1XTCC 2A06D 5B66H 4OGQB 2JP3A 2Y0CA 3L75G 2NPSA 3G71P 3MIWA 2J3OA 4N78D 3A3YB 1W5CE 1SQXJ 3M91A 2KYVA 1JM0A 1P84D 3VYIA 2H43B 2IBZI 4IFFA 1WRGA 3LIDA 3IFMA 1JCCA 2Z4EC 2KS1A 1KB9D 2BCCD 3ABVC 1SFCA 2BASA 4H13D 5DJUB 3O6QB 1PL5A 3QWOC 1NH4A 1NTKG 1J1DB 1FZAA 3E1IC 5APQA 2C9LY 4D6TJ 1KQFB 2YXQB 1N7SA 3OAKA 1WMKA 2I1JA 1FS0E 1N7LA 1CW5A 3CI9A 2O3JA 3P8CE 1GW3A 2E75D 3PTZA 3L4FA 4XA4A 1CZQA 1M1JC 4IL6X 4H44C 1P84H 1N2DC 1GL2A 1JY2N 2JJLA 1RY3A 1EQ7A 1FZGA 5KKZC 1KB9H 2YXRB 2E43A 3L72E 4GKGA 2NZ2A 1BE3D 2YNYA 2ZT9C 2FYUD 2HLOB 2W8ZA 3KQGA 1MFZA 1NTZJ 1NTZE 5CBOA 1SQQJ 5CJ4A 1SQQE 1G1IA 3TGUJ 5APYA 3TGUE 3L73J 3L73E 1Q86Q 1KTMA 4JQ0D 2IZ0A 3UIAA 2YKQA 2FXOA 1MUUA 1FOSF 2E76C 3B5NC 2QRXA 3AEFC 1JY2P 2YKOA 4DJGA 3AE4C 4BWNA 2H7HA 2FYNC 1PFIA 1VQPP 1HJ0A 2B87B 1RF0C 1SQBJ 1OW6A 1SQBE 5AVSB 3IF4A 2QVAA 2IBZG 2QG4A 3FGAD 1OZHA 2GM4A 1L0LK 1N73C 4AYCA 1EZVE 3OA7A 4ZKPA 5KJ7A 4IL6H 1JCDA 4AUWA 4OGQC 1T8ZA 5AW3B 2D2CB 3L70E 5TJHA 2H43C 1BCCJ 3D70A 1BCCE 1LTIC 1SS1A 2JWAA 5GTHH 4B86A 3CMEP 3HUSB 2ZYGA 3L75D 2WSCH 1ZOYC 3V2RA 1VQ9P 2XV5A 1SVFA 2GUVA 3RGUA 2RN0A 3RL0C 3OJAB 3NTNA 2M3EA 1IFMA 1FIBA 1L4AA 2Q9IA 2WSEJ 2J3FD 5AVTB 3I56P 4L75A 2J3GA 1H89A 1NTKD 1GDTA 1U57A 5DJTB 2PGDA 1LTJA 2W6BA 2AXTE 2WT7A 4JZCA 2NPSD 1EDJA 2R44A 3H1JG 5KAFE 1IO4A 3V6IA 2FYUK 4XFJA 2KZIA 3CC4P 1GZLA 1S5LE 3WMM0 1N86B 4EYYQ 4DOJA 4WY4C 1HGZA 3Q3DA 1P84I 3GLMA 1H0TA 3TYYA 2FFDB 3A7OA 3H25A 1KB9I 4BXLA 2N9BA 3VTPC 3BVHA 1G1JA 1BDDA 4EPUA 1ZV8A 4WVZA 3BCCG 3ZDMA 4U3FG 4M3LA 1KILC 1PPJE 1S4XA 1URQA 1LTTC 3U1AA 2FYZA 1LJ2A 2PAJA 3MP7B 1FZCC 1NOHA 4GT1A 3H1LG 3H32B 4TT3H 1FBMA 2W90A 4I2LC 3CWBG 2JDIH 4WBAA 1AVYA 5KLIB 2J60A 2E74B 1G2CB 3LW5J 1SQPG 1FDMA 1MZ9A 2IYOA 3MHVA 3V2NA 2N1TB 1LT9A 3HD7B 2IBZD 3HE4A 3D6ZA 4DCKA 2E42A 1FC2C 3AE1C 1FICA 5AVYB 1IFPA 3GHGA 2XNXB 2KOGA 4ZKUA 3CCMP 1SQVJ 2QIWA 1SQVE 3RBXA 2KNCA 2JEEA 4HKZH 1GU4A 1FZEA 3VN0A 1YHQP 1VDFA 1K73Q 3AECC 3G3ZA 3L74J 3L74E 3PRJA 5APWA 3BATA 1J1EB 4O9BA 4JYBA 1JO5A 4CPGA 1PGQA 4K3AA 1BGYJ 1NTKK 1BGYE 4OWFA 1NVOA 3Q1MA 4M7FA 3RK2D 3H1HJ 1IC2A 3H1HE 2WTYA 3MUDA 1OFCX 2GY7A 3AEDC 2YMKA 2FKWB 2QSIA 3L72G 5CCGA 1X9VA 1SFCC 2UWJE 4BRYA 2I8DA 1PIXA 3O6QA 1FE6A 4U7JA 2J61A 2WWWA 4GOFA 1OVUA 3SFEC 1N86C 1XTGB 1EDKA 2M5AA 1NTZG 1SQQG 1L2PA 1VF5C 3B4SA 3U59A 3B8EB 3TGUG 3H1JD 4ASVA 3L73G 1T3UA 5CCHC 3E1IB 1KYOE 1PGOA 1GL2C 1L4AD 1HGVA 3KDPB 1YITP 3JSVC 4IOIH 4L76A 1HJBA 5E79E 1H88A 5TISH 3TF5A 4R9TA 2HLOA 1PGPA 1OX3A 4H44B 1OWAA 1SQBG 1USEA 1IJDB 5KKZB 3PH0A 3O8ZA 3BCCD 3KZIE 4U3FD 3A0HH 1KZUB 1T6AA 5KLIC 1EZVG 4RKUJ 2XDJA 3H1LD 2N1TC 5B5EH 2ZAEB 4PD4E 1YIJP 1L0ND 4L73A 2B88A 2YMYA 2Q3IA 4PJ0E 2WQYC 2SPZA 1OMIA 1AV1A 3G9RA 3L70G 3M0DC 1YYCA 2J1GA 2G3AA 2ZYAA 1M57D 1BCCG 1SQPD 2LXBA 1IZNB 2E76B 3B5NB 5BVZA 1HH0A 4W7ZA 1SQXD 2ZVOB 2K3RA 2ZT9D 2FYNB 2KUBA 3TSIA 1ZW0A 2KXPB 2K37A 2ZFCA 1RF0B 3TNUA 2JHKF 1VQ5P 2LKMA 3CMAP 3CWBJ 3GMAA 4EI2A 1HUCA 3F89A 3SFDC 4D6TD 3H1KJ 3H1KE 1GW4A 4AQRD 1H8AA 3HUSA 3P8CD 5CJ0A 5APVA 4I7ZC 2D39A 2OYIC 2CK3H 5AVWB 4R4LA 5B66E 3CPWO 2FXPA 1N8RQ 2J64A 5AVRB 2I1KA 1Y47A 4YTPC 1J2JB 2RH0A 2Q7CA 1VQ4P 2R32A 3S9OA 3RL0B 2POHA 1JB0J 1NJIQ 2DW3A 2A45G 2XZRA 1NTZD 4OGQD 1SQQD 1W2EA 2KI7B 3TGUD 3IN6A 3L73D 2QM8A 1PPJG 3NFQA 3CXHE 4ZMDA 4PV1B 1L0LE 1PP9D 2YIUC 3IR9A 3WU2H 1KN7A 4NYTA 3L72J 3PHLA 5KLVJ 5CCGD 5KLVE 3KYQA 2FFDA 1JMMA 3CCEP 1QVFO 1S2EA 3BVHC 1SQBD 2M8RA 1L0NK 4WY4B 3M9QA 2Q5UA 1Z56A 2P2UA 3R4YA 1MFTA 4UB6E 1EZVD 1SQPK 4HB1A 1KV4A 1NYHA 1KC8Q 1SQVG 3H32A 2KLUA 4H0LC 1M8OB 2RMZA 2OARA 2V7QJ 1SQXK 1KILB 1SP4A 1DD4A 1Q82Q 2O1JA 1G2CA 1BCCD 3L74G 3HD7A 1FZCB 1YTZI 3FWLA 2OYHC 1RE4C 5CMZA 1NTMJ 4N3YB 1NTME 1BGYG 2XNXA 3P7KA 3MZWB 3H1HG 2FIBA 3CL3D 2YKPA 2WSFH 1QVGO 1GU5A 1QLED 4L74A 4H13C 2HPCB 2J5ZA 2P1JA 2HODB 1FZBA 3L70J 1RE3C 5M1BA 3OW2O 2JKVA 4IL6E 1BSHA 1QL1A 4GDOA 3Q5RA 1ZMEC 3AE2C 2HG5D 5BU8B 1UIXA 3CC7P 4RJTA 3II6A 1NTZK 1JY3O 3P8MC 1SQQK 1PGJA 5GTHE 2KSJA 2D2CD 2WSEH 1LP1A 1HBWA 1KILE 4PV1C 1U7MA 2Z4EA 1NU1J 4N6JA 1RQVA 1K8AQ 1NU1E 2AXTH 1YJNP 1FDOA 5L8RJ 2E5TA 3CX5E 1SFCB 2QJYB 1FZFA 5KAFH 1R8EA 1JNMA 3E1IA 3L71J 3E1RA 3L71E 1SQBK 1N7SB 2J2PA 3CXHI 1T2KD 1VF5B 1W2BO 4EDFA 1GD2E 1M1JA 1VPCA 1EXIA 1WT6A 4JF7A 1GL2B 3N4XA 3CCRP 2A45H 1RF1C 3M0AA 1YBKA 1LWUC 3V4QA 3GG2A 3CD6P 2JWDA 2H88C 4MN4C 2BEZF 2JR8A 2IYPA 2IFNA 2LR2A 2Q1KA 1HF9A 1SQVD 3RK3B 3AE9C 1NO4A 3F5HA 1QEXA 2IX7C 3K5BA 1M90Q 1ZR2A 2QJPC 4LLHA 2WPRA 3V2QA 3H1IJ 3H1KG 3H1IE 3L74D 3PJSK 3B5NA 1X22A 1K9MQ 1K05A 3VMXA 3QH9A 3SWFA 1BGYD 2HPCC 2HODC 1KFMA 2J3UA 3WUUA 3H1HD 4XE5B 1ZRTE 3Q2YA 1NAYA 1RF0A 2M3BA 1HVVA 1X0TA 5AW7B 5EFWB 1EZVI 2JO1A 3VP8A 4UB8E 1OVRA 3JCUH 1CI6A 3HE5A 1N73A 4YPCA 1QL2A 3WUVA 3T97B 1MV8A 2E74D 1M56D 2N1TD 3HD7D 1ZN5A 1EDLA 2NPSC 3A0BE 2J0HA 1BDCA 4NPDA 2AEMA 1KYOD 1LNQA 2H43A 1L0LG 2QEXP 4KHXA 2YO2A 4Z1MH 3RK3E 5C39A 5KLVG 3W67A 1VQ8P 2QJYC 3MGNA 4W80A 4ZFGA 4I7ZB 2OYIB 4K35A 1FZAC 2IFMA 1N7SC 1GMJA 1S3JA 3CCSP 1AQTA 1JY3N 1YQ4C 2KK7A 3EFGA 3CX5I 5AW8B 2KZJA 1AJYA 2PFXA 1CSBA 4Y28J 1X8YA 1QX8A 1FZGC 4PD4D 1VQKP 2WT7B 1KORA 1JEKA 1VQMP 5KAIE 2HYNA 5E79H 2MJZA 2HFED 1SQVK 4QMAA 3AEGC 3RK3C 4YXWH 2YIUB 4WY4A 2JHHC 3VOPA 1NTMG 3AEEC 1EDIA 3C8VA 5TISE 2A45I 3H6PA 2J5UA 4JYOX 3WUTA 2Y0DA 1JY3P 1S72P 1OVVA 3AE3C 3BVHB 5GTIH 2JHLF 3A2AA 4PD4H 3CWBD 2R3SA 3AE8C 1KILA 4NPEA 4M7HA 2PRRA 4R4MA 1URQB 4LC1A 2P67A 4H44D 1IK7A 3H1KD 3L36A 1S9KD 2B89A 2B87A 5AVQB 1FZCA 3AEBC 4WWIA 1VQ6P 4H0LB 1OIPA 2AXCA 3Q5PA 2J0GA 1ZP0C 2IZ1A 3RK2C 1EXJA 5KJ7C 3USSA 3AE7C 1LT9B 2OYHB 1RE4B 1LT1A 2O1KA 2WITA 1LTSC 2L91A 2K9JB 3N7NA 1FZBC 2Y9ZA 2O01J 5H2FE 1VQLP 4NPFX 1KQGB 2E76D 5AW6B 3B5ND 5AW0B 1NU1G 2KNCB 2Y0EA 1ZR4A 1FZEB 1LTGC 1L0NE 3E7KA 2V4HA 4H13B 3CXHD 3M06A 3D71A 1RE3B 3L71G 2ITAA 3VMYA 2P58A 2OQQA 1YQ3C 3BRTB 4RESB 3KXDA 2WPSA 1PZQA 3L72D 3C1LA 5KLVD 3CC2P 1L4AC 2Q9IC 2E75B 3C9IA 3RL0g 1SQXE 2FBWC 1VL2A 1TU3F 3CLQA 3EQ2A 1OW8A 1LTJC 2KIKA 3TDKA 1FZFC 4I1LA 2R5DA 4BRYB 3CXHH 2W6JH 2J61B 1L0LJ 1N86A 4D6TE 2P10A 2W83C 3HTKB 1NGMB 1LTAC 4KJMA 4KT0J 2M5AB 2A06E 2Q3EA 1KYOI 3MTUE 3L35A 2ZJSE 2G8YA 5CCHA 1JTHB 4N78E 2Z5HA 2Y9YA 3H1IG 3RL0D 1P84E 1IFNA 3ITKA 2B9BA 3WU2E 1KB9E 2BCCJ 4I6MC 2BCCE 2J59M 2QJKC 1NTMD 2AEFA 2CPBA 4PV1D 1KQSO 4UB6H 1Z3UA 3V5BA 2YO3A 1URQC 3FIBA 3A5TA 2K88A 2K9YA 3AE5C 3B71A 1RF1B 4A7PA 1LWUB 2JHMF 4C46A 2NRGA 2V7QH 1DEBA 4IFDK 1OXZA 3L70D 1IFDA 4PD4I 5AW5B 2IPPA 4TLFA 2OTJP 1PP9J 3SSUA 1Z3SA 1PP9E 2N1TA 1LT9C 4WY4D 1NKZB 2OTLP 4Y99B 2PP6A 4RO0A 1BE3J 1BE3E 3M0DA 4JYCA 1S5LX 2QJPB 1AVOA 1A02F 4C7NB 3FX0A 3GHGC 2W6AA 2FYUJ 1KFNA 3AE6C 2FYUE 3CCUP 4W7YA 5AVVB 2C9NY 2CPSA 1FU1A 1FZEC 1E5WA 1KILD 1KMIZ 1AFOA 2H89C 3VP9A 4EOTA 3T97A 1D7MA 3U1CA 1GK4A 2WSFJ 3TK1A 3MD0A 5KLVK 1NU1D 3TNUB 3CX5D 5AW2B 3R2PA 2E75C 4R9JA 3L71D 3I55P 5CBNA 3MUDC 2FY8A 1IK9A 3L37A 5CCGC 2WSCJ 2NPSB 3PLNA 1R5SA 4ASWA 4LGDE 3FWNA 2OYIA 1J1DC 5AW1B 1Q7YQ 3SWYA 4DT0A 2BEQD 2KS1B 1FZDA 3CX5H 1X79B 3NXSA 2QE7H 1PPJD 1PV3A 2H8PD 2RKLA 1FZAB 2W27A 1S5LH 4GODA 5APSA 1FIDA 4YXDC 1NTMK 3I5CA 3L75J 3L75E 5AW4B 4JBZA 1KQLA 3H1ID 2HLOC 5AVXB 4HYTB 2J0YA 3HRNA 2OGUA 1FZGB 1NKNA 1SFCD 1VQ7P 1EC5A 1YI2P 1NTKJ 4HJGH 1NTKE 2ZXXA 1ZRTD 3BRVB 2ZYDA 3KPEA 1N7SD 1Y9BA 1VF5D 2WNPF 3D6YA 1FDIA 4Y99C 1GK6A 4OVNF 5CCHD 2E5YA 1GL2D 3LW5H 1YJWP 3G6EP 1L0NG 2J58A 3FXDA 1JMBA 1OW7A 3PP5A 3FXEA 2Z5IA 3RK3D 1M7LA 1R5LA 1NU1K 2OYHA 1RE4A 3RBZA 2KSEA 5AW9B 3VMZA 1UIIA 1FJPA
chains in the Genus database with same CATH topology
2XV5A 3A2AA 1SVFA 3IR9A 2GUVA 3RL0C 4NYTA 3OJAB 1KILA 3NTNA 1NAFA 5CCGD 3RK2B 1FOSE 3KYQA 1IFMA 1FIBA 4M7HA 1L4AA 1URQB 2FFDA 4LC1A 1JMMA 2P67A 2Q9IA 2J3FD 5AVTB 3L36A 3HUSC 5AVQB 1S9KD 1FZCA 2J3GA 1A02J 1H89A 2JHIF 3BVHC 1GDTA 1RE3A 4OH8B 1FZBB 2M8RA 1LTJA 1L0NK 4WY4B 2W6BA 2J0GA 3M9QA 1GTWA 2Q5UA 1Z56A 2WT7A 4JZCA 2P2UA 3RK2C 2NPSD 2C0WA 1T2KC 1LGHB 1SQPK 5KJ7C 1IO4A 1JC9A 1LT9B 2GUSA 2FYUK 2XKMA 2OYHB 2KP8A 1RE4B 1GZLA 3P32A 1AQ5A 3WMM0 2O1KA 2WITA 1N86B 3H32A 1LTSC 2WZ7A 3N7NA 1FZBC 2OARA 1SQXK 5KJ7D 4WY4C 4DOJA 1HGZA 1KILB 2R3CA 1SP4A 3V2PA 5KTBA 2O1JA 3TYYA 1G2CA 1L4AB 2FFDB 5AW6B 2Q9IB 3B5ND 5AW0B 3A7OA 1ZR4A 1FZEB 3HD7A 1FZCB 1YTZI 2N9BA 1JY2O 3VTPC 1LTGC 1FJKA 3BVHA 2FXMA 2OYHC 1RE4C 1G1JA 2XU6A 5CMZA 3M06A 2VRSA 1FAVA 3HTKA 4N3YB 1RE3B 1LTJB 3VMYA 4EPUA 1ZV8A 2Z4EB 2XNXA 3P7KA 4HH2A 4M3LA 1KILC 3BRTB 4RESB 2WPSA 2FIBA 2R5BA 4DZOA 1JTHA 1URQA 1LTTC 1FZFB 3CL3D 2YKPA 2WPQA 3NMDA 3U1AA 1L4AC 2FFDC 2FYZA 2WSFH 1IFIA 2Q9IC 3C9IA 2PAJA 4IFMA 1JUNA 1GU5A 1NOHA 1FZCC 4GT1A 1LTBC 3H32B 2HPCB 2J5ZA 2P1JA 2HODB 1FZBA 1FBMA 3CLQA 1DX7A 3M9BA 4I2LC 1RE3C 3EQ2A 1LTJC 4WBAA 1YTZT 2J60A 5CHXA 1G2CB 1M1JB 1FZFC 1FDMA 1MZ9A 1QL1A 4I1LA 2R5DA 3V2NA 2N1TB 1LT9A 3HD7B 5APXA 2J61B 4EIJA 1N86A 3HE4A 1RF1A 2QM7A 2E42A 1IFJA 1LWUA 3HTKB 3H32C 2HG5D 5BU8B 1LTAC 1FICA 5AVYB 3II6A 2XNXB 1NTZK 3GHGA 2KOGA 1JY3O 3P8MC 4ZKUA 1SLQA 3MTUE 1SQQK 3L35A 5CCHA 5APTA 1JTHB 4N78E 2Z5HA 2KSJA 2ZXEB 2JEEA 2KLVA 2WSEH 1GU4A 1FZEA 1NHLA 4C7RA 1HBWA 2KB7P 3HD7C 3RL0D 1T3JA 1IFNA 3VN0A 1HTLC 1VDFA 3LIEA 3V4WA 4I6MC 1DH3A 2Z4EA 2J59M 3G3ZA 1ZLLA 4N6JA 4C7NA 4GIFA 5BU5A 1NWQA 2XNXC 2CPBA 5APWA 1SFCB 3BATA 1FZFA 1Z3UA 1J1EB 3V5BA 2YO3A 1URQC 1JNMA 4O9BA 3FIBA 4JYBA 1JO5A 3A5TA 3E1IA 3M9HA 1NTKK 3HE4B 1RF1B 1SQBK 4M7FA 2HPCA 5AVZB 3RK2D 1LWUB 1N7SB 2HODA 1IC2A 2J2PA 2WTYA 2JHMF 3MUDA 1URQD 1T2KD 2GY7A 4C46A 2P7JA 3GHGB 1DEBA 2FKWB 4IFDK 1OXZA 2O01H 1IFDA 5CCGA 1GD2E 1X9VA 1M1JA 1SFCC 2IPPA 5AW5B 1J1EC 1VPCA 1Z3SA 2L5GB 2C0XA 2N1TA 2J3FA 1WT6A 2J61A 1LT9C 2WWWA 4WY4D 1NKZB 5APUA 4JF7A 1GL2B 3N4XA 1CI6B 1JOCA 2A45H 1N86C 1XTGB 2PP6A 3HE5B 3M0AA 4Y99B 1RF1C 1N73B 1LWUC 3V4QA 3M0DA 4JYCA 3BASA 1A02F 4C7NB 1HWTC 1S9KE 3GHGC 4WB4A 5AVUB 1XTCC 2W6AA 3U59A 1KFNA 3B8EB 2IFNA 4W7YA 5AVVB 1T3UA 2C9NY 5CCHC 2NPSA 3MIWA 2J3OA 2CPSA 4N78D 1FU1A 3E1IB 3A3YB 3RK3B 1FZEC 1E5WA 3M91A 2KYVA 1KILD 1GL2C 1NO4A 1AFOA 3VYIA 2H43B 3VP9A 4EOTA 3T97A 4IFFA 2IX7C 1WRGA 1L4AD 3LIDA 3IFMA 1HGVA 3U1CA 1JCCA 1ZR2A 2Z4EC 3KDPB 4LLHA 1GK4A 2WPRA 3TK1A 1SFCA 3MD0A 3V2QA 1HJBA 1H88A 5KLVK 3TNUB 4R9TA 2BASA 2HLOA 5AW2B 3R2PA 3B5NA 1NH4A 1J1DB 1FZAA 3E1IC 1OWAA 5APQA 2C9LY 4R9JA 1IJDB 3VMXA 1N7SA 3SWFA 3OAKA 2HPCC 2HODC 2I1JA 1KFMA 1N7LA 3O8ZA 1CW5A 2J3UA 3CI9A 3P8CE 4XE5B 1GW3A 1KZUB 1IK9A 3L4FA 3L37A 1RF0A 2M3BA 1HVVA 4XA4A 1CZQA 5CCGC 1M1JC 5AW7B 2NPSB 2XDJA 4LGDE 2N1TC 3VP8A 2OYIA 1N2DC 1GL2A 1JY2N 1J1DC 2JJLA 5AW1B 1CI6A 1RY3A 1EQ7A 3HE5A 1FZGA 1N73A 1QL2A 2YMYA 2Q3IA 1MV8A 3SWYA 2E43A 4GKGA 3M0DC 1YYCA 2J1GA 1FZDA 2N1TD 3HD7D 1X79B 3NXSA 1ZN5A 2YNYA 2HLOB 2NPSC 2H8PD 3B5NB 3KQGA 2J0HA 5BVZA 1FZAB 1MFZA 1HH0A 2W27A 5APSA 5CJ4A 2H43A 4W7ZA 1FIDA 1G1IA 4KHXA 5APYA 1NTMK 2YO2A 3I5CA 5AW4B 3TSIA 2ZFCA 1KQLA 1RF0B 3TNUA 2JHKF 3MGNA 3UIAA 4W80A 2YKQA 4ZFGA 1MUUA 2LKMA 2HLOC 1FOSF 5AVXB 4HYTB 3B5NC 2OYIB 2J0YA 1FZAC 3HRNA 1JY2P 2YKOA 1FZGB 1HUCA 2IFMA 1NKNA 1SFCD 1N7SC 2H7HA 1GW4A 4AQRD 1JY3N 1H8AA 3HUSA 3P8CD 1PFIA 3BRVB 1RF0C 5CJ0A 3KPEA 3EFGA 5AVSB 5APVA 1N7SD 5AW8B 2D39A 2OYIC 1CSBA 2WNPF 1X8YA 2GM4A 1L0LK 4Y99C 1FZGC 1GK6A 1N73C 5AVWB 5CCHD 4AYCA 2WT7B 3OA7A 4ZKPA 5KJ7A 2HYNA 2J64A 5AVRB 1JCDA 4AUWA 2I1KA 2MJZA 1J2JB 1GL2D 2HFED 3LW5H 1T8ZA 2Q7CA 1SQVK 5AW3B 2R32A 3RK3C 4WY4A 2JHHC 3RL0B 2POHA 3VOPA 2J58A 2A45G 2XZRA 3PP5A 2H43C 1LTIC 1W2EA 2A45I 3H6PA 2Z5IA 3RK3D 4B86A 1M7LA 3HUSB 2QM8A 1NU1K 4JYOX 1JY3P 3NFQA 2OYHA 1RE4A 2WSCH 5AW9B 3BVHB 3VMZA 3V2RA 1FJPA 2JHLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPC B;  2J5Z A;  2A45 H;  1FZB A;  2HOD B;  1N86 C;  1RF1 C;  2H43 A;  1N73 B;  1RE3 C;  1FID A;  1LWU C;  1LTJ C;  4NYT A;  3GHG C;  1FIB A;  2J60 A;  4M7H A;  2FFD A;  1M1J B;  2Q9I A;  2J3F D;  1FZF C;  1T3U A;  1RF0 B;  2JHK F;  3HUS C;  1FZC A;  2J3G A;  1LT9 A;  2J3O A;  4ZFG A;  3E1I B;  1FZE C;  2J61 B;  2HLO C;  2JHI F;  3BVH C;  1N86 A;  2OYI B;  1RF1 A;  2J0Y A;  1RE3 A;  1FZA C;  1FZB B;  1LWU A;  3H32 C;  1LTJ A;  1JY2 P;  2H43 B;  1FZG B;  2J0G A;  1FIC A;  2XNX B;  3GHG A;  1JY3 O;  2Z4E C;  4JZC A;  1JY3 N;  3HUS A;  4R9T A;  1JC9 A;  1FZE A;  1RF0 C;  1LT9 B;  2HLO A;  2OYH B;  1RE4 B;  3E1I C;  1FZA A;  1N86 B;  3H32 A;  4R9J A;  2D39 A;  2OYI C;  1FZB C;  2WNP F;  2HPC C;  2HOD C;  2Z4E A;  1FZG C;  1N73 C;  2J3U A;  2XNX C;  2FFD B;  1FZF A;  1Z3U A;  2J64 A;  2Q9I B;  1RF0 A;  1M1J C;  1FZE B;  3FIB A;  1FZC B;  1JY2 O;  3E1I A;  3BVH A;  2OYH C;  1RE4 C;  2OYI A;  1JY2 N;  1RF1 B;  4M7F A;  2HPC A;  1RE3 B;  1LWU B;  2HOD A;  2JHH C;  1FZG A;  1LTJ B;  2J2P A;  1N73 A;  4EPU A;  2JHM F;  2Z4E B;  2A45 G;  2GY7 A;  2H43 C;  2XNX A;  3GHG B;  2J1G A;  2FIB A;  1W2E A;  2A45 I;  1FZD A;  1FZF B;  1M1J A;  3HUS B;  4JYO X;  2FFD C;  1Z3S A;  2Q9I C;  1JY3 P;  2OYH A;  2HLO B;  1RE4 A;  2J3F A;  1FZC C;  3BVH B;  2J61 A;  1LT9 C;  2JHL F;  2J0H A;  1FZA B;  3H32 B; 
#chains in the Genus database with same CATH topology
 2D2C C;  2K9J A;  4UB8 H;  1SQX G;  3AEA C;  3CCQ P;  2WMM A;  1NAF A;  1USD A;  2GA1 A;  3RK2 B;  1FOS E;  1RH5 B;  3HUS C;  1A02 J;  2JHI F;  3JCU E;  3A0B H;  1RE3 A;  4OH8 B;  1FZB B;  1GTW A;  4D6T G;  1Q90 D;  2A06 G;  1DEE G;  2C0W A;  1T2K C;  1LGH B;  1AA0 A;  1U7J A;  1JC9 A;  2M0B A;  2IBZ E;  2GUS A;  2XKM A;  2KP8 A;  3P32 A;  1AQ5 A;  1VQO P;  3Q5S A;  2WZ7 A;  5KJ7 D;  1DIP A;  2R3C A;  2WPV B;  3GW6 A;  3V2P A;  2BCC G;  5KTB A;  1L4A B;  3S4R A;  2LXC B;  2Q9I B;  2HR3 A;  1LP1 B;  1JY2 O;  2IDB A;  1FJK A;  2WSS H;  2FXM A;  2N9Y B;  1KYO H;  2XU6 A;  2O01 N;  2VRS A;  1FAV A;  1K04 A;  3HTK A;  3G4S P;  1DD3 A;  1LTJ B;  1S1C X;  2Z4E B;  2AEJ A;  4HH2 A;  2R5B A;  4DZO A;  1JTH A;  1FZF B;  3NMD A;  2WPQ A;  5KAI H;  2ZVN B;  2FFD C;  1IFI A;  3IAO A;  3SWK A;  4IFM A;  1JUN A;  1PP9 G;  1QGK B;  1LTB C;  3W68 A;  1DX7 A;  3M9B A;  2MKV A;  2XND H;  4ZNC A;  3EWK A;  1YTZ T;  3KZI H;  1BE3 G;  5CHX A;  1KD1 Q;  1H0T B;  1M1J B;  1VQN P;  5APX A;  2FYU G;  1Q81 Q;  4EIJ A;  1RF1 A;  2QM7 A;  1IFJ A;  1LWU A;  3H32 C;  2QJK B;  1BSN A;  3H1J J;  3H1J E;  3A0H E;  4PJ0 H;  1SLQ A;  1RQU A;  3KHU A;  5APT A;  2OYO A;  2ZT9 B;  2E74 C;  2ZXE B;  2Q6Q A;  2KLV A;  1YJ9 P;  1NHL A;  5GTI E;  4C7R A;  2KB7 P;  5B5E E;  3HD7 C;  1T3J A;  1HTL C;  2QA4 P;  1E79 H;  3LIE A;  3V4W A;  3CCJ P;  3EFF K;  1DH3 A;  3GF3 A;  3JC2 2;  1ZLL A;  4C7N A;  4GOE A;  5BU5 A;  4GIF A;  1Q2N A;  1NWQ A;  3CCL P;  2XNX C;  2OTK E;  3M9H A;  2WVR A;  3HE4 B;  4JPZ B;  3BCC J;  2HPC A;  5AVZ B;  4U3F J;  3BCC E;  2HOD A;  4U3F E;  1ZXG A;  1URQ D;  2P7J A;  3GHG B;  5H2F H;  2O01 H;  1Y8A A;  3H1L J;  1RHZ B;  3H1L E;  1J1E C;  2L5G B;  2C0X A;  4H0L D;  1M1K Q;  2J3F A;  3S1K A;  1L0N J;  3VMA A;  3CWB E;  5APU A;  5K5G B;  1CI6 B;  1JOC A;  3HE5 B;  1N73 B;  2K1A A;  3GF7 A;  1L0L D;  3CCV P;  3BAS A;  1SQP J;  1MKM A;  1SQP E;  1HWT C;  1S9K E;  4WB4 A;  5AVU B;  1XTC C;  2A06 D;  5B66 H;  4OGQ B;  2JP3 A;  2Y0C A;  3L75 G;  2NPS A;  3G71 P;  3MIW A;  2J3O A;  4N78 D;  3A3Y B;  1W5C E;  1SQX J;  3M91 A;  2KYV A;  1JM0 A;  1P84 D;  3VYI A;  2H43 B;  2IBZ I;  4IFF A;  1WRG A;  3LID A;  3IFM A;  1JCC A;  2Z4E C;  2KS1 A;  1KB9 D;  2BCC D;  3ABV C;  1SFC A;  2BAS A;  4H13 D;  5DJU B;  3O6Q B;  1PL5 A;  3QWO C;  1NH4 A;  1NTK G;  1J1D B;  1FZA A;  3E1I C;  5APQ A;  2C9L Y;  4D6T J;  1KQF B;  2YXQ B;  1N7S A;  3OAK A;  1WMK A;  2I1J A;  1FS0 E;  1N7L A;  1CW5 A;  3CI9 A;  2O3J A;  3P8C E;  1GW3 A;  2E75 D;  3PTZ A;  3L4F A;  4XA4 A;  1CZQ A;  1M1J C;  4IL6 X;  4H44 C;  1P84 H;  1N2D C;  1GL2 A;  1JY2 N;  2JJL A;  1RY3 A;  1EQ7 A;  1FZG A;  5KKZ C;  1KB9 H;  2YXR B;  2E43 A;  3L72 E;  4GKG A;  2NZ2 A;  1BE3 D;  2YNY A;  2ZT9 C;  2FYU D;  2HLO B;  2W8Z A;  3KQG A;  1MFZ A;  1NTZ J;  1NTZ E;  5CBO A;  1SQQ J;  5CJ4 A;  1SQQ E;  1G1I A;  3TGU J;  5APY A;  3TGU E;  3L73 J;  3L73 E;  1Q86 Q;  1KTM A;  4JQ0 D;  2IZ0 A;  3UIA A;  2YKQ A;  2FXO A;  1MUU A;  1FOS F;  2E76 C;  3B5N C;  2QRX A;  3AEF C;  1JY2 P;  2YKO A;  4DJG A;  3AE4 C;  4BWN A;  2H7H A;  2FYN C;  1PFI A;  1VQP P;  1HJ0 A;  2B87 B;  1RF0 C;  1SQB J;  1OW6 A;  1SQB E;  5AVS B;  3IF4 A;  2QVA A;  2IBZ G;  2QG4 A;  3FGA D;  1OZH A;  2GM4 A;  1L0L K;  1N73 C;  4AYC A;  1EZV E;  3OA7 A;  4ZKP A;  5KJ7 A;  4IL6 H;  1JCD A;  4AUW A;  4OGQ C;  1T8Z A;  5AW3 B;  2D2C B;  3L70 E;  5TJH A;  2H43 C;  1BCC J;  3D70 A;  1BCC E;  1LTI C;  1SS1 A;  2JWA A;  5GTH H;  4B86 A;  3CME P;  3HUS B;  2ZYG A;  3L75 D;  2WSC H;  1ZOY C;  3V2R A;  1VQ9 P;  2XV5 A;  1SVF A;  2GUV A;  3RGU A;  2RN0 A;  3RL0 C;  3OJA B;  3NTN A;  2M3E A;  1IFM A;  1FIB A;  1L4A A;  2Q9I A;  2WSE J;  2J3F D;  5AVT B;  3I56 P;  4L75 A;  2J3G A;  1H89 A;  1NTK D;  1GDT A;  1U57 A;  5DJT B;  2PGD A;  1LTJ A;  2W6B A;  2AXT E;  2WT7 A;  4JZC A;  2NPS D;  1EDJ A;  2R44 A;  3H1J G;  5KAF E;  1IO4 A;  3V6I A;  2FYU K;  4XFJ A;  2KZI A;  3CC4 P;  1GZL A;  1S5L E;  3WMM 0;  1N86 B;  4EYY Q;  4DOJ A;  4WY4 C;  1HGZ A;  3Q3D A;  1P84 I;  3GLM A;  1H0T A;  3TYY A;  2FFD B;  3A7O A;  3H25 A;  1KB9 I;  4BXL A;  2N9B A;  3VTP C;  3BVH A;  1G1J A;  1BDD A;  4EPU A;  1ZV8 A;  4WVZ A;  3BCC G;  3ZDM A;  4U3F G;  4M3L A;  1KIL C;  1PPJ E;  1S4X A;  1URQ A;  1LTT C;  3U1A A;  2FYZ A;  1LJ2 A;  2PAJ A;  3MP7 B;  1FZC C;  1NOH A;  4GT1 A;  3H1L G;  3H32 B;  4TT3 H;  1FBM A;  2W90 A;  4I2L C;  3CWB G;  2JDI H;  4WBA A;  1AVY A;  5KLI B;  2J60 A;  2E74 B;  1G2C B;  3LW5 J;  1SQP G;  1FDM A;  1MZ9 A;  2IYO A;  3MHV A;  3V2N A;  2N1T B;  1LT9 A;  3HD7 B;  2IBZ D;  3HE4 A;  3D6Z A;  4DCK A;  2E42 A;  1FC2 C;  3AE1 C;  1FIC A;  5AVY B;  1IFP A;  3GHG A;  2XNX B;  2KOG A;  4ZKU A;  3CCM P;  1SQV J;  2QIW A;  1SQV E;  3RBX A;  2KNC A;  2JEE A;  4HKZ H;  1GU4 A;  1FZE A;  3VN0 A;  1YHQ P;  1VDF A;  1K73 Q;  3AEC C;  3G3Z A;  3L74 J;  3L74 E;  3PRJ A;  5APW A;  3BAT A;  1J1E B;  4O9B A;  4JYB A;  1JO5 A;  4CPG A;  1PGQ A;  4K3A A;  1BGY J;  1NTK K;  1BGY E;  4OWF A;  1NVO A;  3Q1M A;  4M7F A;  3RK2 D;  3H1H J;  1IC2 A;  3H1H E;  2WTY A;  3MUD A;  1OFC X;  2GY7 A;  3AED C;  2YMK A;  2FKW B;  2QSI A;  3L72 G;  5CCG A;  1X9V A;  1SFC C;  2UWJ E;  4BRY A;  2I8D A;  1PIX A;  3O6Q A;  1FE6 A;  4U7J A;  2J61 A;  2WWW A;  4GOF A;  1OVU A;  3SFE C;  1N86 C;  1XTG B;  1EDK A;  2M5A A;  1NTZ G;  1SQQ G;  1L2P A;  1VF5 C;  3B4S A;  3U59 A;  3B8E B;  3TGU G;  3H1J D;  4ASV A;  3L73 G;  1T3U A;  5CCH C;  3E1I B;  1KYO E;  1PGO A;  1GL2 C;  1L4A D;  1HGV A;  3KDP B;  1YIT P;  3JSV C;  4IOI H;  4L76 A;  1HJB A;  5E79 E;  1H88 A;  5TIS H;  3TF5 A;  4R9T A;  2HLO A;  1PGP A;  1OX3 A;  4H44 B;  1OWA A;  1SQB G;  1USE A;  1IJD B;  5KKZ B;  3PH0 A;  3O8Z A;  3BCC D;  3KZI E;  4U3F D;  3A0H H;  1KZU B;  1T6A A;  5KLI C;  1EZV G;  4RKU J;  2XDJ A;  3H1L D;  2N1T C;  5B5E H;  2ZAE B;  4PD4 E;  1YIJ P;  1L0N D;  4L73 A;  2B88 A;  2YMY A;  2Q3I A;  4PJ0 E;  2WQY C;  2SPZ A;  1OMI A;  1AV1 A;  3G9R A;  3L70 G;  3M0D C;  1YYC A;  2J1G A;  2G3A A;  2ZYA A;  1M57 D;  1BCC G;  1SQP D;  2LXB A;  1IZN B;  2E76 B;  3B5N B;  5BVZ A;  1HH0 A;  4W7Z A;  1SQX D;  2ZVO B;  2K3R A;  2ZT9 D;  2FYN B;  2KUB A;  3TSI A;  1ZW0 A;  2KXP B;  2K37 A;  2ZFC A;  1RF0 B;  3TNU A;  2JHK F;  1VQ5 P;  2LKM A;  3CMA P;  3CWB J;  3GMA A;  4EI2 A;  1HUC A;  3F89 A;  3SFD C;  4D6T D;  3H1K J;  3H1K E;  1GW4 A;  4AQR D;  1H8A A;  3HUS A;  3P8C D;  5CJ0 A;  5APV A;  4I7Z C;  2D39 A;  2OYI C;  2CK3 H;  5AVW B;  4R4L A;  5B66 E;  3CPW O;  2FXP A;  1N8R Q;  2J64 A;  5AVR B;  2I1K A;  1Y47 A;  4YTP C;  1J2J B;  2RH0 A;  2Q7C A;  1VQ4 P;  2R32 A;  3S9O A;  3RL0 B;  2POH A;  1JB0 J;  1NJI Q;  2DW3 A;  2A45 G;  2XZR A;  1NTZ D;  4OGQ D;  1SQQ D;  1W2E A;  2KI7 B;  3TGU D;  3IN6 A;  3L73 D;  2QM8 A;  1PPJ G;  3NFQ A;  3CXH E;  4ZMD A;  4PV1 B;  1L0L E;  1PP9 D;  2YIU C;  3IR9 A;  3WU2 H;  1KN7 A;  4NYT A;  3L72 J;  3PHL A;  5KLV J;  5CCG D;  5KLV E;  3KYQ A;  2FFD A;  1JMM A;  3CCE P;  1QVF O;  1S2E A;  3BVH C;  1SQB D;  2M8R A;  1L0N K;  4WY4 B;  3M9Q A;  2Q5U A;  1Z56 A;  2P2U A;  3R4Y A;  1MFT A;  4UB6 E;  1EZV D;  1SQP K;  4HB1 A;  1KV4 A;  1NYH A;  1KC8 Q;  1SQV G;  3H32 A;  2KLU A;  4H0L C;  1M8O B;  2RMZ A;  2OAR A;  2V7Q J;  1SQX K;  1KIL B;  1SP4 A;  1DD4 A;  1Q82 Q;  2O1J A;  1G2C A;  1BCC D;  3L74 G;  3HD7 A;  1FZC B;  1YTZ I;  3FWL A;  2OYH C;  1RE4 C;  5CMZ A;  1NTM J;  4N3Y B;  1NTM E;  1BGY G;  2XNX A;  3P7K A;  3MZW B;  3H1H G;  2FIB A;  3CL3 D;  2YKP A;  2WSF H;  1QVG O;  1GU5 A;  1QLE D;  4L74 A;  4H13 C;  2HPC B;  2J5Z A;  2P1J A;  2HOD B;  1FZB A;  3L70 J;  1RE3 C;  5M1B A;  3OW2 O;  2JKV A;  4IL6 E;  1BSH A;  1QL1 A;  4GDO A;  3Q5R A;  1ZME C;  3AE2 C;  2HG5 D;  5BU8 B;  1UIX A;  3CC7 P;  4RJT A;  3II6 A;  1NTZ K;  1JY3 O;  3P8M C;  1SQQ K;  1PGJ A;  5GTH E;  2KSJ A;  2D2C D;  2WSE H;  1LP1 A;  1HBW A;  1KIL E;  4PV1 C;  1U7M A;  2Z4E A;  1NU1 J;  4N6J A;  1RQV A;  1K8A Q;  1NU1 E;  2AXT H;  1YJN P;  1FDO A;  5L8R J;  2E5T A;  3CX5 E;  1SFC B;  2QJY B;  1FZF A;  5KAF H;  1R8E A;  1JNM A;  3E1I A;  3L71 J;  3E1R A;  3L71 E;  1SQB K;  1N7S B;  2J2P A;  3CXH I;  1T2K D;  1VF5 B;  1W2B O;  4EDF A;  1GD2 E;  1M1J A;  1VPC A;  1EXI A;  1WT6 A;  4JF7 A;  1GL2 B;  3N4X A;  3CCR P;  2A45 H;  1RF1 C;  3M0A A;  1YBK A;  1LWU C;  3V4Q A;  3GG2 A;  3CD6 P;  2JWD A;  2H88 C;  4MN4 C;  2BEZ F;  2JR8 A;  2IYP A;  2IFN A;  2LR2 A;  2Q1K A;  1HF9 A;  1SQV D;  3RK3 B;  3AE9 C;  1NO4 A;  3F5H A;  1QEX A;  2IX7 C;  3K5B A;  1M90 Q;  1ZR2 A;  2QJP C;  4LLH A;  2WPR A;  3V2Q A;  3H1I J;  3H1K G;  3H1I E;  3L74 D;  3PJS K;  3B5N A;  1X22 A;  1K9M Q;  1K05 A;  3VMX A;  3QH9 A;  3SWF A;  1BGY D;  2HPC C;  2HOD C;  1KFM A;  2J3U A;  3WUU A;  3H1H D;  4XE5 B;  1ZRT E;  3Q2Y A;  1NAY A;  1RF0 A;  2M3B A;  1HVV A;  1X0T A;  5AW7 B;  5EFW B;  1EZV I;  2JO1 A;  3VP8 A;  4UB8 E;  1OVR A;  3JCU H;  1CI6 A;  3HE5 A;  1N73 A;  4YPC A;  1QL2 A;  3WUV A;  3T97 B;  1MV8 A;  2E74 D;  1M56 D;  2N1T D;  3HD7 D;  1ZN5 A;  1EDL A;  2NPS C;  3A0B E;  2J0H A;  1BDC A;  4NPD A;  2AEM A;  1KYO D;  1LNQ A;  2H43 A;  1L0L G;  2QEX P;  4KHX A;  2YO2 A;  4Z1M H;  3RK3 E;  5C39 A;  5KLV G;  3W67 A;  1VQ8 P;  2QJY C;  3MGN A;  4W80 A;  4ZFG A;  4I7Z B;  2OYI B;  4K35 A;  1FZA C;  2IFM A;  1N7S C;  1GMJ A;  1S3J A;  3CCS P;  1AQT A;  1JY3 N;  1YQ4 C;  2KK7 A;  3EFG A;  3CX5 I;  5AW8 B;  2KZJ A;  1AJY A;  2PFX A;  1CSB A;  4Y28 J;  1X8Y A;  1QX8 A;  1FZG C;  4PD4 D;  1VQK P;  2WT7 B;  1KOR A;  1JEK A;  1VQM P;  5KAI E;  2HYN A;  5E79 H;  2MJZ A;  2HFE D;  1SQV K;  4QMA A;  3AEG C;  3RK3 C;  4YXW H;  2YIU B;  4WY4 A;  2JHH C;  3VOP A;  1NTM G;  3AEE C;  1EDI A;  3C8V A;  5TIS E;  2A45 I;  3H6P A;  2J5U A;  4JYO X;  3WUT A;  2Y0D A;  1JY3 P;  1S72 P;  1OVV A;  3AE3 C;  3BVH B;  5GTI H;  2JHL F;  3A2A A;  4PD4 H;  3CWB D;  2R3S A;  3AE8 C;  1KIL A;  4NPE A;  4M7H A;  2PRR A;  4R4M A;  1URQ B;  4LC1 A;  2P67 A;  4H44 D;  1IK7 A;  3H1K D;  3L36 A;  1S9K D;  2B89 A;  2B87 A;  5AVQ B;  1FZC A;  3AEB C;  4WWI A;  1VQ6 P;  4H0L B;  1OIP A;  2AXC A;  3Q5P A;  2J0G A;  1ZP0 C;  2IZ1 A;  3RK2 C;  1EXJ A;  5KJ7 C;  3USS A;  3AE7 C;  1LT9 B;  2OYH B;  1RE4 B;  1LT1 A;  2O1K A;  2WIT A;  1LTS C;  2L91 A;  2K9J B;  3N7N A;  1FZB C;  2Y9Z A;  2O01 J;  5H2F E;  1VQL P;  4NPF X;  1KQG B;  2E76 D;  5AW6 B;  3B5N D;  5AW0 B;  1NU1 G;  2KNC B;  2Y0E A;  1ZR4 A;  1FZE B;  1LTG C;  1L0N E;  3E7K A;  2V4H A;  4H13 B;  3CXH D;  3M06 A;  3D71 A;  1RE3 B;  3L71 G;  2ITA A;  3VMY A;  2P58 A;  2OQQ A;  1YQ3 C;  3BRT B;  4RES B;  3KXD A;  2WPS A;  1PZQ A;  3L72 D;  3C1L A;  5KLV D;  3CC2 P;  1L4A C;  2Q9I C;  2E75 B;  3C9I A;  3RL0 g;  1SQX E;  2FBW C;  1VL2 A;  1TU3 F;  3CLQ A;  3EQ2 A;  1OW8 A;  1LTJ C;  2KIK A;  3TDK A;  1FZF C;  4I1L A;  2R5D A;  4BRY B;  3CXH H;  2W6J H;  2J61 B;  1L0L J;  1N86 A;  4D6T E;  2P10 A;  2W83 C;  3HTK B;  1NGM B;  1LTA C;  4KJM A;  4KT0 J;  2M5A B;  2A06 E;  2Q3E A;  1KYO I;  3MTU E;  3L35 A;  2ZJS E;  2G8Y A;  5CCH A;  1JTH B;  4N78 E;  2Z5H A;  2Y9Y A;  3H1I G;  3RL0 D;  1P84 E;  1IFN A;  3ITK A;  2B9B A;  3WU2 E;  1KB9 E;  2BCC J;  4I6M C;  2BCC E;  2J59 M;  2QJK C;  1NTM D;  2AEF A;  2CPB A;  4PV1 D;  1KQS O;  4UB6 H;  1Z3U A;  3V5B A;  2YO3 A;  1URQ C;  3FIB A;  3A5T A;  2K88 A;  2K9Y A;  3AE5 C;  3B71 A;  1RF1 B;  4A7P A;  1LWU B;  2JHM F;  4C46 A;  2NRG A;  2V7Q H;  1DEB A;  4IFD K;  1OXZ A;  3L70 D;  1IFD A;  4PD4 I;  5AW5 B;  2IPP A;  4TLF A;  2OTJ P;  1PP9 J;  3SSU A;  1Z3S A;  1PP9 E;  2N1T A;  1LT9 C;  4WY4 D;  1NKZ B;  2OTL P;  4Y99 B;  2PP6 A;  4RO0 A;  1BE3 J;  1BE3 E;  3M0D A;  4JYC A;  1S5L X;  2QJP B;  1AVO A;  1A02 F;  4C7N B;  3FX0 A;  3GHG C;  2W6A A;  2FYU J;  1KFN A;  3AE6 C;  2FYU E;  3CCU P;  4W7Y A;  5AVV B;  2C9N Y;  2CPS A;  1FU1 A;  1FZE C;  1E5W A;  1KIL D;  1KMI Z;  1AFO A;  2H89 C;  3VP9 A;  4EOT A;  3T97 A;  1D7M A;  3U1C A;  1GK4 A;  2WSF J;  3TK1 A;  3MD0 A;  5KLV K;  1NU1 D;  3TNU B;  3CX5 D;  5AW2 B;  3R2P A;  2E75 C;  4R9J A;  3L71 D;  3I55 P;  5CBN A;  3MUD C;  2FY8 A;  1IK9 A;  3L37 A;  5CCG C;  2WSC J;  2NPS B;  3PLN A;  1R5S A;  4ASW A;  4LGD E;  3FWN A;  2OYI A;  1J1D C;  5AW1 B;  1Q7Y Q;  3SWY A;  4DT0 A;  2BEQ D;  2KS1 B;  1FZD A;  3CX5 H;  1X79 B;  3NXS A;  2QE7 H;  1PPJ D;  1PV3 A;  2H8P D;  2RKL A;  1FZA B;  2W27 A;  1S5L H;  4GOD A;  5APS A;  1FID A;  4YXD C;  1NTM K;  3I5C A;  3L75 J;  3L75 E;  5AW4 B;  4JBZ A;  1KQL A;  3H1I D;  2HLO C;  5AVX B;  4HYT B;  2J0Y A;  3HRN A;  2OGU A;  1FZG B;  1NKN A;  1SFC D;  1VQ7 P;  1EC5 A;  1YI2 P;  1NTK J;  4HJG H;  1NTK E;  2ZXX A;  1ZRT D;  3BRV B;  2ZYD A;  3KPE A;  1N7S D;  1Y9B A;  1VF5 D;  2WNP F;  3D6Y A;  1FDI A;  4Y99 C;  1GK6 A;  4OVN F;  5CCH D;  2E5Y A;  1GL2 D;  3LW5 H;  1YJW P;  3G6E P;  1L0N G;  2J58 A;  3FXD A;  1JMB A;  1OW7 A;  3PP5 A;  3FXE A;  2Z5I A;  3RK3 D;  1M7L A;  1R5L A;  1NU1 K;  2OYH A;  1RE4 A;  3RBZ A;  2KSE A;  5AW9 B;  3VMZ A;  1UII A;  1FJP A; 
#chains in the Genus database with same CATH homology
 2XV5 A;  3A2A A;  1SVF A;  3IR9 A;  2GUV A;  3RL0 C;  4NYT A;  3OJA B;  1KIL A;  3NTN A;  1NAF A;  5CCG D;  3RK2 B;  1FOS E;  3KYQ A;  1IFM A;  1FIB A;  4M7H A;  1L4A A;  1URQ B;  2FFD A;  4LC1 A;  1JMM A;  2P67 A;  2Q9I A;  2J3F D;  5AVT B;  3L36 A;  3HUS C;  5AVQ B;  1S9K D;  1FZC A;  2J3G A;  1A02 J;  1H89 A;  2JHI F;  3BVH C;  1GDT A;  1RE3 A;  4OH8 B;  1FZB B;  2M8R A;  1LTJ A;  1L0N K;  4WY4 B;  2W6B A;  2J0G A;  3M9Q A;  1GTW A;  2Q5U A;  1Z56 A;  2WT7 A;  4JZC A;  2P2U A;  3RK2 C;  2NPS D;  2C0W A;  1T2K C;  1LGH B;  1SQP K;  5KJ7 C;  1IO4 A;  1JC9 A;  1LT9 B;  2GUS A;  2FYU K;  2XKM A;  2OYH B;  2KP8 A;  1RE4 B;  1GZL A;  3P32 A;  1AQ5 A;  3WMM 0;  2O1K A;  2WIT A;  1N86 B;  3H32 A;  1LTS C;  2WZ7 A;  3N7N A;  1FZB C;  2OAR A;  1SQX K;  5KJ7 D;  4WY4 C;  4DOJ A;  1HGZ A;  1KIL B;  2R3C A;  1SP4 A;  3V2P A;  5KTB A;  2O1J A;  3TYY A;  1G2C A;  1L4A B;  2FFD B;  5AW6 B;  2Q9I B;  3B5N D;  5AW0 B;  3A7O A;  1ZR4 A;  1FZE B;  3HD7 A;  1FZC B;  1YTZ I;  2N9B A;  1JY2 O;  3VTP C;  1LTG C;  1FJK A;  3BVH A;  2FXM A;  2OYH C;  1RE4 C;  1G1J A;  2XU6 A;  5CMZ A;  3M06 A;  2VRS A;  1FAV A;  3HTK A;  4N3Y B;  1RE3 B;  1LTJ B;  3VMY A;  4EPU A;  1ZV8 A;  2Z4E B;  2XNX A;  3P7K A;  4HH2 A;  4M3L A;  1KIL C;  3BRT B;  4RES B;  2WPS A;  2FIB A;  2R5B A;  4DZO A;  1JTH A;  1URQ A;  1LTT C;  1FZF B;  3CL3 D;  2YKP A;  2WPQ A;  3NMD A;  3U1A A;  1L4A C;  2FFD C;  2FYZ A;  2WSF H;  1IFI A;  2Q9I C;  3C9I A;  2PAJ A;  4IFM A;  1JUN A;  1GU5 A;  1NOH A;  1FZC C;  4GT1 A;  1LTB C;  3H32 B;  2HPC B;  2J5Z A;  2P1J A;  2HOD B;  1FZB A;  1FBM A;  3CLQ A;  1DX7 A;  3M9B A;  4I2L C;  1RE3 C;  3EQ2 A;  1LTJ C;  4WBA A;  1YTZ T;  2J60 A;  5CHX A;  1G2C B;  1M1J B;  1FZF C;  1FDM A;  1MZ9 A;  1QL1 A;  4I1L A;  2R5D A;  3V2N A;  2N1T B;  1LT9 A;  3HD7 B;  5APX A;  2J61 B;  4EIJ A;  1N86 A;  3HE4 A;  1RF1 A;  2QM7 A;  2E42 A;  1IFJ A;  1LWU A;  3HTK B;  3H32 C;  2HG5 D;  5BU8 B;  1LTA C;  1FIC A;  5AVY B;  3II6 A;  2XNX B;  1NTZ K;  3GHG A;  2KOG A;  1JY3 O;  3P8M C;  4ZKU A;  1SLQ A;  3MTU E;  1SQQ K;  3L35 A;  5CCH A;  5APT A;  1JTH B;  4N78 E;  2Z5H A;  2KSJ A;  2ZXE B;  2JEE A;  2KLV A;  2WSE H;  1GU4 A;  1FZE A;  1NHL A;  4C7R A;  1HBW A;  2KB7 P;  3HD7 C;  3RL0 D;  1T3J A;  1IFN A;  3VN0 A;  1HTL C;  1VDF A;  3LIE A;  3V4W A;  4I6M C;  1DH3 A;  2Z4E A;  2J59 M;  3G3Z A;  1ZLL A;  4N6J A;  4C7N A;  4GIF A;  5BU5 A;  1NWQ A;  2XNX C;  2CPB A;  5APW A;  1SFC B;  3BAT A;  1FZF A;  1Z3U A;  1J1E B;  3V5B A;  2YO3 A;  1URQ C;  1JNM A;  4O9B A;  3FIB A;  4JYB A;  1JO5 A;  3A5T A;  3E1I A;  3M9H A;  1NTK K;  3HE4 B;  1RF1 B;  1SQB K;  4M7F A;  2HPC A;  5AVZ B;  3RK2 D;  1LWU B;  1N7S B;  2HOD A;  1IC2 A;  2J2P A;  2WTY A;  2JHM F;  3MUD A;  1URQ D;  1T2K D;  2GY7 A;  4C46 A;  2P7J A;  3GHG B;  1DEB A;  2FKW B;  4IFD K;  1OXZ A;  2O01 H;  1IFD A;  5CCG A;  1GD2 E;  1X9V A;  1M1J A;  1SFC C;  2IPP A;  5AW5 B;  1J1E C;  1VPC A;  1Z3S A;  2L5G B;  2C0X A;  2N1T A;  2J3F A;  1WT6 A;  2J61 A;  1LT9 C;  2WWW A;  4WY4 D;  1NKZ B;  5APU A;  4JF7 A;  1GL2 B;  3N4X A;  1CI6 B;  1JOC A;  2A45 H;  1N86 C;  1XTG B;  2PP6 A;  3HE5 B;  3M0A A;  4Y99 B;  1RF1 C;  1N73 B;  1LWU C;  3V4Q A;  3M0D A;  4JYC A;  3BAS A;  1A02 F;  4C7N B;  1HWT C;  1S9K E;  3GHG C;  4WB4 A;  5AVU B;  1XTC C;  2W6A A;  3U59 A;  1KFN A;  3B8E B;  2IFN A;  4W7Y A;  5AVV B;  1T3U A;  2C9N Y;  5CCH C;  2NPS A;  3MIW A;  2J3O A;  2CPS A;  4N78 D;  1FU1 A;  3E1I B;  3A3Y B;  3RK3 B;  1FZE C;  1E5W A;  3M91 A;  2KYV A;  1KIL D;  1GL2 C;  1NO4 A;  1AFO A;  3VYI A;  2H43 B;  3VP9 A;  4EOT A;  3T97 A;  4IFF A;  2IX7 C;  1WRG A;  1L4A D;  3LID A;  3IFM A;  1HGV A;  3U1C A;  1JCC A;  1ZR2 A;  2Z4E C;  3KDP B;  4LLH A;  1GK4 A;  2WPR A;  3TK1 A;  1SFC A;  3MD0 A;  3V2Q A;  1HJB A;  1H88 A;  5KLV K;  3TNU B;  4R9T A;  2BAS A;  2HLO A;  5AW2 B;  3R2P A;  3B5N A;  1NH4 A;  1J1D B;  1FZA A;  3E1I C;  1OWA A;  5APQ A;  2C9L Y;  4R9J A;  1IJD B;  3VMX A;  1N7S A;  3SWF A;  3OAK A;  2HPC C;  2HOD C;  2I1J A;  1KFM A;  1N7L A;  3O8Z A;  1CW5 A;  2J3U A;  3CI9 A;  3P8C E;  4XE5 B;  1GW3 A;  1KZU B;  1IK9 A;  3L4F A;  3L37 A;  1RF0 A;  2M3B A;  1HVV A;  4XA4 A;  1CZQ A;  5CCG C;  1M1J C;  5AW7 B;  2NPS B;  2XDJ A;  4LGD E;  2N1T C;  3VP8 A;  2OYI A;  1N2D C;  1GL2 A;  1JY2 N;  1J1D C;  2JJL A;  5AW1 B;  1CI6 A;  1RY3 A;  1EQ7 A;  3HE5 A;  1FZG A;  1N73 A;  1QL2 A;  2YMY A;  2Q3I A;  1MV8 A;  3SWY A;  2E43 A;  4GKG A;  3M0D C;  1YYC A;  2J1G A;  1FZD A;  2N1T D;  3HD7 D;  1X79 B;  3NXS A;  1ZN5 A;  2YNY A;  2HLO B;  2NPS C;  2H8P D;  3B5N B;  3KQG A;  2J0H A;  5BVZ A;  1FZA B;  1MFZ A;  1HH0 A;  2W27 A;  5APS A;  5CJ4 A;  2H43 A;  4W7Z A;  1FID A;  1G1I A;  4KHX A;  5APY A;  1NTM K;  2YO2 A;  3I5C A;  5AW4 B;  3TSI A;  2ZFC A;  1KQL A;  1RF0 B;  3TNU A;  2JHK F;  3MGN A;  3UIA A;  4W80 A;  2YKQ A;  4ZFG A;  1MUU A;  2LKM A;  2HLO C;  1FOS F;  5AVX B;  4HYT B;  3B5N C;  2OYI B;  2J0Y A;  1FZA C;  3HRN A;  1JY2 P;  2YKO A;  1FZG B;  1HUC A;  2IFM A;  1NKN A;  1SFC D;  1N7S C;  2H7H A;  1GW4 A;  4AQR D;  1JY3 N;  1H8A A;  3HUS A;  3P8C D;  1PFI A;  3BRV B;  1RF0 C;  5CJ0 A;  3KPE A;  3EFG A;  5AVS B;  5APV A;  1N7S D;  5AW8 B;  2D39 A;  2OYI C;  1CSB A;  2WNP F;  1X8Y A;  2GM4 A;  1L0L K;  4Y99 C;  1FZG C;  1GK6 A;  1N73 C;  5AVW B;  5CCH D;  4AYC A;  2WT7 B;  3OA7 A;  4ZKP A;  5KJ7 A;  2HYN A;  2J64 A;  5AVR B;  1JCD A;  4AUW A;  2I1K A;  2MJZ A;  1J2J B;  1GL2 D;  2HFE D;  3LW5 H;  1T8Z A;  2Q7C A;  1SQV K;  5AW3 B;  2R32 A;  3RK3 C;  4WY4 A;  2JHH C;  3RL0 B;  2POH A;  3VOP A;  2J58 A;  2A45 G;  2XZR A;  3PP5 A;  2H43 C;  1LTI C;  1W2E A;  2A45 I;  3H6P A;  2Z5I A;  3RK3 D;  4B86 A;  1M7L A;  3HUS B;  2QM8 A;  1NU1 K;  4JYO X;  1JY3 P;  3NFQ A;  2OYH A;  1RE4 A;  2WSC H;  5AW9 B;  3BVH B;  3VMZ A;  3V2R A;  1FJP A;  2JHL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...