2FFDC

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
b'YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E Chain
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 83
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2ffdC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2ffdC03
1Z3SA 1FZFB 2FIBA 1RE4A 2HPCA 3HUSA 2HODB 2J3UA 2J64A 2J1GA 4JZCA 1RE3C 2J0HA 1JY3O 2J3GA 2XNXA 4R9TA 2Z4EC 2J0GA 2HLOB 2Q9IC 1LWUC 3BVHB 1RF1B 2H43C 2J61B 2OYIB 1N73C 1LT9C 1N86C 1T3UA 3HUSB 1FZGC 2J61A 2OYIA 1FZDA 2J3OA 1FZEC 1Z3UA 2XNXB 2FFDC 1FZCB 2OYHB 2JHIF 1LTJC 4M7HA 2A45G 1FZCA 1JY2P 2A45H 2OYHA 3H32C 1FZAC 1JY2N 3GHGC 1FZBC 2J3FD 1RE3B 1RF0C 2HLOC 1JC9A 2Z4EB 2Q9IB 2A45I 1LWUB 2JHKF 1M1JC 1RE3A 2Z4EA 2Q9IA 1N73B 1RE4C 2J2PA 1LTJA 1LT9B 2HPCC 1LWUA 2JHHC 3E1IC 1N86B 3FIBA 1FZGB 2H43A 2D39A 4EPUA 1FZFC 1FZBA 1N73A 1LT9A 1N86A 2HODC 1FZEB 1FZGA 2J0YA 4NYTA 2FFDB 2J60A 2JHMF 1JY2O 1M1JA 2WNPF 1FZEA 2FFDA 2GY7A 3BVHC 2J5ZA 3E1IA 1RF1C 1LTJB 1JY3P 1FICA 2OYIC 3H32B 1FZAB 1JY3N 1FZFA 2H43B 4ZFGA 4R9JA 3GHGB 1FIBA 1FZBB 2HODA 3HUSC 2J3FA 1RF0B 3H32A 1FZAA 3GHGA 1M1JB 2XNXC 1W2EA 1RF0A 2HLOA 2JHLF 4M7FA 3BVHA 1FIDA 2HPCB 1RF1A 1FZCC 1RE4B 3E1IB 2OYHC 4JYOX
chains in the Genus database with same CATH superfamily
1BGYD 4QMAA 3WUUA 4ZMDA 3HRNA 1NTMK 1GZLA 1Z56A 1WMKA 3H1KE 2OARA 2OTJP 4JYCA 2YO2A 2V7QJ 4O9BA 3CL3D 4PJ0E 3VP9A 4I6MC 1JM0A 2YXRB 3JCUH 3C8VA 3R2PA 4U3FJ 1SQBG 1LJ2A 4Y28J 3Q1MA 4OVNF 2K37A 2YO3A 1NTME 2W27A 3RK2B 2FYNB 2WQYC 4XFJA 1QL2A 2JP3A 4EI2A 3GHGC 3B5ND 2J3FD 2IFMA 3CWBG 2HLOC 1NKZB 3CCVP 1EDJA 1BCCJ 1PPJE 1M1JC 2Z5HA 4H13C 1EXJA 4HH2A 3CPWO 1NOHA 2JHHC 4NPDA 4DJGA 1JEKA 5CCGA 1EXIA 3H1LJ 4ZKPA 5AW7B 1SQVD 2N1TD 2R44A 1HBWA 2E76C 3AE2C 4XE5B 1N7SA 2KSEA 4ZFGA 1T2KD 2B9BA 2AXCA 1K8AQ 4U3FG 3D6ZA 2B87B 1R5LA 1VQ6P 1NTZD 3HUSA 2IX7C 4YXDC 3AE4C 3FXDA 4JZCA 2J0HA 3L74G 1RY3A 2M5AA 2Z4EC 1BCCG 3M0DA 1FDOA 1P84E 2M0BA 3P7KA 1QVFO 4H0LC 5KAIE 3CXHI 1PP9D 1L0NK 1E5WA 3H1IJ 2C9LY 3H1JJ 2KLVA 3L71J 3L75D 3RL0g 3Q2YA 4PV1C 2KP8A 1FZAC 4L73A 3V5BA 4LC1A 4HKZH 1FJKA 3KZIE 2Q9IB 4BXLA 5AW8B 2E74D 2FBWC 2Q9IA 2WSFJ 3FIBA 2BASA 1RH5B 1AV1A 1L0NE 2SPZA 1P84I 1GK6A 2QJPB 1J1EB 1Q2NA 4NPFX 2A06G 2YMYA 2FKWB 1WRGA 1GW3A 2QG4A 1MUUA 2IDBA 1EZVG 3VMYA 1NU1J 2IBZD 1VQ4P 1NAFA 4IL6E 2YKOA 1M90Q 2NPSD 3P32A 3FXEA 1HF9A 1NHLA 3L73J 1YHQP 5TISH 1KQLA 3CXHH 3L72J 3T97A 1RE4B 1OVRA 1RF1A 5APXA 3EFGA 3H1IG 2HYNA 3H1JG 5GTHE 3RK2C 3L71G 1RE4A 5KLVJ 2PP6A 2Q3IA 5APVA 1KYOD 1Q90D 4R4MA 3AE1C 3E1RA 5CCGC 1S1CX 3VTPC 1T3UA 1NH4A 1OW8A 4WY4B 2XNXB 3TF5A 3CCJP 4WY4A 3R4YA 2D2CB 2XNDH 1FAVA 5AVWB 5E79E 1SFCB 2QIWA 1OMIA 3I56P 4K35A 1YJ9P 1SFCA 2FYUK 5DJTB 2A45I 3L73G 1OXZA 3L72G 1IK7A 2KI7B 1VQNP 1PFIA 2QVAA 3L36A 1VQ9P 4OWFA 2ZAEB 5KLVG 2E42A 4JF7A 1ZOYC 1FZEB 4HJGH 2JHMF 3EQ2A 1PZQA 4OGQD 1FZEA 2GY7A 1DEBA 1SP4A 1NTKK 3G6EP 1JY3P 1L0LK 1AVYA 2FYUE 3IAOA 2HODA 2ZT9D 1ZMEC 3H1HE 3H1KJ 1W2BO 1SQQD 2JR8A 5B5EE 1KD1Q 1FBMA 2W8ZA 3AE6C 1H0TA 3Q5RA 1NO4A 3AE7C 1NTKE 4R9TA 2KNCA 3OJAB 1M56D 2Q9IC 4H44D 3A0BH 3H1LE 2WT7B 1GMJA 1FS0E 1L0LE 4C7NB 2XZRA 1K73Q 2HFED 1NTMJ 2KZJA 2WSCH 4C7NA 1JTHB 1KILE 1OIPA 1Z3UA 1URQA 3CLQA 3FX0A 2QJPC 1J1EC 1OX3A 4N78E 1SQXD 4GT1A 2M3BA 3KYQA 3VYIA 1KILA 3S9OA 1HJBA 1HTLC 1IZNB 3M9BA 2JO1A 3P8MC 3L74D 2W90A 1VQ8P 4IOIH 3U1AA 3H1KG 2WITA 3CC2P 1QEXA 2GUVA 1RE4C 3N7NA 4D6TE 3CCUP 3A0HH 3CCRP 3E1IA 1S5LH 4C46A 1L4AA 1NTMG 2V7QH 3C1LA 5K5GB 2M8RA 1PGQA 4R9JA 2JWAA 2FXMA 3JSVC 2E43A 4RKUJ 4I1LA 1S72P 4WY4C 2K3RA 4N3YB 2UWJE 2XNXC 1JNMA 2GA1A 1NU1K 1Q81Q 1GW4A 2D2CC 5AW4B 5APSA 1OZHA 1OVUA 2FXOA 1SFCC 1YI2P 3RBZA 2Q7CA 1RQVA 2KK7A 2HLOB 3MUDA 1JCDA 3G71P 3BVHB 5AW2B 2RKLA 2Y0DA 4UB6E 2XKMA 4EYYQ 5APTA 2HR3A 1LTIC 4AQRD 1IFNA 1NU1E 4W80A 3A3YB 1FZEC 2OGUA 3I55P 3L71D 5KJ7A 3WU2H 1L0NJ 2IFNA 3PTZA 1FJPA 2K9JB 3CX5E 2QEXP 5BU5A 2K9JA 1N73B 3JCUE 2CPBA 1ZRTE 4H13D 1FZGB 1BDCA 1N73A 1DIPA 1FZGA 1VQMP 3CI9A 1U7JA 3CCMP 2ZJSE 2P67A 1X0TA 5GTIE 1LTJB 4DOJA 1X9VA 2WSEJ 1FZFA 3GG2A 1FZBB 2E76D 5AVSB 3L70E 1S2EA 2WPVB 1GU5A 1LNQA 2JHLF 5AVZB 2BEQD 3VP8A 1BGYE 4JYOX 3CX5I 1SS1A 3ABVC 1L0NG 1R8EA 1KV4A 4ASVA 4PV1B 5CBNA 1SVFA 1PGOA 3JC22 3VOPA 2J61B 1PGPA 2P10A 2WSFH 2XV5A 5CMZA 2J61A 2J3OA 1KB9H 4H0LD 3OW2O 3LW5J 1FU1A 1FZCB 1N2DC 1KFMA 3G4SP 1SQVK 2A45G 1FZCA 1BE3D 2OTKE 3TSIA 3SFEC 1KZUB 2JHKF 1Y8AA 1A02F 5APYA 3B5NA 2CK3H 2FYUJ 1SQPD 4EPUA 1NTZK 2Y0EA 4IFDK 2E5TA 3MUDC 1N7LA 3H1HJ 2ZVNB 3M91A 4BWNA 1J2JB 1SQVE 2R3CA 4CPGA 3BVHC 1EC5A 2RN0A 1CW5A 1JB0J 1G1JA 3D71A 5KTBA 4N6JA 2Y9ZA 4KT0J 1NTKJ 2WPSA 5KJ7C 1DD3A 1L0LJ 4GDOA 4ZNCA 1GL2B 1NTZE 5KAFH 2DW3A 1N7SB 1GL2A 2J64A 1IC2A 3RK2D 1T3JA 3RK3E 3VN0A 5AVVB 1X8YA 1USDA 3P8CD 2YMKA 3RK3B 1N73C 3QH9A 2FYUG 2O1JA 3HUSB 1FZGC 4A7PA 2IYOA 4GODA 5CCGD 1WT6A 2K88A 1PPJD 2MJZA 3W67A 3W68A 3H1HG 2M5AB 3PLNA 2Z5IA 4GIFA 2ZYAA 3AEFC 2KSJA 4EDFA 2J58A 1HH0A 4TT3H 3TK1A 3L75E 1LTJC 3CCEP 4D6TJ 1G2CA 1BSNA 1FZBC 2BCCD 1HJ0A 3SWFA 1NTKG 1LWUB 3CXHD 1ZN5A 3H1LG 1L0LG 4PD4E 1EDKA 2H88C 5AW9B 1LWUA 2E75B 4PJ0H 3PJSK 3WUVA 1KTMA 1GDTA 2WZ7A 2W83C 1IFDA 2QJKB 2IBZE 3H6PA 4W7YA 1HWTC 3U1CA 2WWWA 1ZXGA 1YIJP 2OTLP 4I2LC 4Y99B 1FIDA 1FZCC 2NPSA 1J1DB 3SSUA 4JBZA 2WPRA 4UB8E 1FE6A 2KXPB 4D6TG 1RHZB 4PD4I 2YKQA 1KYOE 1IFJA 2JKVA 3B5NC 3T97B 1RF1B 1ZR4A 2LKMA 3Q5PA 2PGDA 2IBZI 3TGUD 4WVZA 3S1KA 1MFTA 2QM8A 1K9MQ 5AW6B 3ZDMA 3HTKA 3BCCJ 1JY2N 1AFOA 3BRTB 3FGAD 2AEMA 2ZYDA 2GM4A 2KOGA 5AVTB 3MGNA 1P84H 1GL2C 3CC4P 1SQQK 1YQ3C 2JEEA 1H8AA 2H43A 2KIKA 1N7SC 3NFQA 5KAIH 4B86A 1KYOI 2R5DA 3L70J 1NU1G 2J0YA 1JY2O 2JJLA 3PP5A 2W6JH 1BGYJ 2WMMA 3RK3C 3A5TA 1DEEG 2ZFCA 3HUSC 4L76A 1LTGC 1K05A 1SQBD 1SQQE 3KZIH 5AVXB 1T6AA 1VQKP 3M0DC 4WY4D 3SWYA 1Z3SA 3BASA 2D2CD 2HODB 3CWBD 1SFCD 1VQOP 4RO0A 1SLQA 2J0GA 1LWUC 3WUTA 1KQSO 1H0TB 2JWDA 2E75C 1OVVA 1VDFA 3L70G 3AEDC 1OFCX 4HYTB 2RH0A 1LP1A 2KNCB 2KS1A 1SQXE 5H2FH 2MKVA 1PL5A 3SFDC 2QJKC 1BGYG 3AEBC 2A45H 2WSEH 5GTHH 5AVYB 3V4QA 1URQB 3BATA 4WB4A 4U3FD 1SQVJ 4Y99C 1LT9B 1KILB 1J1DC 1N86B 1IO4A 2YNYA 4R4LA 1LT9A 3USSA 1N86A 3RL0B 1S4XA 2FFDB 4C7RA 1BCCD 2ITAA 2FY8A 4L74A 2FFDA 1NTZJ 1RF1C 3CC7P 3O8ZA 2ZXXA 5E79H 2H7HA 3G9RA 2C0WA 5AW0B 1OWAA 3H1LD 3RBXA 3LW5H 5AW5B 3E1IB 1L4AB 3C9IA 1YBKA 1Q86Q 2YIUC 4RJTA 4YXWH 5M1BA 2Q6QA 1U57A 1PIXA 5B66E 1EDLA 1SQVG 2H43C 5AVUB 3L75J 1PV3A 3D6YA 1M1KQ 2O01J 4W7ZA 2FXPA 1USEA 2VRSA 2A06D 2AXTE 5CHXA 5B5EH 4IFMA 1NTZG 3MP7B 1EZVD 5CJ4A 3HD7B 1VF5B 3OAKA 3HD7A 1FDMA 2WPQA 4IL6X 3H1ID 3L4FA 1D7MA 3H1JD 2D39A 3AEAC 3FWNA 2HODC 1VQ5P 1M1JA 1QGKB 3MIWA 3L75G 3H32B 1HGVA 1KB9D 1RF0B 3H32A 4K3AA 2LXBA 2Q3EA 3TNUB 3BCCE 1W2EA 1QLED 1RF0A 2HPCB 3TNUA 1ZV8A 5KJ7D 1X79B 2E5YA 2P1JA 1U7MA 1FZFB 1NU1D 2HPCA 1OW7A 1CSBA 1QVGO 4U7JA 2J1GA 2QA4P 2AEFA 1S9KD 1URQC 3L73D 3II6A 1UIXA 3L72D 3HE5B 3IF4A 2IBZG 1LT9C 1TU3F 4L75A 1KILC 1N86C 1AA0A 4JYBA 3HE5A 4DZOA 4GOFA 4YPCA 5KLVD 1SQPK 1YJNP 3RL0C 5KLIB 2FFDC 2QJYB 2YXQB 1FC2C 1M57D 5CCHA 3F89A 1BE3E 1DD4A 1JMMA 1RE3B 4EOTA 3A7OA 1AJYA 2KB7P 1RE3A 2WVRA 2H8PD 1IK9A 1KQFB 1SQPE 3E1IC 4UB6H 1L4AC 1E79H 1FOSF 2JDIH 1SQQJ 2WNPF 1NJIQ 2CPSA 3B4SA 2KLUA 3M06A 4PV1D 3GLMA 3B5NB 1FICA 2XDJA 3B8EB 1PGJA 1JY3N 1ZLLA 3EWKA 2OQQA 2J3FA 2KZIA 1XTCC 4HB1A 2G8YA 2W6AA 2QM7A 3CX5H 1CI6B 2N9BA 2BEZF 4AYCA 2QSIA 1VL2A 2L5GB 5AVQB 1CI6A 1ZP0C 5APWA 3IR9A 1W5CE 3HD7C 1JY3O 2N1TB 2AEJA 3PHLA 1HGZA 1VF5C 1SQXJ 3H1KD 3CD6P 1H88A 3P8CE 1KMIZ 2K9YA 2N1TA 3D70A 5GTIH 3L74J 3HE4B 1JO5A 1K04A 3HE4A 1SQQG 3AEGC 3A2AA 1AQTA 1T8ZA 3RGUA 1JOCA 1NTMD 1ZW0A 5DJUB 3H32C 1HUCA 2BCCE 2HG5D 3Q3DA 1RF0C 5AW1B 1M8OB 5TISE 3CCSP 3CXHE 4ZKUA 3GMAA 3GW6A 1PP9E 1YQ4C 3QWOC 2J2PA 2HPCC 5AVRB 3AECC 2P7JA 1MFZA 1GL2D 1FZFC 2L91A 1G2CB 3IFMA 1NVOA 2I8DA 1N7SD 2M3EA 3I5CA 1JMBA 1SQXG 1MV8A 1AQ5A 2B87A 1YITP 3RK3D 2E74B 4JPZB 1LTAC 5CCHC 3VMXA 5KLIC 2QJYC 4M7FA 1Y47A 3G3ZA 2W6BA 4I7ZB 2PRRA 3V2QA 3WMM0 1RE3C 2J3GA 2ZYGA 3KPEA 1GK4A 1KQGB 2IYPA 1KORA 3M0AA 2OYOA 1P84D 2NPSB 2OYIB 3MTUE 5APUA 3NTNA 4EIJA 2PAJA 3IN6A 4DT0A 2OYIA 1YTZI 2E75D 3V4WA 3TGUE 2YKPA 4LLHA 4IFFA 4PD4D 3K5BA 2Q1KA 2C9NY 2I1KA 1BDDA 1N8RQ 2C0XA 2WTYA 1SQBK 2R32A 1L2PA 3V2NA 3HTKB 2POHA 1S3JA 3LIDA 5H2FE 1L0ND 2ZVOB 3MHVA 3AE3C 2GUSA 4NYTA 1NKNA 2YIUB 3A0BE 4YTPC 3CMAP 2J60A 2N1TC 3L37A 4BRYB 2FYNC 1T2KC 4BRYA 2H43B 4TLFA 3S4RA 1AVOA 1SQBE 4WWIA 2O01H 4MN4C 1OW6A 1IJDB 2ZXEB 4PD4H 1NWQA 1GU4A 1GTWA 3GF7A 4KHXA 4OGQB 3CWBE 2NRGA 2XNXA 4NPEA 2IZ0A 2R3SA 2ZT9B 1VQ7P 1BE3J 3V2RA 4OH8B 2Y9YA 1Y9BA 3E7KA 5BU8B 5KKZB 1G1IA 1A02J 2V4HA 1MZ9A 1SQXK 1YJWP 3A0HE 3V6IA 2P2UA 1HVVA 3BCCG 1S5LE 2OYHB 3VMAA 1SQPJ 2OYHA 4UB8H 2O01N 4H44B 3CCLP 2E74C 4U3FE 2QRXA 1LP1B 2KS1B 4IL6H 1KYOH 3AE9C 4I7ZC 1EDIA 2FYZA 3L74E 1GD2E 1ZR2A 1BCCE 1R5SA 5AW3B 1DH3A 1NAYA 5BVZA 1Q7YQ 5CBOA 2NPSC 2J59M 2OYIC 1BE3G 2FYUD 4M3LA 1EQ7A 1NGMB 1IFIA 3H1HD 2WT7A 1VQLP 1IFMA 2Y0CA 3N4XA 3WU2E 1UIIA 3KQGA 1SQPG 4AUWA 3BRVB 1JTHA 1FDIA 4KJMA 4ASWA 1YTZT 1JCCA 5EFWB 3V2PA 3SWKA 1NTKD 2RMZA 2K1AA 1L0LD 1URQD 2KYVA 3PRJA 2BCCJ 1MKMA 3AE5C 1KILD 2A06E 2XU6A 3RL0D 3B71A 1PP9J 4N78D 3TYYA 2R5BA 2G3AA 1EZVE 4M7HA 1Q82Q 3GF3A 2Q5UA 2LR2A 1CZQA 2B88A 2NZ2A 4GKGA 1RQUA 3H1IE 2WSSH 3H1JE 3L71E 4LGDE 4XA4A 4D6TD 3H25A 1L4AD 1PPJG 3U59A 4OGQC 3FWLA 3NMDA 2O3JA 2ZT9C 2N9YB 3GHGB 1FIBA 1BSHA 1H89A 1KB9E 3KDPB 2H89C 2BCCG 4GOEA 5KKZC 2O1KA 3KHUA 3GHGA 4JQ0D 1EZVI 5KLVK 1M1JB 2HLOA 2I1JA 2LXCB 2QE7H 4H13B 3TDKA 5APQA 3BVHA 1PP9G 3M9QA 2OYHC 1VQPP 2FIBA 3CCQP 2J3UA 4DCKA 4H44C 3M9HA 3TGUJ 1IFPA 2IZ1A 3OA7A 1KFNA 1S9KE 3L35A 2P58A 3L73E 3HD7D 3L72E 1XTGB 2E76B 1VF5D 2PFXA 3KXDA 5KLVE 5C39A 1FZDA 3VMZA 1LGHB 1KC8Q 3MZWB 2J5UA 1KB9I 2JHIF 3PH0A 2KUBA 1QL1A 1JY2P 3UIAA 1VPCA 5L8RJ 1JC9A 2Z4EB 3CX5D 3AE8C 3MD0A 1FOSE 5TJHA 1LTTC 5B66H 2Z4EA 5KAFE 2WSCJ 3CMEP 1LTJA 1QX8A 3Q5SA 4H0LB 1ZRTD 1FZBA 1NYHA 3BCCD 1SQBJ 2B89A 3EFFK 1X22A 3TGUG 1KN7A 4WBAA 2AXTH 1LTBC 2J5ZA 4RESB 1FZAB 3F5HA 1S5LX 1JUNA 3CWBJ 1FZAA 3L70D 1YYCA 3LIEA 3O6QB 2IPPA 3NXSA 3AEEC 1LTSC 4Z1MH 1M7LA 1LT1A 3O6QA 5CCHD 5CJ0A 3ITKA 1DX7A
chains in the Genus database with same CATH topology
1Z3SA 3BASA 1SFCC 2HODB 3V2QA 3HRNA 1NTMK 1GZLA 3WMM0 1Z56A 1RE3C 1SFCD 2J3GA 2Q7CA 1SLQA 2J0GA 2OARA 3MUDA 1JCDA 2HLOB 3KPEA 1GK4A 1LWUC 4JYCA 3BVHB 2YO2A 3M0AA 5AW2B 2NPSB 4O9BA 2OYIB 3MTUE 2XKMA 3CL3D 3VP9A 5APUA 5APTA 4I6MC 3NTNA 4EIJA 2PAJA 1LTIC 4AQRD 2OYIA 1IFNA 1YTZI 1VDFA 3V4WA 4W80A 3A3YB 3R2PA 1FZEC 2YKPA 4HYTB 4LLHA 4IFFA 5KJ7A 2YO3A 2W27A 2C9NY 3RK2B 2A45H 2WSEH 5AVYB 2I1KA 1QL2A 3GHGC 2IFNA 3B5ND 2J3FD 2IFMA 1FJPA 2HLOC 3V4QA 1NKZB 1URQB 2C0XA 3BATA 4WB4A 5BU5A 2WTYA 1M1JC 2Z5HA 4Y99C 4HH2A 1SQBK 1N73B 1LT9B 1NOHA 1KILB 2CPBA 2JHHC 1J1DC 1N86B 1IO4A 2R32A 3V2NA 3HTKB 1FZGB 2YNYA 2POHA 1N73A 1LT9A 5CCGA 3LIDA 1N86A 3RL0B 1FZGA 2GUSA 4NYTA 2FFDB 1NKNA 3CI9A 4ZKPA 4C7RA 2J60A 2N1TC 5AW7B 3L37A 2FFDA 2P67A 2N1TD 1RF1C 1LTJB 4DOJA 1HBWA 1T2KC 1X9VA 3O8ZA 4XE5B 1N7SA 2H43B 1FZFA 4ZFGA 2H7HA 1FZBB 1T2KD 5AVSB 2C0WA 5AW0B 1OWAA 2O01H 1GU5A 3LW5H 2JHLF 1IJDB 5CJ0A 5AVZB 5AW5B 2ZXEB 3VP8A 3E1IB 4JYOX 1L4AB 1NWQA 1GU4A 1GTWA 3C9IA 3HUSA 4KHXA 2IX7C 1SVFA 4JZCA 2J0HA 2XNXA 1RY3A 2Z4EC 3VOPA 3M0DA 3P7KA 2H43C 5AVUB 2J61B 3V2RA 4OH8B 2WSFH 2XV5A 5CMZA 5BU8B 2J61A 2J3OA 1G1IA 1A02J 1MZ9A 1SQXK 4W7ZA 2P2UA 1HVVA 1FU1A 1L0NK 2VRSA 1E5WA 1FZCB 1N2DC 5CHXA 2OYHB 1KFMA 2C9LY 4IFMA 2KLVA 1SQVK 2A45G 1FZCA 5CJ4A 2OYHA 2KP8A 1FZAC 3HD7B 3V5BA 3TSIA 4LC1A 1FJKA 2Q9IB 3OAKA 3HD7A 1KZUB 5AW8B 2JHKF 1FDMA 2WPQA 2Q9IA 1A02F 5APYA 3B5NA 3L4FA 3FIBA 2BASA 2D39A 4EPUA 2FYZA 1NTZK 2HODC 4IFDK 1N7LA 1GK6A 1J1EB 3M91A 1GD2E 1ZR2A 1J2JB 1M1JA 2YMYA 2FKWB 3MIWA 5AW3B 1DH3A 2R3CA 1WRGA 1GW3A 5BVZA 3BVHC 1MUUA 3VMYA 2NPSC 2J59M 1CW5A 2OYIC 3H32B 1HGVA 1G1JA 1NAFA 2YKOA 4M3LA 2NPSD 3P32A 5KTBA 1RF0B 4N6JA 1NHLA 1EQ7A 3H32A 1IFIA 3TNUB 1W2EA 2WPSA 5KJ7C 1RF0A 1KQLA 2WT7A 3T97A 2HPCB 1GL2B 1IFMA 1ZV8A 5APXA 3EFGA 3N4XA 3TNUA 1RF1A 5KJ7D 1X79B 2HYNA 3KQGA 1N7SB 2P1JA 4AUWA 3RK2C 1FZFB 3BRVB 1RE4A 1GL2A 2HPCA 1JTHA 2PP6A 2J64A 1IC2A 1CSBA 3RK2D 2J1GA 1YTZT 1JCCA 2Q3IA 1T3JA 3V2PA 3VN0A 5AVVB 1URQC 1S9KD 3II6A 5APVA 1X8YA 3P8CD 3HE5B 1URQD 3RK3B 2KYVA 1N73C 1LT9C 5CCGC 1KILC 1N86C 2O1JA 3VTPC 1T3UA 3HUSB 4JYBA 3HE5A 4DZOA 1FZGC 5CCGD 1WT6A 1KILD 1SQPK 1NH4A 4WY4B 3RL0C 2MJZA 2XNXB 2FFDC 2XU6A 2Z5IA 3RL0D 4GIFA 4WY4A 1RE4B 4N78D 2KSJA 5CCHA 3TYYA 2J58A 2R5BA 1HH0A 3TK1A 1LTJC 4M7HA 1FAVA 5AVWB 1SFCB 1G2CA 1FZBC 1JMMA 1RE3B 4EOTA 1SFCA 2FYUK 2Q5UA 3A7OA 3SWFA 2A45I 1LWUB 2KB7P 1OXZA 1RE3A 1ZN5A 1CZQA 2H8PD 1IK9A 4GKGA 5AW9B 1LWUA 3E1IC 1PFIA 3L36A 1L4AC 4LGDE 1FOSF 2E42A 4XA4A 4JF7A 1L4AD 3U59A 1FZEB 2JHMF 3EQ2A 1GDTA 2WNPF 2WZ7A 2CPSA 1FZEA 3M06A 1IFDA 3NMDA 2GY7A 1DEBA 1SP4A 1NTKK 1JY3P 3B5NB 1FICA 2XDJA 3H6PA 3B8EB 4W7YA 1L0LK 1JY3N 1ZLLA 3GHGB 1HWTC 1H89A 3KDPB 1FIBA 2HODA 3U1CA 2J3FA 1XTCC 2WWWA 2O1KA 2W6AA 2QM7A 3GHGA 4I2LC 5KLVK 1M1JB 1CI6B 2N9BA 2HLOA 2I1JA 4AYCA 4Y99B 5APQA 3BVHA 5AVQB 1FIDA 1FZCC 3M9QA 1FBMA 2NPSA 1J1DB 1CI6A 2OYHC 2WPRA 2FIBA 5APWA 3IR9A 1NO4A 2J3UA 3HD7C 3M9HA 3OA7A 1JY3O 1KFNA 2N1TB 3L35A 1S9KE 4R9TA 2YKQA 3OJAB 1HGZA 2Q9IC 3HD7D 2WT7B 1IFJA 3B5NC 3P8CE 4C7NB 1H88A 1RF1B 1XTGB 2N1TA 2XZRA 2HFED 2WSCH 1ZR4A 2LKMA 4C7NA 1JTHB 3HE4B 1FZDA 3VMZA 1LGHB 1Z3UA 1JO5A 1URQA 3CLQA 3HE4A 1J1EC 3A2AA 4N78E 4GT1A 2JHIF 2M3BA 2QM8A 1T8ZA 3KYQA 3VYIA 1QL1A 1KILA 1JOCA 5AW6B 1HJBA 1HTLC 1JY2P 3HTKA 3UIAA 3H32C 3M9BA 1HUCA 1JY2N 3P8MC 1VPCA 2HG5D 1RF0C 5AW1B 1JC9A 2Z4EB 3U1AA 1AFOA 3MD0A 3BRTB 4ZKUA 1FOSE 1LTTC 2GM4A 2WITA 2KOGA 2GUVA 2Z4EA 5AVTB 3MGNA 1RE4C 1GL2C 1LTJA 2J2PA 2HPCC 1SQQK 2JEEA 1H8AA 3N7NA 5AVRB 2H43A 2P7JA 1MFZA 1N7SC 1GL2D 3NFQA 1FZBA 1FZFC 1G2CB 3IFMA 4B86A 2R5DA 2J0YA 1N7SD 3I5CA 1JY2O 2JJLA 1MV8A 1AQ5A 3PP5A 4WBAA 1LTBC 2J5ZA 3E1IA 4C46A 1L4AA 3RK3C 3A5TA 4RESB 2M8RA 1FZAB 4R9JA 2ZFCA 2FXMA 3HUSC 3RK3D 1JUNA 2E43A 1LTGC 1FZAA 4I1LA 1LTAC 1YYCA 3LIEA 2IPPA 4WY4C 3NXSA 4N3YB 3VMXA 5CCHC 2XNXC 1LTSC 1JNMA 5AVXB 1M7LA 1NU1K 4M7FA 3G3ZA 2W6BA 3M0DC 4WY4D 5CCHD 1GW4A 3SWYA 5AW4B 5APSA 2L5GB 1DX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3S A;  1FZF B;  2FIB A;  1RE4 A;  2HPC A;  3HUS A;  2HOD B;  2J3U A;  2J64 A;  2J1G A;  4JZC A;  1RE3 C;  2J0H A;  1JY3 O;  2J3G A;  2XNX A;  4R9T A;  2Z4E C;  2J0G A;  2HLO B;  2Q9I C;  1LWU C;  3BVH B;  1RF1 B;  2H43 C;  2J61 B;  2OYI B;  1N73 C;  1LT9 C;  1N86 C;  1T3U A;  3HUS B;  1FZG C;  2J61 A;  2OYI A;  1FZD A;  2J3O A;  1FZE C;  1Z3U A;  2XNX B;  2FFD C;  1FZC B;  2OYH B;  2JHI F;  1LTJ C;  4M7H A;  2A45 G;  1FZC A;  1JY2 P;  2A45 H;  2OYH A;  3H32 C;  1FZA C;  1JY2 N;  3GHG C;  1FZB C;  2J3F D;  1RE3 B;  1RF0 C;  2HLO C;  1JC9 A;  2Z4E B;  2Q9I B;  2A45 I;  1LWU B;  2JHK F;  1M1J C;  1RE3 A;  2Z4E A;  2Q9I A;  1N73 B;  1RE4 C;  2J2P A;  1LTJ A;  1LT9 B;  2HPC C;  1LWU A;  2JHH C;  3E1I C;  1N86 B;  3FIB A;  1FZG B;  2H43 A;  2D39 A;  4EPU A;  1FZF C;  1FZB A;  1N73 A;  1LT9 A;  1N86 A;  2HOD C;  1FZE B;  1FZG A;  2J0Y A;  4NYT A;  2FFD B;  2J60 A;  2JHM F;  1JY2 O;  1M1J A;  2WNP F;  1FZE A;  2FFD A;  2GY7 A;  3BVH C;  2J5Z A;  3E1I A;  1RF1 C;  1LTJ B;  1JY3 P;  1FIC A;  2OYI C;  3H32 B;  1FZA B;  1JY3 N;  1FZF A;  2H43 B;  4ZFG A;  4R9J A;  3GHG B;  1FIB A;  1FZB B;  2HOD A;  3HUS C;  2J3F A;  1RF0 B;  3H32 A;  1FZA A;  3GHG A;  1M1J B;  2XNX C;  1W2E A;  1RF0 A;  2HLO A;  2JHL F;  4M7F A;  3BVH A;  1FID A;  2HPC B;  1RF1 A;  1FZC C;  1RE4 B;  3E1I B;  2OYH C;  4JYO X; 
#chains in the Genus database with same CATH topology
 1BGY D;  4QMA A;  3WUU A;  4ZMD A;  3HRN A;  1NTM K;  1GZL A;  1Z56 A;  1WMK A;  3H1K E;  2OAR A;  2OTJ P;  4JYC A;  2YO2 A;  2V7Q J;  4O9B A;  3CL3 D;  4PJ0 E;  3VP9 A;  4I6M C;  1JM0 A;  2YXR B;  3JCU H;  3C8V A;  3R2P A;  4U3F J;  1SQB G;  1LJ2 A;  4Y28 J;  3Q1M A;  4OVN F;  2K37 A;  2YO3 A;  1NTM E;  2W27 A;  3RK2 B;  2FYN B;  2WQY C;  4XFJ A;  1QL2 A;  2JP3 A;  4EI2 A;  3GHG C;  3B5N D;  2J3F D;  2IFM A;  3CWB G;  2HLO C;  1NKZ B;  3CCV P;  1EDJ A;  1BCC J;  1PPJ E;  1M1J C;  2Z5H A;  4H13 C;  1EXJ A;  4HH2 A;  3CPW O;  1NOH A;  2JHH C;  4NPD A;  4DJG A;  1JEK A;  5CCG A;  1EXI A;  3H1L J;  4ZKP A;  5AW7 B;  1SQV D;  2N1T D;  2R44 A;  1HBW A;  2E76 C;  3AE2 C;  4XE5 B;  1N7S A;  2KSE A;  4ZFG A;  1T2K D;  2B9B A;  2AXC A;  1K8A Q;  4U3F G;  3D6Z A;  2B87 B;  1R5L A;  1VQ6 P;  1NTZ D;  3HUS A;  2IX7 C;  4YXD C;  3AE4 C;  3FXD A;  4JZC A;  2J0H A;  3L74 G;  1RY3 A;  2M5A A;  2Z4E C;  1BCC G;  3M0D A;  1FDO A;  1P84 E;  2M0B A;  3P7K A;  1QVF O;  4H0L C;  5KAI E;  3CXH I;  1PP9 D;  1L0N K;  1E5W A;  3H1I J;  2C9L Y;  3H1J J;  2KLV A;  3L71 J;  3L75 D;  3RL0 g;  3Q2Y A;  4PV1 C;  2KP8 A;  1FZA C;  4L73 A;  3V5B A;  4LC1 A;  4HKZ H;  1FJK A;  3KZI E;  2Q9I B;  4BXL A;  5AW8 B;  2E74 D;  2FBW C;  2Q9I A;  2WSF J;  3FIB A;  2BAS A;  1RH5 B;  1AV1 A;  1L0N E;  2SPZ A;  1P84 I;  1GK6 A;  2QJP B;  1J1E B;  1Q2N A;  4NPF X;  2A06 G;  2YMY A;  2FKW B;  1WRG A;  1GW3 A;  2QG4 A;  1MUU A;  2IDB A;  1EZV G;  3VMY A;  1NU1 J;  2IBZ D;  1VQ4 P;  1NAF A;  4IL6 E;  2YKO A;  1M90 Q;  2NPS D;  3P32 A;  3FXE A;  1HF9 A;  1NHL A;  3L73 J;  1YHQ P;  5TIS H;  1KQL A;  3CXH H;  3L72 J;  3T97 A;  1RE4 B;  1OVR A;  1RF1 A;  5APX A;  3EFG A;  3H1I G;  2HYN A;  3H1J G;  5GTH E;  3RK2 C;  3L71 G;  1RE4 A;  5KLV J;  2PP6 A;  2Q3I A;  5APV A;  1KYO D;  1Q90 D;  4R4M A;  3AE1 C;  3E1R A;  5CCG C;  1S1C X;  3VTP C;  1T3U A;  1NH4 A;  1OW8 A;  4WY4 B;  2XNX B;  3TF5 A;  3CCJ P;  4WY4 A;  3R4Y A;  2D2C B;  2XND H;  1FAV A;  5AVW B;  5E79 E;  1SFC B;  2QIW A;  1OMI A;  3I56 P;  4K35 A;  1YJ9 P;  1SFC A;  2FYU K;  5DJT B;  2A45 I;  3L73 G;  1OXZ A;  3L72 G;  1IK7 A;  2KI7 B;  1VQN P;  1PFI A;  2QVA A;  3L36 A;  1VQ9 P;  4OWF A;  2ZAE B;  5KLV G;  2E42 A;  4JF7 A;  1ZOY C;  1FZE B;  4HJG H;  2JHM F;  3EQ2 A;  1PZQ A;  4OGQ D;  1FZE A;  2GY7 A;  1DEB A;  1SP4 A;  1NTK K;  3G6E P;  1JY3 P;  1L0L K;  1AVY A;  2FYU E;  3IAO A;  2HOD A;  2ZT9 D;  1ZME C;  3H1H E;  3H1K J;  1W2B O;  1SQQ D;  2JR8 A;  5B5E E;  1KD1 Q;  1FBM A;  2W8Z A;  3AE6 C;  1H0T A;  3Q5R A;  1NO4 A;  3AE7 C;  1NTK E;  4R9T A;  2KNC A;  3OJA B;  1M56 D;  2Q9I C;  4H44 D;  3A0B H;  3H1L E;  2WT7 B;  1GMJ A;  1FS0 E;  1L0L E;  4C7N B;  2XZR A;  1K73 Q;  2HFE D;  1NTM J;  2KZJ A;  2WSC H;  4C7N A;  1JTH B;  1KIL E;  1OIP A;  1Z3U A;  1URQ A;  3CLQ A;  3FX0 A;  2QJP C;  1J1E C;  1OX3 A;  4N78 E;  1SQX D;  4GT1 A;  2M3B A;  3KYQ A;  3VYI A;  1KIL A;  3S9O A;  1HJB A;  1HTL C;  1IZN B;  3M9B A;  2JO1 A;  3P8M C;  3L74 D;  2W90 A;  1VQ8 P;  4IOI H;  3U1A A;  3H1K G;  2WIT A;  3CC2 P;  1QEX A;  2GUV A;  1RE4 C;  3N7N A;  4D6T E;  3CCU P;  3A0H H;  3CCR P;  3E1I A;  1S5L H;  4C46 A;  1L4A A;  1NTM G;  2V7Q H;  3C1L A;  5K5G B;  2M8R A;  1PGQ A;  4R9J A;  2JWA A;  2FXM A;  3JSV C;  2E43 A;  4RKU J;  4I1L A;  1S72 P;  4WY4 C;  2K3R A;  4N3Y B;  2UWJ E;  2XNX C;  1JNM A;  2GA1 A;  1NU1 K;  1Q81 Q;  1GW4 A;  2D2C C;  5AW4 B;  5APS A;  1OZH A;  1OVU A;  2FXO A;  1SFC C;  1YI2 P;  3RBZ A;  2Q7C A;  1RQV A;  2KK7 A;  2HLO B;  3MUD A;  1JCD A;  3G71 P;  3BVH B;  5AW2 B;  2RKL A;  2Y0D A;  4UB6 E;  2XKM A;  4EYY Q;  5APT A;  2HR3 A;  1LTI C;  4AQR D;  1IFN A;  1NU1 E;  4W80 A;  3A3Y B;  1FZE C;  2OGU A;  3I55 P;  3L71 D;  5KJ7 A;  3WU2 H;  1L0N J;  2IFN A;  3PTZ A;  1FJP A;  2K9J B;  3CX5 E;  2QEX P;  5BU5 A;  2K9J A;  1N73 B;  3JCU E;  2CPB A;  1ZRT E;  4H13 D;  1FZG B;  1BDC A;  1N73 A;  1DIP A;  1FZG A;  1VQM P;  3CI9 A;  1U7J A;  3CCM P;  2ZJS E;  2P67 A;  1X0T A;  5GTI E;  1LTJ B;  4DOJ A;  1X9V A;  2WSE J;  1FZF A;  3GG2 A;  1FZB B;  2E76 D;  5AVS B;  3L70 E;  1S2E A;  2WPV B;  1GU5 A;  1LNQ A;  2JHL F;  5AVZ B;  2BEQ D;  3VP8 A;  1BGY E;  4JYO X;  3CX5 I;  1SS1 A;  3ABV C;  1L0N G;  1R8E A;  1KV4 A;  4ASV A;  4PV1 B;  5CBN A;  1SVF A;  1PGO A;  3JC2 2;  3VOP A;  2J61 B;  1PGP A;  2P10 A;  2WSF H;  2XV5 A;  5CMZ A;  2J61 A;  2J3O A;  1KB9 H;  4H0L D;  3OW2 O;  3LW5 J;  1FU1 A;  1FZC B;  1N2D C;  1KFM A;  3G4S P;  1SQV K;  2A45 G;  1FZC A;  1BE3 D;  2OTK E;  3TSI A;  3SFE C;  1KZU B;  2JHK F;  1Y8A A;  1A02 F;  5APY A;  3B5N A;  2CK3 H;  2FYU J;  1SQP D;  4EPU A;  1NTZ K;  2Y0E A;  4IFD K;  2E5T A;  3MUD C;  1N7L A;  3H1H J;  2ZVN B;  3M91 A;  4BWN A;  1J2J B;  1SQV E;  2R3C A;  4CPG A;  3BVH C;  1EC5 A;  2RN0 A;  1CW5 A;  1JB0 J;  1G1J A;  3D71 A;  5KTB A;  4N6J A;  2Y9Z A;  4KT0 J;  1NTK J;  2WPS A;  5KJ7 C;  1DD3 A;  1L0L J;  4GDO A;  4ZNC A;  1GL2 B;  1NTZ E;  5KAF H;  2DW3 A;  1N7S B;  1GL2 A;  2J64 A;  1IC2 A;  3RK2 D;  1T3J A;  3RK3 E;  3VN0 A;  5AVV B;  1X8Y A;  1USD A;  3P8C D;  2YMK A;  3RK3 B;  1N73 C;  3QH9 A;  2FYU G;  2O1J A;  3HUS B;  1FZG C;  4A7P A;  2IYO A;  4GOD A;  5CCG D;  1WT6 A;  2K88 A;  1PPJ D;  2MJZ A;  3W67 A;  3W68 A;  3H1H G;  2M5A B;  3PLN A;  2Z5I A;  4GIF A;  2ZYA A;  3AEF C;  2KSJ A;  4EDF A;  2J58 A;  1HH0 A;  4TT3 H;  3TK1 A;  3L75 E;  1LTJ C;  3CCE P;  4D6T J;  1G2C A;  1BSN A;  1FZB C;  2BCC D;  1HJ0 A;  3SWF A;  1NTK G;  1LWU B;  3CXH D;  1ZN5 A;  3H1L G;  1L0L G;  4PD4 E;  1EDK A;  2H88 C;  5AW9 B;  1LWU A;  2E75 B;  4PJ0 H;  3PJS K;  3WUV A;  1KTM A;  1GDT A;  2WZ7 A;  2W83 C;  1IFD A;  2QJK B;  2IBZ E;  3H6P A;  4W7Y A;  1HWT C;  3U1C A;  2WWW A;  1ZXG A;  1YIJ P;  2OTL P;  4I2L C;  4Y99 B;  1FID A;  1FZC C;  2NPS A;  1J1D B;  3SSU A;  4JBZ A;  2WPR A;  4UB8 E;  1FE6 A;  2KXP B;  4D6T G;  1RHZ B;  4PD4 I;  2YKQ A;  1KYO E;  1IFJ A;  2JKV A;  3B5N C;  3T97 B;  1RF1 B;  1ZR4 A;  2LKM A;  3Q5P A;  2PGD A;  2IBZ I;  3TGU D;  4WVZ A;  3S1K A;  1MFT A;  2QM8 A;  1K9M Q;  5AW6 B;  3ZDM A;  3HTK A;  3BCC J;  1JY2 N;  1AFO A;  3BRT B;  3FGA D;  2AEM A;  2ZYD A;  2GM4 A;  2KOG A;  5AVT B;  3MGN A;  1P84 H;  1GL2 C;  3CC4 P;  1SQQ K;  1YQ3 C;  2JEE A;  1H8A A;  2H43 A;  2KIK A;  1N7S C;  3NFQ A;  5KAI H;  4B86 A;  1KYO I;  2R5D A;  3L70 J;  1NU1 G;  2J0Y A;  1JY2 O;  2JJL A;  3PP5 A;  2W6J H;  1BGY J;  2WMM A;  3RK3 C;  3A5T A;  1DEE G;  2ZFC A;  3HUS C;  4L76 A;  1LTG C;  1K05 A;  1SQB D;  1SQQ E;  3KZI H;  5AVX B;  1T6A A;  1VQK P;  3M0D C;  4WY4 D;  3SWY A;  1Z3S A;  3BAS A;  2D2C D;  2HOD B;  3CWB D;  1SFC D;  1VQO P;  4RO0 A;  1SLQ A;  2J0G A;  1LWU C;  3WUT A;  1KQS O;  1H0T B;  2JWD A;  2E75 C;  1OVV A;  1VDF A;  3L70 G;  3AED C;  1OFC X;  4HYT B;  2RH0 A;  1LP1 A;  2KNC B;  2KS1 A;  1SQX E;  5H2F H;  2MKV A;  1PL5 A;  3SFD C;  2QJK C;  1BGY G;  3AEB C;  2A45 H;  2WSE H;  5GTH H;  5AVY B;  3V4Q A;  1URQ B;  3BAT A;  4WB4 A;  4U3F D;  1SQV J;  4Y99 C;  1LT9 B;  1KIL B;  1J1D C;  1N86 B;  1IO4 A;  2YNY A;  4R4L A;  1LT9 A;  3USS A;  1N86 A;  3RL0 B;  1S4X A;  2FFD B;  4C7R A;  1BCC D;  2ITA A;  2FY8 A;  4L74 A;  2FFD A;  1NTZ J;  1RF1 C;  3CC7 P;  3O8Z A;  2ZXX A;  5E79 H;  2H7H A;  3G9R A;  2C0W A;  5AW0 B;  1OWA A;  3H1L D;  3RBX A;  3LW5 H;  5AW5 B;  3E1I B;  1L4A B;  3C9I A;  1YBK A;  1Q86 Q;  2YIU C;  4RJT A;  4YXW H;  5M1B A;  2Q6Q A;  1U57 A;  1PIX A;  5B66 E;  1EDL A;  1SQV G;  2H43 C;  5AVU B;  3L75 J;  1PV3 A;  3D6Y A;  1M1K Q;  2O01 J;  4W7Z A;  2FXP A;  1USE A;  2VRS A;  2A06 D;  2AXT E;  5CHX A;  5B5E H;  4IFM A;  1NTZ G;  3MP7 B;  1EZV D;  5CJ4 A;  3HD7 B;  1VF5 B;  3OAK A;  3HD7 A;  1FDM A;  2WPQ A;  4IL6 X;  3H1I D;  3L4F A;  1D7M A;  3H1J D;  2D39 A;  3AEA C;  3FWN A;  2HOD C;  1VQ5 P;  1M1J A;  1QGK B;  3MIW A;  3L75 G;  3H32 B;  1HGV A;  1KB9 D;  1RF0 B;  3H32 A;  4K3A A;  2LXB A;  2Q3E A;  3TNU B;  3BCC E;  1W2E A;  1QLE D;  1RF0 A;  2HPC B;  3TNU A;  1ZV8 A;  5KJ7 D;  1X79 B;  2E5Y A;  2P1J A;  1U7M A;  1FZF B;  1NU1 D;  2HPC A;  1OW7 A;  1CSB A;  1QVG O;  4U7J A;  2J1G A;  2QA4 P;  2AEF A;  1S9K D;  1URQ C;  3L73 D;  3II6 A;  1UIX A;  3L72 D;  3HE5 B;  3IF4 A;  2IBZ G;  1LT9 C;  1TU3 F;  4L75 A;  1KIL C;  1N86 C;  1AA0 A;  4JYB A;  3HE5 A;  4DZO A;  4GOF A;  4YPC A;  5KLV D;  1SQP K;  1YJN P;  3RL0 C;  5KLI B;  2FFD C;  2QJY B;  2YXQ B;  1FC2 C;  1M57 D;  5CCH A;  3F89 A;  1BE3 E;  1DD4 A;  1JMM A;  1RE3 B;  4EOT A;  3A7O A;  1AJY A;  2KB7 P;  1RE3 A;  2WVR A;  2H8P D;  1IK9 A;  1KQF B;  1SQP E;  3E1I C;  4UB6 H;  1L4A C;  1E79 H;  1FOS F;  2JDI H;  1SQQ J;  2WNP F;  1NJI Q;  2CPS A;  3B4S A;  2KLU A;  3M06 A;  4PV1 D;  3GLM A;  3B5N B;  1FIC A;  2XDJ A;  3B8E B;  1PGJ A;  1JY3 N;  1ZLL A;  3EWK A;  2OQQ A;  2J3F A;  2KZI A;  1XTC C;  4HB1 A;  2G8Y A;  2W6A A;  2QM7 A;  3CX5 H;  1CI6 B;  2N9B A;  2BEZ F;  4AYC A;  2QSI A;  1VL2 A;  2L5G B;  5AVQ B;  1CI6 A;  1ZP0 C;  5APW A;  3IR9 A;  1W5C E;  3HD7 C;  1JY3 O;  2N1T B;  2AEJ A;  3PHL A;  1HGZ A;  1VF5 C;  1SQX J;  3H1K D;  3CD6 P;  1H88 A;  3P8C E;  1KMI Z;  2K9Y A;  2N1T A;  3D70 A;  5GTI H;  3L74 J;  3HE4 B;  1JO5 A;  1K04 A;  3HE4 A;  1SQQ G;  3AEG C;  3A2A A;  1AQT A;  1T8Z A;  3RGU A;  1JOC A;  1NTM D;  1ZW0 A;  5DJU B;  3H32 C;  1HUC A;  2BCC E;  2HG5 D;  3Q3D A;  1RF0 C;  5AW1 B;  1M8O B;  5TIS E;  3CCS P;  3CXH E;  4ZKU A;  3GMA A;  3GW6 A;  1PP9 E;  1YQ4 C;  3QWO C;  2J2P A;  2HPC C;  5AVR B;  3AEC C;  2P7J A;  1MFZ A;  1GL2 D;  1FZF C;  2L91 A;  1G2C B;  3IFM A;  1NVO A;  2I8D A;  1N7S D;  2M3E A;  3I5C A;  1JMB A;  1SQX G;  1MV8 A;  1AQ5 A;  2B87 A;  1YIT P;  3RK3 D;  2E74 B;  4JPZ B;  1LTA C;  5CCH C;  3VMX A;  5KLI C;  2QJY C;  4M7F A;  1Y47 A;  3G3Z A;  2W6B A;  4I7Z B;  2PRR A;  3V2Q A;  3WMM 0;  1RE3 C;  2J3G A;  2ZYG A;  3KPE A;  1GK4 A;  1KQG B;  2IYP A;  1KOR A;  3M0A A;  2OYO A;  1P84 D;  2NPS B;  2OYI B;  3MTU E;  5APU A;  3NTN A;  4EIJ A;  2PAJ A;  3IN6 A;  4DT0 A;  2OYI A;  1YTZ I;  2E75 D;  3V4W A;  3TGU E;  2YKP A;  4LLH A;  4IFF A;  4PD4 D;  3K5B A;  2Q1K A;  2C9N Y;  2I1K A;  1BDD A;  1N8R Q;  2C0X A;  2WTY A;  1SQB K;  2R32 A;  1L2P A;  3V2N A;  3HTK B;  2POH A;  1S3J A;  3LID A;  5H2F E;  1L0N D;  2ZVO B;  3MHV A;  3AE3 C;  2GUS A;  4NYT A;  1NKN A;  2YIU B;  3A0B E;  4YTP C;  3CMA P;  2J60 A;  2N1T C;  3L37 A;  4BRY B;  2FYN C;  1T2K C;  4BRY A;  2H43 B;  4TLF A;  3S4R A;  1AVO A;  1SQB E;  4WWI A;  2O01 H;  4MN4 C;  1OW6 A;  1IJD B;  2ZXE B;  4PD4 H;  1NWQ A;  1GU4 A;  1GTW A;  3GF7 A;  4KHX A;  4OGQ B;  3CWB E;  2NRG A;  2XNX A;  4NPE A;  2IZ0 A;  2R3S A;  2ZT9 B;  1VQ7 P;  1BE3 J;  3V2R A;  4OH8 B;  2Y9Y A;  1Y9B A;  3E7K A;  5BU8 B;  5KKZ B;  1G1I A;  1A02 J;  2V4H A;  1MZ9 A;  1SQX K;  1YJW P;  3A0H E;  3V6I A;  2P2U A;  1HVV A;  3BCC G;  1S5L E;  2OYH B;  3VMA A;  1SQP J;  2OYH A;  4UB8 H;  2O01 N;  4H44 B;  3CCL P;  2E74 C;  4U3F E;  2QRX A;  1LP1 B;  2KS1 B;  4IL6 H;  1KYO H;  3AE9 C;  4I7Z C;  1EDI A;  2FYZ A;  3L74 E;  1GD2 E;  1ZR2 A;  1BCC E;  1R5S A;  5AW3 B;  1DH3 A;  1NAY A;  5BVZ A;  1Q7Y Q;  5CBO A;  2NPS C;  2J59 M;  2OYI C;  1BE3 G;  2FYU D;  4M3L A;  1EQ7 A;  1NGM B;  1IFI A;  3H1H D;  2WT7 A;  1VQL P;  1IFM A;  2Y0C A;  3N4X A;  3WU2 E;  1UII A;  3KQG A;  1SQP G;  4AUW A;  3BRV B;  1JTH A;  1FDI A;  4KJM A;  4ASW A;  1YTZ T;  1JCC A;  5EFW B;  3V2P A;  3SWK A;  1NTK D;  2RMZ A;  2K1A A;  1L0L D;  1URQ D;  2KYV A;  3PRJ A;  2BCC J;  1MKM A;  3AE5 C;  1KIL D;  2A06 E;  2XU6 A;  3RL0 D;  3B71 A;  1PP9 J;  4N78 D;  3TYY A;  2R5B A;  2G3A A;  1EZV E;  4M7H A;  1Q82 Q;  3GF3 A;  2Q5U A;  2LR2 A;  1CZQ A;  2B88 A;  2NZ2 A;  4GKG A;  1RQU A;  3H1I E;  2WSS H;  3H1J E;  3L71 E;  4LGD E;  4XA4 A;  4D6T D;  3H25 A;  1L4A D;  1PPJ G;  3U59 A;  4OGQ C;  3FWL A;  3NMD A;  2O3J A;  2ZT9 C;  2N9Y B;  3GHG B;  1FIB A;  1BSH A;  1H89 A;  1KB9 E;  3KDP B;  2H89 C;  2BCC G;  4GOE A;  5KKZ C;  2O1K A;  3KHU A;  3GHG A;  4JQ0 D;  1EZV I;  5KLV K;  1M1J B;  2HLO A;  2I1J A;  2LXC B;  2QE7 H;  4H13 B;  3TDK A;  5APQ A;  3BVH A;  1PP9 G;  3M9Q A;  2OYH C;  1VQP P;  2FIB A;  3CCQ P;  2J3U A;  4DCK A;  4H44 C;  3M9H A;  3TGU J;  1IFP A;  2IZ1 A;  3OA7 A;  1KFN A;  1S9K E;  3L35 A;  2P58 A;  3L73 E;  3HD7 D;  3L72 E;  1XTG B;  2E76 B;  1VF5 D;  2PFX A;  3KXD A;  5KLV E;  5C39 A;  1FZD A;  3VMZ A;  1LGH B;  1KC8 Q;  3MZW B;  2J5U A;  1KB9 I;  2JHI F;  3PH0 A;  2KUB A;  1QL1 A;  1JY2 P;  3UIA A;  1VPC A;  5L8R J;  1JC9 A;  2Z4E B;  3CX5 D;  3AE8 C;  3MD0 A;  1FOS E;  5TJH A;  1LTT C;  5B66 H;  2Z4E A;  5KAF E;  2WSC J;  3CME P;  1LTJ A;  1QX8 A;  3Q5S A;  4H0L B;  1ZRT D;  1FZB A;  1NYH A;  3BCC D;  1SQB J;  2B89 A;  3EFF K;  1X22 A;  3TGU G;  1KN7 A;  4WBA A;  2AXT H;  1LTB C;  2J5Z A;  4RES B;  1FZA B;  3F5H A;  1S5L X;  1JUN A;  3CWB J;  1FZA A;  3L70 D;  1YYC A;  3LIE A;  3O6Q B;  2IPP A;  3NXS A;  3AEE C;  1LTS C;  4Z1M H;  1M7L A;  1LT1 A;  3O6Q A;  5CCH D;  5CJ0 A;  3ITK A;  1DX7 A; 
#chains in the Genus database with same CATH homology
 1Z3S A;  3BAS A;  1SFC C;  2HOD B;  3V2Q A;  3HRN A;  1NTM K;  1GZL A;  3WMM 0;  1Z56 A;  1RE3 C;  1SFC D;  2J3G A;  2Q7C A;  1SLQ A;  2J0G A;  2OAR A;  3MUD A;  1JCD A;  2HLO B;  3KPE A;  1GK4 A;  1LWU C;  4JYC A;  3BVH B;  2YO2 A;  3M0A A;  5AW2 B;  2NPS B;  4O9B A;  2OYI B;  3MTU E;  2XKM A;  3CL3 D;  3VP9 A;  5APU A;  5APT A;  4I6M C;  3NTN A;  4EIJ A;  2PAJ A;  1LTI C;  4AQR D;  2OYI A;  1IFN A;  1YTZ I;  1VDF A;  3V4W A;  4W80 A;  3A3Y B;  3R2P A;  1FZE C;  2YKP A;  4HYT B;  4LLH A;  4IFF A;  5KJ7 A;  2YO3 A;  2W27 A;  2C9N Y;  3RK2 B;  2A45 H;  2WSE H;  5AVY B;  2I1K A;  1QL2 A;  3GHG C;  2IFN A;  3B5N D;  2J3F D;  2IFM A;  1FJP A;  2HLO C;  3V4Q A;  1NKZ B;  1URQ B;  2C0X A;  3BAT A;  4WB4 A;  5BU5 A;  2WTY A;  1M1J C;  2Z5H A;  4Y99 C;  4HH2 A;  1SQB K;  1N73 B;  1LT9 B;  1NOH A;  1KIL B;  2CPB A;  2JHH C;  1J1D C;  1N86 B;  1IO4 A;  2R32 A;  3V2N A;  3HTK B;  1FZG B;  2YNY A;  2POH A;  1N73 A;  1LT9 A;  5CCG A;  3LID A;  1N86 A;  3RL0 B;  1FZG A;  2GUS A;  4NYT A;  2FFD B;  1NKN A;  3CI9 A;  4ZKP A;  4C7R A;  2J60 A;  2N1T C;  5AW7 B;  3L37 A;  2FFD A;  2P67 A;  2N1T D;  1RF1 C;  1LTJ B;  4DOJ A;  1HBW A;  1T2K C;  1X9V A;  3O8Z A;  4XE5 B;  1N7S A;  2H43 B;  1FZF A;  4ZFG A;  2H7H A;  1FZB B;  1T2K D;  5AVS B;  2C0W A;  5AW0 B;  1OWA A;  2O01 H;  1GU5 A;  3LW5 H;  2JHL F;  1IJD B;  5CJ0 A;  5AVZ B;  5AW5 B;  2ZXE B;  3VP8 A;  3E1I B;  4JYO X;  1L4A B;  1NWQ A;  1GU4 A;  1GTW A;  3C9I A;  3HUS A;  4KHX A;  2IX7 C;  1SVF A;  4JZC A;  2J0H A;  2XNX A;  1RY3 A;  2Z4E C;  3VOP A;  3M0D A;  3P7K A;  2H43 C;  5AVU B;  2J61 B;  3V2R A;  4OH8 B;  2WSF H;  2XV5 A;  5CMZ A;  5BU8 B;  2J61 A;  2J3O A;  1G1I A;  1A02 J;  1MZ9 A;  1SQX K;  4W7Z A;  2P2U A;  1HVV A;  1FU1 A;  1L0N K;  2VRS A;  1E5W A;  1FZC B;  1N2D C;  5CHX A;  2OYH B;  1KFM A;  2C9L Y;  4IFM A;  2KLV A;  1SQV K;  2A45 G;  1FZC A;  5CJ4 A;  2OYH A;  2KP8 A;  1FZA C;  3HD7 B;  3V5B A;  3TSI A;  4LC1 A;  1FJK A;  2Q9I B;  3OAK A;  3HD7 A;  1KZU B;  5AW8 B;  2JHK F;  1FDM A;  2WPQ A;  2Q9I A;  1A02 F;  5APY A;  3B5N A;  3L4F A;  3FIB A;  2BAS A;  2D39 A;  4EPU A;  2FYZ A;  1NTZ K;  2HOD C;  4IFD K;  1N7L A;  1GK6 A;  1J1E B;  3M91 A;  1GD2 E;  1ZR2 A;  1J2J B;  1M1J A;  2YMY A;  2FKW B;  3MIW A;  5AW3 B;  1DH3 A;  2R3C A;  1WRG A;  1GW3 A;  5BVZ A;  3BVH C;  1MUU A;  3VMY A;  2NPS C;  2J59 M;  1CW5 A;  2OYI C;  3H32 B;  1HGV A;  1G1J A;  1NAF A;  2YKO A;  4M3L A;  2NPS D;  3P32 A;  5KTB A;  1RF0 B;  4N6J A;  1NHL A;  1EQ7 A;  3H32 A;  1IFI A;  3TNU B;  1W2E A;  2WPS A;  5KJ7 C;  1RF0 A;  1KQL A;  2WT7 A;  3T97 A;  2HPC B;  1GL2 B;  1IFM A;  1ZV8 A;  5APX A;  3EFG A;  3N4X A;  3TNU A;  1RF1 A;  5KJ7 D;  1X79 B;  2HYN A;  3KQG A;  1N7S B;  2P1J A;  4AUW A;  3RK2 C;  1FZF B;  3BRV B;  1RE4 A;  1GL2 A;  2HPC A;  1JTH A;  2PP6 A;  2J64 A;  1IC2 A;  1CSB A;  3RK2 D;  2J1G A;  1YTZ T;  1JCC A;  2Q3I A;  1T3J A;  3V2P A;  3VN0 A;  5AVV B;  1URQ C;  1S9K D;  3II6 A;  5APV A;  1X8Y A;  3P8C D;  3HE5 B;  1URQ D;  3RK3 B;  2KYV A;  1N73 C;  1LT9 C;  5CCG C;  1KIL C;  1N86 C;  2O1J A;  3VTP C;  1T3U A;  3HUS B;  4JYB A;  3HE5 A;  4DZO A;  1FZG C;  5CCG D;  1WT6 A;  1KIL D;  1SQP K;  1NH4 A;  4WY4 B;  3RL0 C;  2MJZ A;  2XNX B;  2FFD C;  2XU6 A;  2Z5I A;  3RL0 D;  4GIF A;  4WY4 A;  1RE4 B;  4N78 D;  2KSJ A;  5CCH A;  3TYY A;  2J58 A;  2R5B A;  1HH0 A;  3TK1 A;  1LTJ C;  4M7H A;  1FAV A;  5AVW B;  1SFC B;  1G2C A;  1FZB C;  1JMM A;  1RE3 B;  4EOT A;  1SFC A;  2FYU K;  2Q5U A;  3A7O A;  3SWF A;  2A45 I;  1LWU B;  2KB7 P;  1OXZ A;  1RE3 A;  1ZN5 A;  1CZQ A;  2H8P D;  1IK9 A;  4GKG A;  5AW9 B;  1LWU A;  3E1I C;  1PFI A;  3L36 A;  1L4A C;  4LGD E;  1FOS F;  2E42 A;  4XA4 A;  4JF7 A;  1L4A D;  3U59 A;  1FZE B;  2JHM F;  3EQ2 A;  1GDT A;  2WNP F;  2WZ7 A;  2CPS A;  1FZE A;  3M06 A;  1IFD A;  3NMD A;  2GY7 A;  1DEB A;  1SP4 A;  1NTK K;  1JY3 P;  3B5N B;  1FIC A;  2XDJ A;  3H6P A;  3B8E B;  4W7Y A;  1L0L K;  1JY3 N;  1ZLL A;  3GHG B;  1HWT C;  1H89 A;  3KDP B;  1FIB A;  2HOD A;  3U1C A;  2J3F A;  1XTC C;  2WWW A;  2O1K A;  2W6A A;  2QM7 A;  3GHG A;  4I2L C;  5KLV K;  1M1J B;  1CI6 B;  2N9B A;  2HLO A;  2I1J A;  4AYC A;  4Y99 B;  5APQ A;  3BVH A;  5AVQ B;  1FID A;  1FZC C;  3M9Q A;  1FBM A;  2NPS A;  1J1D B;  1CI6 A;  2OYH C;  2WPR A;  2FIB A;  5APW A;  3IR9 A;  1NO4 A;  2J3U A;  3HD7 C;  3M9H A;  3OA7 A;  1JY3 O;  1KFN A;  2N1T B;  3L35 A;  1S9K E;  4R9T A;  2YKQ A;  3OJA B;  1HGZ A;  2Q9I C;  3HD7 D;  2WT7 B;  1IFJ A;  3B5N C;  3P8C E;  4C7N B;  1H88 A;  1RF1 B;  1XTG B;  2N1T A;  2XZR A;  2HFE D;  2WSC H;  1ZR4 A;  2LKM A;  4C7N A;  1JTH B;  3HE4 B;  1FZD A;  3VMZ A;  1LGH B;  1Z3U A;  1JO5 A;  1URQ A;  3CLQ A;  3HE4 A;  1J1E C;  3A2A A;  4N78 E;  4GT1 A;  2JHI F;  2M3B A;  2QM8 A;  1T8Z A;  3KYQ A;  3VYI A;  1QL1 A;  1KIL A;  1JOC A;  5AW6 B;  1HJB A;  1HTL C;  1JY2 P;  3HTK A;  3UIA A;  3H32 C;  3M9B A;  1HUC A;  1JY2 N;  3P8M C;  1VPC A;  2HG5 D;  1RF0 C;  5AW1 B;  1JC9 A;  2Z4E B;  3U1A A;  1AFO A;  3MD0 A;  3BRT B;  4ZKU A;  1FOS E;  1LTT C;  2GM4 A;  2WIT A;  2KOG A;  2GUV A;  2Z4E A;  5AVT B;  3MGN A;  1RE4 C;  1GL2 C;  1LTJ A;  2J2P A;  2HPC C;  1SQQ K;  2JEE A;  1H8A A;  3N7N A;  5AVR B;  2H43 A;  2P7J A;  1MFZ A;  1N7S C;  1GL2 D;  3NFQ A;  1FZB A;  1FZF C;  1G2C B;  3IFM A;  4B86 A;  2R5D A;  2J0Y A;  1N7S D;  3I5C A;  1JY2 O;  2JJL A;  1MV8 A;  1AQ5 A;  3PP5 A;  4WBA A;  1LTB C;  2J5Z A;  3E1I A;  4C46 A;  1L4A A;  3RK3 C;  3A5T A;  4RES B;  2M8R A;  1FZA B;  4R9J A;  2ZFC A;  2FXM A;  3HUS C;  3RK3 D;  1JUN A;  2E43 A;  1LTG C;  1FZA A;  4I1L A;  1LTA C;  1YYC A;  3LIE A;  2IPP A;  4WY4 C;  3NXS A;  4N3Y B;  3VMX A;  5CCH C;  2XNX C;  1LTS C;  1JNM A;  5AVX B;  1M7L A;  1NU1 K;  4M7F A;  3G3Z A;  2W6B A;  3M0D C;  4WY4 D;  5CCH D;  1GW4 A;  3SWY A;  5AW4 B;  5APS A;  2L5G B;  1DX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...