2FFDC

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E Chain
total genus 83
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2ffdC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2ffdC03
4JZCA 2Z4EB 2HPCC 2FIBA 3E1IA 4M7HA 1N73A 2OYHB 1FZEA 1RF0B 2J1GA 4M7FA 4ZFGA 1M1JC 1LWUC 2A45H 1FZEB 1RF0A 1RF0C 2A45G 1FZBB 2XNXC 1LWUB 2Q9IA 1M1JB 1JY2N 1FZBC 2XNXB 3H32B 2FFDA 4JYOX 2FFDC 1JY3P 1LT9B 2D39A 2HLOC 1FZGA 3H32C 1N86A 2JHLF 2HLOA 4R9TA 2Z4EC 1FZGC 1FZEC 1Z3UA 3GHGA 2WNPF 1FZGB 1RF1C 1JY2O 1JY3O 2J2PA 2OYHA 1FZAC 2HODB 1FZAA 2J3FA 2J5ZA 2XNXA 1LWUA 2HODC 1FIDA 2HODA 4R9JA 1FZAB 2J60A 1FZCC 2Q9IC 4EPUA 3H32A 1FZFC 1FZFA 2HLOB 1N73B 2JHMF 1JY3N 1LTJC 3E1IB 2A45I 2Z4EA 2J3UA 2J3GA 3BVHC 3BVHA 1RF1A 2J64A 1W2EA 2J0YA 2J3FD 1RE4A 1N73C 1RE4B 1LTJA 2JHHC 1LTJB 1LT9A 1RF1B 3BVHB 1JY2P 2J0GA 2OYIB 2Q9IB 1M1JA 1FZDA 2H43B 1FZBA 1FZFB 1FZCA 1N86B 1RE3A 2J61B 2J61A 2J0HA 1JC9A 3E1IC 1FZCB 2HPCB 1N86C 1RE4C 3HUSC 1FICA 1T3UA 1Z3SA 2J3OA 4NYTA 3GHGC 2HPCA 3HUSA 1RE3B 3GHGB 2OYHC 3FIBA 2H43A 2JHIF 1RE3C 2JHKF 2GY7A 1LT9C 2OYIA 2OYIC 2H43C 1FIBA 3HUSB 2FFDB
chains in the Genus database with same CATH superfamily
1X8YA 3L73G 1AFOA 1KQFB 3PRJA 2WPQA 1N7SB 2E5TA 4ASWA 2WWWA 3A3YB 1LTTC 1SQBG 1LWUB 1Q82Q 3CWBJ 4W80A 2GM4A 3MZWB 1GL2D 1H0TB 3H1JD 1NTMJ 1BSNA 1LTGC 2GUVA 2O3JA 3TGUJ 4WBAA 1OXZA 5CJ4A 1R8EA 3II6A 2V4HA 1M56D 5EFWB 3TGUD 3IFMA 1EZVG 1SQBD 3D6YA 2HODA 2J60A 3AECC 1NTZJ 2KB7P 1RH5B 3VOPA 2C9NY 1D7MA 2IYPA 2NPSA 3PH0A 1LT9A 1FJKA 5AVRB 1FOSE 1GU4A 2P7JA 1FZCA 1H89A 4U7JA 2J0HA 3JC22 2E76D 3V5BA 1VQLP 1YJNP 3RBZA 1FDOA 1Z3SA 3SWFA 1NTKE 2HPCA 1URQA 2L5GB 1ZOYC 2WSCJ 3TGUG 1K05A 2M0BA 2N1TD 3CCMP 4M7HA 2YO3A 2IYOA 4ASVA 5GTHE 1S72P 4ZFGA 1M1JC 3HE4B 2FXPA 1AV1A 3AEDC 4OGQD 3M06A 5CCHD 4RJTA 2R5DA 3MUDA 4HB1A 1VQNP 4Z1MH 1N86A 5APSA 3L73D 2WT7B 1TU3F 1IK7A 3W68A 1YQ3C 1FZAC 3V4QA 1P84D 3V2RA 4R9JA 3CCEP 1OFCX 1R5LA 2Z5HA 3B5NC 3M9BA 3CCVP 2J3GA 1NTKG 3NXSA 3BVHA 4NPDA 1NTZG 1KQSO 1EZVD 1NTKK 3H1HG 3VMXA 1FZDA 1DIPA 1VQKP 1MFZA 4I6MC 2BASA 3O6QB 3VMZA 1JC9A 5GTIE 2FYNB 1N86C 1IFMA 1LGHB 3ITKA 1L4AB 2K9YA 4XA4A 4B86A 3VTPC 3WU2E 3JSVC 1A02J 2BEQD 3VMYA 2GY7A 1LT9C 4PD4I 3CX5E 1KN7A 2YXRB 1K8AQ 1K04A 4GT1A 2I1JA 3WU2H 3KPEA 5B66E 1EDIA 2HPCC 2D2CB 1N7SC 1T2KD 1QEXA 2XU6A 1NKZB 1BE3D 5M1BA 3T97A 1RF0A 1J1DC 5AVQB 1J1DB 5AVZB 3RGUA 3TYYA 3H1LG 2W6BA 3FXEA 5CCGC 2QRXA 2RN0A 4JQ0D 4WY4A 2V7QH 2OTKE 1SP4A 1BE3E 3BCCJ 5B5EE 2OQQA 2P1JA 1BDDA 2P10A 1OX3A 3BVHC 1NU1K 3L74G 2O01H 1LTJA 1U7JA 2QM8A 5KKZB 1NH4A 2E76C 5KAFH 2J61B 1QVFO 2Q1KA 1MZ9A 3L72G 3PJSK 1BCCG 5KLVG 3GHGC 3L71D 3GHGB 2M5AA 5APQA 1SQXD 1RE3C 2WTYA 1AQTA 1NVOA 2ZYAA 1L0NK 3H1LJ 4WWIA 3H1ID 1DD3A 3AEFC 3HE5A 2PP6A 1FZEA 1VDFA 2BCCG 5DJTB 3CX5I 4M7FA 3RL0C 1R5SA 2A45G 3A0BH 1KILE 3CCLP 3PHLA 2FYZA 3V2NA 5CCHA 3L37A 2XKMA 4L75A 1NO4A 1PPJG 4UB8E 3L71G 2E5YA 1U7MA 2KI7B 3L72D 4YPCA 2ZAEB 3RL0g 3HD7A 3L72J 1PFIA 1HH0A 1FZAB 3A2AA 3ABVC 3HE4A 1PGJA 3CCRP 1NGMB 4H13D 1H8AA 2YKOA 4IFFA 2WT7A 5CCGA 5APUA 2E43A 2FYUK 3M9QA 4HYTB 3AEEC 2HPCB 2LR2A 5CBNA 2J3OA 5KLVJ 1AA0A 2H7HA 3H1IG 2KOGA 1RE3B 5AVYB 4HH2A 5AW6B 3KXDA 2XDJA 2JWAA 4N78D 2OTLP 2OYIC 3FWLA 1AVYA 2E74D 1FIBA 1L4AC 3L36A 1BDCA 3L72E 1LJ2A 1PPJD 2JJLA 1DEBA 3OA7A 2QIWA 3CC4P 5B66H 2XNXC 1NHLA 2Q9IA 2AXTH 3AE4C 3P8CE 1H0TA 1KD1Q 3H32C 2R3SA 2PGDA 5AW2B 1PGOA 2A06E 1Y47A 1J2JB 1Z3UA 4C7RA 1RF1C 5DJUB 1JB0J 1DX7A 1JO5A 5BU8B 1IFNA 3CWBG 1ZR2A 4D6TJ 1SQXK 1KC8Q 4JF7A 2PFXA 1L0LD 1N7LA 2IPPA 1LTJC 5CHXA 2IBZG 4D6TD 2J3UA 2AEMA 2WSSH 3V4WA 2KP8A 2Q9IB 4IL6H 2JWDA 2KLUA 1CZQA 1FZFB 3WUVA 4BRYA 2K1AA 4JBZA 1EC5A 1RE4C 3H1LE 2Q3EA 3AEBC 1XTCC 3CWBE 3S9OA 4JPZB 1SQPK 3RK2B 1KILB 3L75J 3S1KA 1VQPP 2KK7A 2OYOA 1VF5D 3RL0D 3RK2D 1URQD 1SQBJ 2KXPB 2WSEH 2FXMA 3H1HJ 1GU5A 1SQVJ 3RL0B 5AVWB 1EDKA 2G8YA 2ZJSE 3H32B 1SQVD 1SQVK 4H44B 2KZJA 1FZGA 5KLVD 4M3LA 1BE3J 1GMJA 1X79B 2HLOA 3MD0A 4KT0J 1S2EA 1CW5A 1JY3O 1BCCJ 2NPSD 1MKMA 2MJZA 3BASA 1QVGO 1IK9A 1L0NG 1SQPD 3L70G 1W5CE 1PL5A 3H1JE 1EDLA 2FBWC 2WSEJ 1SQQE 2Q6QA 2H89C 2JHHC 1RE4B 5H2FE 3RK3B 2J0GA 4IOIH 4CPGA 1JM0A 2QJKC 4UB6H 3P32A 2L91A 1RQVA 3GG2A 1QL1A 4Y28J 1VQ9P 1S4XA 1NU1G 1OVVA 5AW5B 1ZMEC 3BCCE 1SFCA 4I1LA 5BVZA 3B4SA 1Q86Q 1L0LK 3FIBA 1ZV8A 1P84E 5APYA 1PGPA 1JTHA 3L74D 1KYOD 4PD4D 4DT0A 4H44D 1DEEG 1G2CB 1SFCD 4L73A 5GTIH 1L0LE 4R4MA 3MHVA 4ZKPA 1IFIA 1LT1A 2IX7C 1J1EC 1SQQK 3GW6A 5APWA 5E79E 2UWJE 4NPEA 1HGZA 4EOTA 2FYUG 2QG4A 1M1JB 2HYNA 2Y0EA 5AW8B 3C1LA 3NMDA 4K35A 2BCCD 2D2CC 2KIKA 1M57D 3CLQA 2E75D 1QLED 3H25A 1ZLLA 4LLHA 1NU1D 3GHGA 2R44A 2OYHA 2J5ZA 1NU1J 3N7NA 4OGQB 1NTME 4H0LB 4BWNA 4PV1C 5AW0B 2ZT9D 4UB6E 2OTJP 4WY4D 1W2EA 4U3FG 5APVA 2YNYA 3CX5H 2Q5UA 2H43B 2XNDH 1FZBA 2W90A 1SQQG 2FYUD 2J58A 1WRGA 2G3AA 2N1TB 1L4AA 1ZRTE 2PRRA 2HFED 3D71A 1GTWA 5AVVB 2R3CA 3L71J 2DW3A 2YO2A 3EWKA 2W83C 1EXIA 4U3FD 1LNQA 2WQYC 3VP9A 2FIBA 3E1IA 3TDKA 1NU1E 3AEGC 1W2BO 1FAVA 1J1EB 4YXDC 3A0HE 5TISE 3IAOA 4KHXA 2YKQA 5KLVE 1SS1A 4WY4B 1T6AA 2AEJA 4LGDE 2K3RA 4H0LD 1LP1A 2KS1B 2E74B 1JMMA 3PLNA 2HLOC 2Z4EC 1ZN5A 1FU1A 2NPSC 1JY2O 2ZT9B 2E75B 5AW9B 1OIPA 1CSBA 1GW4A 1ZR4A 3E7KA 4C46A 1AVOA 2KSEA 3H1IE 1E79H 1GD2E 2FXOA 1YITP 1QL2A 2C9LY 5AW7B 2WVRA 1HWTC 1S5LE 1E5WA 5AVXB 1RE4A 1FDIA 2YMKA 1RF1B 4GOFA 4N78E 3TGUE 1SQVG 3AE5C 2WMMA 2JDIH 2XV5A 5GTHH 1SFCB 3LIDA 3M0DA 2YKPA 1LTBC 1LTSC 5AW1B 3VN0A 1KILA 1KB9H 1ZP0C 3HD7C 4PJ0E 1NWQA 1NTMG 5KAFE 4YXWH 1AJYA 1IFJA 2OARA 2H43C 3WUUA 1AQ5A 1FDMA 3USSA 3SWYA 3Q5PA 3RK3D 2IFNA 2B9BA 1M1KQ 1BGYE 1N7SA 1LWUC 2YIUC 2O01N 1GL2C 2FYUE 1HVVA 2WSFH 3MUDC 4BRYB 1OVUA 2KLVA 2QE7H 1YIJP 3A0HH 1ZRTD 3PTZA 4D6TG 1YJ9P 2WNPF 1PPJE 1NAYA 2NPSB 2GUSA 2P67A 3U59A 2HG5D 1GDTA 1YHQP 1FZCC 5KLIC 4I7ZC 3M91A 3BRVB 2JEEA 1BCCD 2J3FD 3L73J 2ZXXA 4O9BA 1VF5B 1LP1B 3AE8C 1PV3A 1U57A 2IZ1A 1URQB 3P8CD 1Q81Q 3AE9C 4L74A 1YI2P 1YJWP 3CXHH 2JP3A 4Y99C 2Y0CA 2R32A 3Q5RA 3B8EB 3H1JJ 2JHIF 3IN6A 4AYCA 1KFMA 3KHUA 2KS1A 4JZCA 2PAJA 1MFTA 2KYVA 2QVAA 3M9HA 2J1GA 3L70J 1YTZI 4C7NA 4UB8H 1RF0C 1RQUA 3Q3DA 4H0LC 1MUUA 5CJ0A 4DZOA 3CMAP 2RH0A 4OGQC 1M7LA 1BGYG 5CCHC 1EZVI 3CMEP 3H1KE 1SVFA 3ZDMA 4IFDK 5B5EH 3U1AA 5KAIH 1LTAC 2LKMA 1GL2A 1NYHA 1IZNB 4H44C 3CC2P 2HODC 2Q9IC 2V7QJ 1FE6A 3QWOC 2KSJA 3RBXA 3O8ZA 3E1IB 2YMYA 4TT3H 3SFDC 2Z5IA 3FX0A 1M1JA 1A02F 3CCQP 2Y9YA 3H6PA 3B71A 4PD4E 2K37A 3M0AA 3CCUP 2KNCA 3HE5B 3L71E 1HJBA 1OZHA 3HUSC 3HRNA 3MP7B 3TF5A 1G2CA 1SQQD 3KZIH 5TISH 1M8OB 3JCUH 1VQ5P 1SQQJ 1HTLC 1SQXG 4NPFX 1NAFA 2RMZA 3KZIE 3NTNA 1GW3A 4EIJA 5K5GB 2FFDB 1Y9BA 3L74J 1BCCE 2AEFA 5KJ7D 2OYHB 1USEA 1N7SD 1FZEB 1FZBB 1FZBC 1IJDB 1MV8A 4U3FJ 2FFDC 1FOSF 2RKLA 1HGVA 2IDBA 2FY8A 1UIXA 1VQ7P 4H13B 4JYBA 2W6JH 4IL6E 3T97B 2C0WA 5CBOA 2K88A 3V6IA 1EZVE 2J2PA 2QJPB 2BEZF 4IL6X 3IR9A 1IFDA 3B5NB 1EQ7A 3M0DC 3CC7P 2E74C 1H88A 1QX8A 3L70D 2ZFCA 2J64A 5AW4B 1JEKA 4PV1B 4D6TE 1FS0E 3CX5D 1KILC 3TSIA 3Q1MA 5APXA 3EFGA 2BCCE 3E1RA 4C7NB 3H1KD 3L73E 1L0LG 5KLIB 2NZ2A 1PP9J 2N1TA 4NYTA 2W8ZA 3QH9A 3CL3D 2CPBA 4OH8B 4I2LC 1KQGB 2JHKF 3P7KA 1RHZB 1GK6A 1BGYJ 3EFFK 3LIEA 2OGUA 1YTZT 1S9KD 1M90Q 3CCSP 3SWKA 3AEAC 2B87B 2H88C 1ZW0A 1RF0B 1S3JA 1PZQA 1PP9E 3SSUA 2IBZI 3BCCD 3CCJP 3GMAA 2QJYC 1DD4A 3VYIA 1GL2B 1G1JA 1KMIZ 1VQ4P 3U1CA 3H1HE 2IBZE 3CXHD 3L35A 1SQVE 4IFMA 4R9TA 2VRSA 2JKVA 1GK4A 3HTKA 1Z56A 4GKGA 1KQLA 3FXDA 3L4FA 1S1CX 1KV4A 2MKVA 1L0NE 4H13C 4A7PA 3R4YA 1JY3N 5KTBA 1FBMA 1VF5C 2J0YA 5KAIE 1IFPA 1URQC 1JY2P 2CK3H 3C8VA 5AVTB 3P8MC 2QM7A 3PP5A 1VQOP 1N86B 1FZCB 2WPVB 2M3EA 4GDOA 3I5CA 5AW3B 1S5LH 2O1KA 1L0LJ 1OMIA 4LC1A 3H1JG 3BATA 3Q2YA 1CI6B 2I1KA 3WUTA 2P58A 5KKZC 2W6AA 3AE7C 3HUSB 1L2PA 3A5TA 4XFJA 1L4AD 2YIUB 2H8PD 3CWBD 1YBKA 4HJGH 3L75D 5TJHA 1OWAA 1DH3A 2W27A 1LT9B 1VPCA 1JOCA 1RY3A 1YQ4C 1JNMA 1VQMP 2IZ0A 1HJ0A 3AE1C 4OWFA 1NJIQ 2QJPC 1BGYD 2HODB 1FZAA 3F89A 4RESB 1JCCA 3AE2C 1FIDA 2N9BA 3G71P 1NTZD 2WSCH 4QMAA 2QJKB 4EYYQ 1FZFC 2C0XA 3I55P 2A45I 1L0ND 2Z4EA 1K73Q 1RF1A 2M3BA 1KILD 1NKNA 1VQ6P 2OYIB 4EDFA 4GODA 1Y8AA 4DCKA 3LW5H 1NTMK 4L76A 1X0TA 2R5BA 1SQPJ 2ZYDA 2WZ7A 1KZUB 2K9JA 4GOEA 4Y99B 3H1KG 2E76B 3CD6P 1CI6A 2B89A 2OYIA 3UIAA 4MN4C 1OW7A 4PV1D 2M8RA 2Z4EB 2QEXP 3G3ZA 2A06G 2HR3A 1Q7YQ 3V2QA 4K3AA 2P2UA 4N6JA 2FKWB 1KB9E 4R4LA 3RK2C 4WY4C 4PJ0H 3G6EP 3F5HA 4ZNCA 1QGKB 3CXHE 2I8DA 3KQGA 3MIWA 2ZYGA 4JYCA 1P84I 1KYOE 3Q5SA 5KLVK 3MGNA 1KB9I 5CMZA 1YYCA 1ZXGA 2WITA 1VQ8P 5C39A 5E79H 1WMKA 1T3JA 2AXTE 3W67A 1FJPA 2J3FA 4ZMDA 2XNXA 3OJAB 1LWUA 2O01J 4YTPC 2ZXEB 1KB9D 1WT6A 4OVNF 5KJ7C 3IF4A 2Q3IA 3GLMA 1HBWA 1N8RQ 2JHMF 2BCCJ 1K9MQ 2ZVNB 1SQXE 1Q90D 1KFNA 1SQBK 1LTJB 3L75E 1Q2NA 3WMM0 3OAKA 3K5BA 3AE3C 1NTMD 2M5AB 3TK1A 1RE3A 5BU5A 2J61A 3E1IC 5H2FH 3B5NA 1SQBE 2QA4P 2LXBA 4AQRD 4EI2A 3HD7B 1KTMA 2E42A 3HTKB 1JUNA 2OYHC 1X22A 3H1KJ 2H43A 4WVZA 2J5UA 3H1HD 2FYNC 1T8ZA 2IFMA 4N3YB 3D70A 5APTA 1PP9G 2FYUJ 1OVRA 1N73A 3VP8A 1SFCC 5KJ7A 1S5LX 1VL2A 2XZRA 3FWNA 3SFEC 3BCCG 1JY2N 2D2CD 4JYOX 3R2PA 1XTGB 2D39A 1SQXJ 2LXCB 2ZVOB 4W7YA 3L70E 3H1LD 3N4XA 1OW6A 3H1IJ 2E75C 3KDPB 3EQ2A 3NFQA 1USDA 3CI9A 1NTZE 3CPWO 1PIXA 2ZT9C 3A0BE 4KJMA 3V2PA 4EPUA 3AE6C 4AUWA 3D6ZA 1JTHB 1NTZK 2B87A 4BXLA 3BRTB 3G4SP 3RK3E 1N73B 3A7OA 3TNUB 2AXCA 2B88A 3RK3C 4XE5B 3G9RA 2SPZA 5AVUB 3KYQA 1N73C 2Y0DA 4RKUJ 1T2KC 1PGQA 3BVHB 4ZKUA 1HUCA 1UIIA 1P84H 1IC2A 1EXJA 3LW5J 2WPRA 4W7ZA 1S9KE 5AVSB 2J59M 4I7ZB 4DOJA 4GIFA 1LTIC 2IBZD 1KORA 3GF3A 1PP9D 5CCGD 2QSIA 1SQPE 4TLFA 1JCDA 3TNUA 1GZLA 2N1TC 1OW8A 4HKZH 2A45H 2GA1A 1L0NJ 2JR8A 3JCUE 1HF9A 2XNXB 1EDJA 1FC2C 2FFDA 2POHA 1JY3P 1N2DC 3L75G 1NOHA 2QJYB 3O6QA 3CXHI 2JHLF 1KYOI 2JO1A 3I56P 1FZGC 3S4RA 1FZEC 4DJGA 3OW2O 1FZGB 4U3FE 1SQPG 4PD4H 1KYOH 1IO4A 2KZIA 2KUBA 2KNCB 2CPSA 4WB4A 1FZFA 2HLOB 1X9VA 3B5ND 2K9JB 1JMBA 3MTUE 2YXQB 2NRGA 1G1IA 3FGAD 1NTKJ 3C9IA 2N9YB 4RO0A 2WPSA 1NTKD 2Y9ZA 1SLQA 3VMAA 1FICA 1T3UA 2A06D 3GF7A 3HD7D 2WSFJ 1BSHA 3HUSA 5L8RJ 3L74E 2O1JA 2ITAA 1BE3G 2Q7CA 3H32A
chains in the Genus database with same CATH topology
3RK3D 1X8YA 1AFOA 3L36A 1L4AD 2IFNA 2WPQA 2H8PD 2JJLA 1N7SA 1N7SB 1DEBA 3OA7A 1LWUC 2WWWA 3A3YB 1LTTC 1GL2C 2XNXC 1LWUB 1NHLA 2Q9IA 4W80A 1HVVA 1OWAA 2GM4A 1DH3A 2WSFH 1GL2D 2W27A 1LT9B 1VPCA 1JOCA 3P8CE 1RY3A 3H32C 2KLVA 5AW2B 1LTGC 2GUVA 1JNMA 1J2JB 1Z3UA 4C7RA 4WBAA 2WNPF 1OXZA 5CJ4A 1RF1C 3II6A 2NPSB 2HODB 1FZAA 3IFMA 2GUSA 4RESB 1DX7A 1JCCA 2P67A 2HG5D 3U59A 1GDTA 2HODA 1JO5A 1FIDA 5BU8B 1IFNA 2J60A 2N9BA 1FZCC 1ZR2A 2WSCH 1SQXK 1FZFC 2C0XA 3M91A 3BRVB 4JF7A 2JEEA 2IPPA 1N7LA 1LTJC 2KB7P 2A45I 5CHXA 2Z4EA 3VOPA 2J3UA 2C9NY 1RF1A 2NPSA 2J3FD 2M3BA 3V4WA 1KILD 1LT9A 4O9BA 2KP8A 1FJKA 5AVRB 1NKNA 2OYIB 1FOSE 2Q9IB 1GU4A 1URQB 2P7JA 1CZQA 1FZFB 1FZCA 3P8CD 3LW5H 1H89A 1NTMK 2J0HA 3V5BA 1RE4C 1XTCC 2R5BA 1Z3SA 3SWFA 4Y99C 2HPCA 2WZ7A 2R32A 1KZUB 3B8EB 4Y99B 1URQA 1SQPK 2L5GB 2JHIF 1CI6A 2OYIA 3RK2B 4AYCA 1KFMA 3UIAA 1KILB 2N1TD 2M8RA 4JZCA 2Z4EB 2PAJA 3G3ZA 4M7HA 2KYVA 2YO3A 3RL0D 3M9HA 2J1GA 3RK2D 1URQD 3V2QA 4ZFGA 2P2UA 2WSEH 4N6JA 2FKWB 1M1JC 1YTZI 2FXMA 3HE4B 4C7NA 1GU5A 1RF0C 3RK2C 4WY4C 3M06A 3RL0B 5CCHD 5AVWB 1MUUA 2R5DA 5CJ0A 3MUDA 3H32B 4DZOA 3KQGA 1SQVK 3MIWA 1M7LA 5CCHC 4JYCA 5KLVK 3MGNA 1FZGA 1N86A 5CMZA 1YYCA 5APSA 1SVFA 2WITA 4M3LA 4IFDK 1X79B 2HLOA 2WT7B 3MD0A 3U1AA 1T3JA 1CW5A 1JY3O 1FJPA 1LTAC 1FZAC 2NPSD 2LKMA 2J3FA 2MJZA 3V4QA 3BASA 1GL2A 2XNXA 3OJAB 1LWUA 2HODC 2ZXEB 3V2RA 4R9JA 1IK9A 1WT6A 2Q9IC 2Z5HA 5KJ7C 3B5NC 2Q3IA 3M9BA 1HBWA 2KSJA 3O8ZA 2JHMF 3E1IB 2J3GA 2YMYA 3NXSA 1KFNA 3BVHA 1SQBK 2JHHC 1RE4B 1LTJB 3RK3B 2Z5IA 2J0GA 1M1JA 1A02F 1NTKK 3WMM0 3OAKA 3VMXA 1FZDA 3H6PA 3P32A 1MFZA 3TK1A 1RE3A 5BU5A 4I6MC 3M0AA 2J61A 2BASA 3VMZA 3E1IC 1JC9A 3B5NA 1QL1A 3HE5B 1N86C 1HJBA 1IFMA 1LGHB 4AQRD 5AW5B 1L4AB 3HUSC 1SFCA 3HRNA 3HD7B 2E42A 4XA4A 4I1LA 4B86A 1G2CA 5BVZA 3VTPC 1L0LK 3HTKB 1A02J 2OYHC 1JUNA 3FIBA 1ZV8A 2H43A 3VMYA 2GY7A 1LT9C 5APYA 1HTLC 1JTHA 1T8ZA 1NAFA 4GT1A 2IFMA 2I1JA 4N3YB 1G2CB 5APTA 1SFCD 3NTNA 1GW3A 4EIJA 2FFDB 3KPEA 2HPCC 4ZKPA 1IFIA 1N73A 3VP8A 1N7SC 1SFCC 1J1EC 1SQQK 2IX7C 5KJ7D 5KJ7A 1T2KD 2OYHB 5APWA 2XU6A 1N7SD 1NKZB 3T97A 2XZRA 1HGZA 1RF0A 1FZEB 1J1DC 4EOTA 1FZBB 1M1JB 1JY2N 2HYNA 1FZBC 1IJDB 1MV8A 1J1DB 5AVQB 5AVZB 5AW8B 4JYOX 2FFDC 3R2PA 1XTGB 2D39A 3NMDA 1FOSF 4W7YA 3TYYA 1HGVA 3CLQA 4JYBA 3N4XA 1ZLLA 4LLHA 2W6BA 3GHGA 2C0WA 3KDPB 5CCGC 3EQ2A 3NFQA 3CI9A 2J2PA 2OYHA 2J5ZA 4WY4A 3N7NA 1SP4A 3IR9A 1IFDA 3V2PA 3B5NB 1EQ7A 3M0DC 5AW0B 4EPUA 4AUWA 1JTHB 2P1JA 1H88A 1NTZK 3BRTB 1N73B 2ZFCA 3A7OA 3TNUB 3BVHC 3RK3C 1NU1K 4XE5B 4WY4D 2J64A 1W2EA 5AVUB 3KYQA 5AW4B 1N73C 2O01H 1LTJA 1T2KC 5APVA 3BVHB 4ZKUA 2YNYA 1HUCA 2Q5UA 2QM8A 1IC2A 1KILC 2H43B 1NH4A 1FZBA 3TSIA 5APXA 3EFGA 2WPRA 4W7ZA 4C7NB 1S9KE 2J61B 2J58A 5AVSB 1WRGA 2J59M 2N1TB 1MZ9A 4DOJA 1L4AA 4GIFA 1LTIC 2HFED 2N1TA 1GTWA 5AVVB 2R3CA 4NYTA 3GHGC 3GHGB 3CL3D 2CPBA 4OH8B 5APQA 4I2LC 1RE3C 5CCGD 2WTYA 2JHKF 3P7KA 1GK6A 1L0NK 3LIEA 2YO2A 1YTZT 1S9KD 1JCDA 3TNUA 3VP9A 1GZLA 3E1IA 2FIBA 2N1TC 3HE5A 2PP6A 1FZEA 1VDFA 1RF0B 1FAVA 1J1EB 4M7FA 3RL0C 4KHXA 2A45H 2A45G 2YKQA 2FYZA 3V2NA 5CCHA 4WY4B 3L37A 1GL2B 3VYIA 2XKMA 2XNXB 2FFDA 4LGDE 2POHA 1JY3P 1N2DC 1NO4A 1G1JA 1NOHA 1JMMA 2HLOC 3U1CA 2JHLF 3L35A 4IFMA 4R9TA 2Z4EC 2VRSA 1FZGC 1FZEC 1ZN5A 1FU1A 1GK4A 3HTKA 2NPSC 1FZGB 1Z56A 1JY2O 1IO4A 5AW9B 3HD7A 4GKGA 1CSBA 1KQLA 1PFIA 1GW4A 3L4FA 1HH0A 1ZR4A 4C46A 1FZAB 3A2AA 2CPSA 3HE4A 4WB4A 1GD2E 1FZFA 2HLOB 1X9VA 1JY3N 1QL2A 2C9LY 3B5ND 5AW7B 5KTBA 1H8AA 1HWTC 1E5WA 5AVXB 1FBMA 2J0YA 2YKOA 1RE4A 3MTUE 4IFFA 1RF1B 1G1IA 1URQC 1JY2P 4N78E 5AVTB 3P8MC 5CCGA 5APUA 2QM7A 3C9IA 3PP5A 2WT7A 2E43A 2FYUK 1N86B 2WPSA 2XV5A 3M9QA 4HYTB 1FZCB 2HPCB 1SFCB 3LIDA 3M0DA 1SLQA 2YKPA 1FICA 1T3UA 1LTBC 3I5CA 5AW3B 3HD7D 2J3OA 2H7HA 1LTSC 2O1KA 2KOGA 3HUSA 5AW1B 1RE3B 3VN0A 1KILA 2O1JA 3HD7C 4HH2A 4LC1A 5AVYB 3BATA 1NWQA 5AW6B 1CI6B 2XDJA 4N78D 2OYIC 1IFJA 2I1KA 2OARA 2H43C 1AQ5A 2W6AA 1FDMA 3SWYA 1FIBA 1L4AC 3HUSB 3A5TA 2Q7CA 3H32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZC A;  2Z4E B;  2HPC C;  2FIB A;  3E1I A;  4M7H A;  1N73 A;  2OYH B;  1FZE A;  1RF0 B;  2J1G A;  4M7F A;  4ZFG A;  1M1J C;  1LWU C;  2A45 H;  1FZE B;  1RF0 A;  1RF0 C;  2A45 G;  1FZB B;  2XNX C;  1LWU B;  2Q9I A;  1M1J B;  1JY2 N;  1FZB C;  2XNX B;  3H32 B;  2FFD A;  4JYO X;  2FFD C;  1JY3 P;  1LT9 B;  2D39 A;  2HLO C;  1FZG A;  3H32 C;  1N86 A;  2JHL F;  2HLO A;  4R9T A;  2Z4E C;  1FZG C;  1FZE C;  1Z3U A;  3GHG A;  2WNP F;  1FZG B;  1RF1 C;  1JY2 O;  1JY3 O;  2J2P A;  2OYH A;  1FZA C;  2HOD B;  1FZA A;  2J3F A;  2J5Z A;  2XNX A;  1LWU A;  2HOD C;  1FID A;  2HOD A;  4R9J A;  1FZA B;  2J60 A;  1FZC C;  2Q9I C;  4EPU A;  3H32 A;  1FZF C;  1FZF A;  2HLO B;  1N73 B;  2JHM F;  1JY3 N;  1LTJ C;  3E1I B;  2A45 I;  2Z4E A;  2J3U A;  2J3G A;  3BVH C;  3BVH A;  1RF1 A;  2J64 A;  1W2E A;  2J0Y A;  2J3F D;  1RE4 A;  1N73 C;  1RE4 B;  1LTJ A;  2JHH C;  1LTJ B;  1LT9 A;  1RF1 B;  3BVH B;  1JY2 P;  2J0G A;  2OYI B;  2Q9I B;  1M1J A;  1FZD A;  2H43 B;  1FZB A;  1FZF B;  1FZC A;  1N86 B;  1RE3 A;  2J61 B;  2J61 A;  2J0H A;  1JC9 A;  3E1I C;  1FZC B;  2HPC B;  1N86 C;  1RE4 C;  3HUS C;  1FIC A;  1T3U A;  1Z3S A;  2J3O A;  4NYT A;  3GHG C;  2HPC A;  3HUS A;  1RE3 B;  3GHG B;  2OYH C;  3FIB A;  2H43 A;  2JHI F;  1RE3 C;  2JHK F;  2GY7 A;  1LT9 C;  2OYI A;  2OYI C;  2H43 C;  1FIB A;  3HUS B;  2FFD B; 
#chains in the Genus database with same CATH topology
 1X8Y A;  3L73 G;  1AFO A;  1KQF B;  3PRJ A;  2WPQ A;  1N7S B;  2E5T A;  4ASW A;  2WWW A;  3A3Y B;  1LTT C;  1SQB G;  1LWU B;  1Q82 Q;  3CWB J;  4W80 A;  2GM4 A;  3MZW B;  1GL2 D;  1H0T B;  3H1J D;  1NTM J;  1BSN A;  1LTG C;  2GUV A;  2O3J A;  3TGU J;  4WBA A;  1OXZ A;  5CJ4 A;  1R8E A;  3II6 A;  2V4H A;  1M56 D;  5EFW B;  3TGU D;  3IFM A;  1EZV G;  1SQB D;  3D6Y A;  2HOD A;  2J60 A;  3AEC C;  1NTZ J;  2KB7 P;  1RH5 B;  3VOP A;  2C9N Y;  1D7M A;  2IYP A;  2NPS A;  3PH0 A;  1LT9 A;  1FJK A;  5AVR B;  1FOS E;  1GU4 A;  2P7J A;  1FZC A;  1H89 A;  4U7J A;  2J0H A;  3JC2 2;  2E76 D;  3V5B A;  1VQL P;  1YJN P;  3RBZ A;  1FDO A;  1Z3S A;  3SWF A;  1NTK E;  2HPC A;  1URQ A;  2L5G B;  1ZOY C;  2WSC J;  3TGU G;  1K05 A;  2M0B A;  2N1T D;  3CCM P;  4M7H A;  2YO3 A;  2IYO A;  4ASV A;  5GTH E;  1S72 P;  4ZFG A;  1M1J C;  3HE4 B;  2FXP A;  1AV1 A;  3AED C;  4OGQ D;  3M06 A;  5CCH D;  4RJT A;  2R5D A;  3MUD A;  4HB1 A;  1VQN P;  4Z1M H;  1N86 A;  5APS A;  3L73 D;  2WT7 B;  1TU3 F;  1IK7 A;  3W68 A;  1YQ3 C;  1FZA C;  3V4Q A;  1P84 D;  3V2R A;  4R9J A;  3CCE P;  1OFC X;  1R5L A;  2Z5H A;  3B5N C;  3M9B A;  3CCV P;  2J3G A;  1NTK G;  3NXS A;  3BVH A;  4NPD A;  1NTZ G;  1KQS O;  1EZV D;  1NTK K;  3H1H G;  3VMX A;  1FZD A;  1DIP A;  1VQK P;  1MFZ A;  4I6M C;  2BAS A;  3O6Q B;  3VMZ A;  1JC9 A;  5GTI E;  2FYN B;  1N86 C;  1IFM A;  1LGH B;  3ITK A;  1L4A B;  2K9Y A;  4XA4 A;  4B86 A;  3VTP C;  3WU2 E;  3JSV C;  1A02 J;  2BEQ D;  3VMY A;  2GY7 A;  1LT9 C;  4PD4 I;  3CX5 E;  1KN7 A;  2YXR B;  1K8A Q;  1K04 A;  4GT1 A;  2I1J A;  3WU2 H;  3KPE A;  5B66 E;  1EDI A;  2HPC C;  2D2C B;  1N7S C;  1T2K D;  1QEX A;  2XU6 A;  1NKZ B;  1BE3 D;  5M1B A;  3T97 A;  1RF0 A;  1J1D C;  5AVQ B;  1J1D B;  5AVZ B;  3RGU A;  3TYY A;  3H1L G;  2W6B A;  3FXE A;  5CCG C;  2QRX A;  2RN0 A;  4JQ0 D;  4WY4 A;  2V7Q H;  2OTK E;  1SP4 A;  1BE3 E;  3BCC J;  5B5E E;  2OQQ A;  2P1J A;  1BDD A;  2P10 A;  1OX3 A;  3BVH C;  1NU1 K;  3L74 G;  2O01 H;  1LTJ A;  1U7J A;  2QM8 A;  5KKZ B;  1NH4 A;  2E76 C;  5KAF H;  2J61 B;  1QVF O;  2Q1K A;  1MZ9 A;  3L72 G;  3PJS K;  1BCC G;  5KLV G;  3GHG C;  3L71 D;  3GHG B;  2M5A A;  5APQ A;  1SQX D;  1RE3 C;  2WTY A;  1AQT A;  1NVO A;  2ZYA A;  1L0N K;  3H1L J;  4WWI A;  3H1I D;  1DD3 A;  3AEF C;  3HE5 A;  2PP6 A;  1FZE A;  1VDF A;  2BCC G;  5DJT B;  3CX5 I;  4M7F A;  3RL0 C;  1R5S A;  2A45 G;  3A0B H;  1KIL E;  3CCL P;  3PHL A;  2FYZ A;  3V2N A;  5CCH A;  3L37 A;  2XKM A;  4L75 A;  1NO4 A;  1PPJ G;  4UB8 E;  3L71 G;  2E5Y A;  1U7M A;  2KI7 B;  3L72 D;  4YPC A;  2ZAE B;  3RL0 g;  3HD7 A;  3L72 J;  1PFI A;  1HH0 A;  1FZA B;  3A2A A;  3ABV C;  3HE4 A;  1PGJ A;  3CCR P;  1NGM B;  4H13 D;  1H8A A;  2YKO A;  4IFF A;  2WT7 A;  5CCG A;  5APU A;  2E43 A;  2FYU K;  3M9Q A;  4HYT B;  3AEE C;  2HPC B;  2LR2 A;  5CBN A;  2J3O A;  5KLV J;  1AA0 A;  2H7H A;  3H1I G;  2KOG A;  1RE3 B;  5AVY B;  4HH2 A;  5AW6 B;  3KXD A;  2XDJ A;  2JWA A;  4N78 D;  2OTL P;  2OYI C;  3FWL A;  1AVY A;  2E74 D;  1FIB A;  1L4A C;  3L36 A;  1BDC A;  3L72 E;  1LJ2 A;  1PPJ D;  2JJL A;  1DEB A;  3OA7 A;  2QIW A;  3CC4 P;  5B66 H;  2XNX C;  1NHL A;  2Q9I A;  2AXT H;  3AE4 C;  3P8C E;  1H0T A;  1KD1 Q;  3H32 C;  2R3S A;  2PGD A;  5AW2 B;  1PGO A;  2A06 E;  1Y47 A;  1J2J B;  1Z3U A;  4C7R A;  1RF1 C;  5DJU B;  1JB0 J;  1DX7 A;  1JO5 A;  5BU8 B;  1IFN A;  3CWB G;  1ZR2 A;  4D6T J;  1SQX K;  1KC8 Q;  4JF7 A;  2PFX A;  1L0L D;  1N7L A;  2IPP A;  1LTJ C;  5CHX A;  2IBZ G;  4D6T D;  2J3U A;  2AEM A;  2WSS H;  3V4W A;  2KP8 A;  2Q9I B;  4IL6 H;  2JWD A;  2KLU A;  1CZQ A;  1FZF B;  3WUV A;  4BRY A;  2K1A A;  4JBZ A;  1EC5 A;  1RE4 C;  3H1L E;  2Q3E A;  3AEB C;  1XTC C;  3CWB E;  3S9O A;  4JPZ B;  1SQP K;  3RK2 B;  1KIL B;  3L75 J;  3S1K A;  1VQP P;  2KK7 A;  2OYO A;  1VF5 D;  3RL0 D;  3RK2 D;  1URQ D;  1SQB J;  2KXP B;  2WSE H;  2FXM A;  3H1H J;  1GU5 A;  1SQV J;  3RL0 B;  5AVW B;  1EDK A;  2G8Y A;  2ZJS E;  3H32 B;  1SQV D;  1SQV K;  4H44 B;  2KZJ A;  1FZG A;  5KLV D;  4M3L A;  1BE3 J;  1GMJ A;  1X79 B;  2HLO A;  3MD0 A;  4KT0 J;  1S2E A;  1CW5 A;  1JY3 O;  1BCC J;  2NPS D;  1MKM A;  2MJZ A;  3BAS A;  1QVG O;  1IK9 A;  1L0N G;  1SQP D;  3L70 G;  1W5C E;  1PL5 A;  3H1J E;  1EDL A;  2FBW C;  2WSE J;  1SQQ E;  2Q6Q A;  2H89 C;  2JHH C;  1RE4 B;  5H2F E;  3RK3 B;  2J0G A;  4IOI H;  4CPG A;  1JM0 A;  2QJK C;  4UB6 H;  3P32 A;  2L91 A;  1RQV A;  3GG2 A;  1QL1 A;  4Y28 J;  1VQ9 P;  1S4X A;  1NU1 G;  1OVV A;  5AW5 B;  1ZME C;  3BCC E;  1SFC A;  4I1L A;  5BVZ A;  3B4S A;  1Q86 Q;  1L0L K;  3FIB A;  1ZV8 A;  1P84 E;  5APY A;  1PGP A;  1JTH A;  3L74 D;  1KYO D;  4PD4 D;  4DT0 A;  4H44 D;  1DEE G;  1G2C B;  1SFC D;  4L73 A;  5GTI H;  1L0L E;  4R4M A;  3MHV A;  4ZKP A;  1IFI A;  1LT1 A;  2IX7 C;  1J1E C;  1SQQ K;  3GW6 A;  5APW A;  5E79 E;  2UWJ E;  4NPE A;  1HGZ A;  4EOT A;  2FYU G;  2QG4 A;  1M1J B;  2HYN A;  2Y0E A;  5AW8 B;  3C1L A;  3NMD A;  4K35 A;  2BCC D;  2D2C C;  2KIK A;  1M57 D;  3CLQ A;  2E75 D;  1QLE D;  3H25 A;  1ZLL A;  4LLH A;  1NU1 D;  3GHG A;  2R44 A;  2OYH A;  2J5Z A;  1NU1 J;  3N7N A;  4OGQ B;  1NTM E;  4H0L B;  4BWN A;  4PV1 C;  5AW0 B;  2ZT9 D;  4UB6 E;  2OTJ P;  4WY4 D;  1W2E A;  4U3F G;  5APV A;  2YNY A;  3CX5 H;  2Q5U A;  2H43 B;  2XND H;  1FZB A;  2W90 A;  1SQQ G;  2FYU D;  2J58 A;  1WRG A;  2G3A A;  2N1T B;  1L4A A;  1ZRT E;  2PRR A;  2HFE D;  3D71 A;  1GTW A;  5AVV B;  2R3C A;  3L71 J;  2DW3 A;  2YO2 A;  3EWK A;  2W83 C;  1EXI A;  4U3F D;  1LNQ A;  2WQY C;  3VP9 A;  2FIB A;  3E1I A;  3TDK A;  1NU1 E;  3AEG C;  1W2B O;  1FAV A;  1J1E B;  4YXD C;  3A0H E;  5TIS E;  3IAO A;  4KHX A;  2YKQ A;  5KLV E;  1SS1 A;  4WY4 B;  1T6A A;  2AEJ A;  4LGD E;  2K3R A;  4H0L D;  1LP1 A;  2KS1 B;  2E74 B;  1JMM A;  3PLN A;  2HLO C;  2Z4E C;  1ZN5 A;  1FU1 A;  2NPS C;  1JY2 O;  2ZT9 B;  2E75 B;  5AW9 B;  1OIP A;  1CSB A;  1GW4 A;  1ZR4 A;  3E7K A;  4C46 A;  1AVO A;  2KSE A;  3H1I E;  1E79 H;  1GD2 E;  2FXO A;  1YIT P;  1QL2 A;  2C9L Y;  5AW7 B;  2WVR A;  1HWT C;  1S5L E;  1E5W A;  5AVX B;  1RE4 A;  1FDI A;  2YMK A;  1RF1 B;  4GOF A;  4N78 E;  3TGU E;  1SQV G;  3AE5 C;  2WMM A;  2JDI H;  2XV5 A;  5GTH H;  1SFC B;  3LID A;  3M0D A;  2YKP A;  1LTB C;  1LTS C;  5AW1 B;  3VN0 A;  1KIL A;  1KB9 H;  1ZP0 C;  3HD7 C;  4PJ0 E;  1NWQ A;  1NTM G;  5KAF E;  4YXW H;  1AJY A;  1IFJ A;  2OAR A;  2H43 C;  3WUU A;  1AQ5 A;  1FDM A;  3USS A;  3SWY A;  3Q5P A;  3RK3 D;  2IFN A;  2B9B A;  1M1K Q;  1BGY E;  1N7S A;  1LWU C;  2YIU C;  2O01 N;  1GL2 C;  2FYU E;  1HVV A;  2WSF H;  3MUD C;  4BRY B;  1OVU A;  2KLV A;  2QE7 H;  1YIJ P;  3A0H H;  1ZRT D;  3PTZ A;  4D6T G;  1YJ9 P;  2WNP F;  1PPJ E;  1NAY A;  2NPS B;  2GUS A;  2P67 A;  3U59 A;  2HG5 D;  1GDT A;  1YHQ P;  1FZC C;  5KLI C;  4I7Z C;  3M91 A;  3BRV B;  2JEE A;  1BCC D;  2J3F D;  3L73 J;  2ZXX A;  4O9B A;  1VF5 B;  1LP1 B;  3AE8 C;  1PV3 A;  1U57 A;  2IZ1 A;  1URQ B;  3P8C D;  1Q81 Q;  3AE9 C;  4L74 A;  1YI2 P;  1YJW P;  3CXH H;  2JP3 A;  4Y99 C;  2Y0C A;  2R32 A;  3Q5R A;  3B8E B;  3H1J J;  2JHI F;  3IN6 A;  4AYC A;  1KFM A;  3KHU A;  2KS1 A;  4JZC A;  2PAJ A;  1MFT A;  2KYV A;  2QVA A;  3M9H A;  2J1G A;  3L70 J;  1YTZ I;  4C7N A;  4UB8 H;  1RF0 C;  1RQU A;  3Q3D A;  4H0L C;  1MUU A;  5CJ0 A;  4DZO A;  3CMA P;  2RH0 A;  4OGQ C;  1M7L A;  1BGY G;  5CCH C;  1EZV I;  3CME P;  3H1K E;  1SVF A;  3ZDM A;  4IFD K;  5B5E H;  3U1A A;  5KAI H;  1LTA C;  2LKM A;  1GL2 A;  1NYH A;  1IZN B;  4H44 C;  3CC2 P;  2HOD C;  2Q9I C;  2V7Q J;  1FE6 A;  3QWO C;  2KSJ A;  3RBX A;  3O8Z A;  3E1I B;  2YMY A;  4TT3 H;  3SFD C;  2Z5I A;  3FX0 A;  1M1J A;  1A02 F;  3CCQ P;  2Y9Y A;  3H6P A;  3B71 A;  4PD4 E;  2K37 A;  3M0A A;  3CCU P;  2KNC A;  3HE5 B;  3L71 E;  1HJB A;  1OZH A;  3HUS C;  3HRN A;  3MP7 B;  3TF5 A;  1G2C A;  1SQQ D;  3KZI H;  5TIS H;  1M8O B;  3JCU H;  1VQ5 P;  1SQQ J;  1HTL C;  1SQX G;  4NPF X;  1NAF A;  2RMZ A;  3KZI E;  3NTN A;  1GW3 A;  4EIJ A;  5K5G B;  2FFD B;  1Y9B A;  3L74 J;  1BCC E;  2AEF A;  5KJ7 D;  2OYH B;  1USE A;  1N7S D;  1FZE B;  1FZB B;  1FZB C;  1IJD B;  1MV8 A;  4U3F J;  2FFD C;  1FOS F;  2RKL A;  1HGV A;  2IDB A;  2FY8 A;  1UIX A;  1VQ7 P;  4H13 B;  4JYB A;  2W6J H;  4IL6 E;  3T97 B;  2C0W A;  5CBO A;  2K88 A;  3V6I A;  1EZV E;  2J2P A;  2QJP B;  2BEZ F;  4IL6 X;  3IR9 A;  1IFD A;  3B5N B;  1EQ7 A;  3M0D C;  3CC7 P;  2E74 C;  1H88 A;  1QX8 A;  3L70 D;  2ZFC A;  2J64 A;  5AW4 B;  1JEK A;  4PV1 B;  4D6T E;  1FS0 E;  3CX5 D;  1KIL C;  3TSI A;  3Q1M A;  5APX A;  3EFG A;  2BCC E;  3E1R A;  4C7N B;  3H1K D;  3L73 E;  1L0L G;  5KLI B;  2NZ2 A;  1PP9 J;  2N1T A;  4NYT A;  2W8Z A;  3QH9 A;  3CL3 D;  2CPB A;  4OH8 B;  4I2L C;  1KQG B;  2JHK F;  3P7K A;  1RHZ B;  1GK6 A;  1BGY J;  3EFF K;  3LIE A;  2OGU A;  1YTZ T;  1S9K D;  1M90 Q;  3CCS P;  3SWK A;  3AEA C;  2B87 B;  2H88 C;  1ZW0 A;  1RF0 B;  1S3J A;  1PZQ A;  1PP9 E;  3SSU A;  2IBZ I;  3BCC D;  3CCJ P;  3GMA A;  2QJY C;  1DD4 A;  3VYI A;  1GL2 B;  1G1J A;  1KMI Z;  1VQ4 P;  3U1C A;  3H1H E;  2IBZ E;  3CXH D;  3L35 A;  1SQV E;  4IFM A;  4R9T A;  2VRS A;  2JKV A;  1GK4 A;  3HTK A;  1Z56 A;  4GKG A;  1KQL A;  3FXD A;  3L4F A;  1S1C X;  1KV4 A;  2MKV A;  1L0N E;  4H13 C;  4A7P A;  3R4Y A;  1JY3 N;  5KTB A;  1FBM A;  1VF5 C;  2J0Y A;  5KAI E;  1IFP A;  1URQ C;  1JY2 P;  2CK3 H;  3C8V A;  5AVT B;  3P8M C;  2QM7 A;  3PP5 A;  1VQO P;  1N86 B;  1FZC B;  2WPV B;  2M3E A;  4GDO A;  3I5C A;  5AW3 B;  1S5L H;  2O1K A;  1L0L J;  1OMI A;  4LC1 A;  3H1J G;  3BAT A;  3Q2Y A;  1CI6 B;  2I1K A;  3WUT A;  2P58 A;  5KKZ C;  2W6A A;  3AE7 C;  3HUS B;  1L2P A;  3A5T A;  4XFJ A;  1L4A D;  2YIU B;  2H8P D;  3CWB D;  1YBK A;  4HJG H;  3L75 D;  5TJH A;  1OWA A;  1DH3 A;  2W27 A;  1LT9 B;  1VPC A;  1JOC A;  1RY3 A;  1YQ4 C;  1JNM A;  1VQM P;  2IZ0 A;  1HJ0 A;  3AE1 C;  4OWF A;  1NJI Q;  2QJP C;  1BGY D;  2HOD B;  1FZA A;  3F89 A;  4RES B;  1JCC A;  3AE2 C;  1FID A;  2N9B A;  3G71 P;  1NTZ D;  2WSC H;  4QMA A;  2QJK B;  4EYY Q;  1FZF C;  2C0X A;  3I55 P;  2A45 I;  1L0N D;  2Z4E A;  1K73 Q;  1RF1 A;  2M3B A;  1KIL D;  1NKN A;  1VQ6 P;  2OYI B;  4EDF A;  4GOD A;  1Y8A A;  4DCK A;  3LW5 H;  1NTM K;  4L76 A;  1X0T A;  2R5B A;  1SQP J;  2ZYD A;  2WZ7 A;  1KZU B;  2K9J A;  4GOE A;  4Y99 B;  3H1K G;  2E76 B;  3CD6 P;  1CI6 A;  2B89 A;  2OYI A;  3UIA A;  4MN4 C;  1OW7 A;  4PV1 D;  2M8R A;  2Z4E B;  2QEX P;  3G3Z A;  2A06 G;  2HR3 A;  1Q7Y Q;  3V2Q A;  4K3A A;  2P2U A;  4N6J A;  2FKW B;  1KB9 E;  4R4L A;  3RK2 C;  4WY4 C;  4PJ0 H;  3G6E P;  3F5H A;  4ZNC A;  1QGK B;  3CXH E;  2I8D A;  3KQG A;  3MIW A;  2ZYG A;  4JYC A;  1P84 I;  1KYO E;  3Q5S A;  5KLV K;  3MGN A;  1KB9 I;  5CMZ A;  1YYC A;  1ZXG A;  2WIT A;  1VQ8 P;  5C39 A;  5E79 H;  1WMK A;  1T3J A;  2AXT E;  3W67 A;  1FJP A;  2J3F A;  4ZMD A;  2XNX A;  3OJA B;  1LWU A;  2O01 J;  4YTP C;  2ZXE B;  1KB9 D;  1WT6 A;  4OVN F;  5KJ7 C;  3IF4 A;  2Q3I A;  3GLM A;  1HBW A;  1N8R Q;  2JHM F;  2BCC J;  1K9M Q;  2ZVN B;  1SQX E;  1Q90 D;  1KFN A;  1SQB K;  1LTJ B;  3L75 E;  1Q2N A;  3WMM 0;  3OAK A;  3K5B A;  3AE3 C;  1NTM D;  2M5A B;  3TK1 A;  1RE3 A;  5BU5 A;  2J61 A;  3E1I C;  5H2F H;  3B5N A;  1SQB E;  2QA4 P;  2LXB A;  4AQR D;  4EI2 A;  3HD7 B;  1KTM A;  2E42 A;  3HTK B;  1JUN A;  2OYH C;  1X22 A;  3H1K J;  2H43 A;  4WVZ A;  2J5U A;  3H1H D;  2FYN C;  1T8Z A;  2IFM A;  4N3Y B;  3D70 A;  5APT A;  1PP9 G;  2FYU J;  1OVR A;  1N73 A;  3VP8 A;  1SFC C;  5KJ7 A;  1S5L X;  1VL2 A;  2XZR A;  3FWN A;  3SFE C;  3BCC G;  1JY2 N;  2D2C D;  4JYO X;  3R2P A;  1XTG B;  2D39 A;  1SQX J;  2LXC B;  2ZVO B;  4W7Y A;  3L70 E;  3H1L D;  3N4X A;  1OW6 A;  3H1I J;  2E75 C;  3KDP B;  3EQ2 A;  3NFQ A;  1USD A;  3CI9 A;  1NTZ E;  3CPW O;  1PIX A;  2ZT9 C;  3A0B E;  4KJM A;  3V2P A;  4EPU A;  3AE6 C;  4AUW A;  3D6Z A;  1JTH B;  1NTZ K;  2B87 A;  4BXL A;  3BRT B;  3G4S P;  3RK3 E;  1N73 B;  3A7O A;  3TNU B;  2AXC A;  2B88 A;  3RK3 C;  4XE5 B;  3G9R A;  2SPZ A;  5AVU B;  3KYQ A;  1N73 C;  2Y0D A;  4RKU J;  1T2K C;  1PGQ A;  3BVH B;  4ZKU A;  1HUC A;  1UII A;  1P84 H;  1IC2 A;  1EXJ A;  3LW5 J;  2WPR A;  4W7Z A;  1S9K E;  5AVS B;  2J59 M;  4I7Z B;  4DOJ A;  4GIF A;  1LTI C;  2IBZ D;  1KOR A;  3GF3 A;  1PP9 D;  5CCG D;  2QSI A;  1SQP E;  4TLF A;  1JCD A;  3TNU A;  1GZL A;  2N1T C;  1OW8 A;  4HKZ H;  2A45 H;  2GA1 A;  1L0N J;  2JR8 A;  3JCU E;  1HF9 A;  2XNX B;  1EDJ A;  1FC2 C;  2FFD A;  2POH A;  1JY3 P;  1N2D C;  3L75 G;  1NOH A;  2QJY B;  3O6Q A;  3CXH I;  2JHL F;  1KYO I;  2JO1 A;  3I56 P;  1FZG C;  3S4R A;  1FZE C;  4DJG A;  3OW2 O;  1FZG B;  4U3F E;  1SQP G;  4PD4 H;  1KYO H;  1IO4 A;  2KZI A;  2KUB A;  2KNC B;  2CPS A;  4WB4 A;  1FZF A;  2HLO B;  1X9V A;  3B5N D;  2K9J B;  1JMB A;  3MTU E;  2YXQ B;  2NRG A;  1G1I A;  3FGA D;  1NTK J;  3C9I A;  2N9Y B;  4RO0 A;  2WPS A;  1NTK D;  2Y9Z A;  1SLQ A;  3VMA A;  1FIC A;  1T3U A;  2A06 D;  3GF7 A;  3HD7 D;  2WSF J;  1BSH A;  3HUS A;  5L8R J;  3L74 E;  2O1J A;  2ITA A;  1BE3 G;  2Q7C A;  3H32 A; 
#chains in the Genus database with same CATH homology
 3RK3 D;  1X8Y A;  1AFO A;  3L36 A;  1L4A D;  2IFN A;  2WPQ A;  2H8P D;  2JJL A;  1N7S A;  1N7S B;  1DEB A;  3OA7 A;  1LWU C;  2WWW A;  3A3Y B;  1LTT C;  1GL2 C;  2XNX C;  1LWU B;  1NHL A;  2Q9I A;  4W80 A;  1HVV A;  1OWA A;  2GM4 A;  1DH3 A;  2WSF H;  1GL2 D;  2W27 A;  1LT9 B;  1VPC A;  1JOC A;  3P8C E;  1RY3 A;  3H32 C;  2KLV A;  5AW2 B;  1LTG C;  2GUV A;  1JNM A;  1J2J B;  1Z3U A;  4C7R A;  4WBA A;  2WNP F;  1OXZ A;  5CJ4 A;  1RF1 C;  3II6 A;  2NPS B;  2HOD B;  1FZA A;  3IFM A;  2GUS A;  4RES B;  1DX7 A;  1JCC A;  2P67 A;  2HG5 D;  3U59 A;  1GDT A;  2HOD A;  1JO5 A;  1FID A;  5BU8 B;  1IFN A;  2J60 A;  2N9B A;  1FZC C;  1ZR2 A;  2WSC H;  1SQX K;  1FZF C;  2C0X A;  3M91 A;  3BRV B;  4JF7 A;  2JEE A;  2IPP A;  1N7L A;  1LTJ C;  2KB7 P;  2A45 I;  5CHX A;  2Z4E A;  3VOP A;  2J3U A;  2C9N Y;  1RF1 A;  2NPS A;  2J3F D;  2M3B A;  3V4W A;  1KIL D;  1LT9 A;  4O9B A;  2KP8 A;  1FJK A;  5AVR B;  1NKN A;  2OYI B;  1FOS E;  2Q9I B;  1GU4 A;  1URQ B;  2P7J A;  1CZQ A;  1FZF B;  1FZC A;  3P8C D;  3LW5 H;  1H89 A;  1NTM K;  2J0H A;  3V5B A;  1RE4 C;  1XTC C;  2R5B A;  1Z3S A;  3SWF A;  4Y99 C;  2HPC A;  2WZ7 A;  2R32 A;  1KZU B;  3B8E B;  4Y99 B;  1URQ A;  1SQP K;  2L5G B;  2JHI F;  1CI6 A;  2OYI A;  3RK2 B;  4AYC A;  1KFM A;  3UIA A;  1KIL B;  2N1T D;  2M8R A;  4JZC A;  2Z4E B;  2PAJ A;  3G3Z A;  4M7H A;  2KYV A;  2YO3 A;  3RL0 D;  3M9H A;  2J1G A;  3RK2 D;  1URQ D;  3V2Q A;  4ZFG A;  2P2U A;  2WSE H;  4N6J A;  2FKW B;  1M1J C;  1YTZ I;  2FXM A;  3HE4 B;  4C7N A;  1GU5 A;  1RF0 C;  3RK2 C;  4WY4 C;  3M06 A;  3RL0 B;  5CCH D;  5AVW B;  1MUU A;  2R5D A;  5CJ0 A;  3MUD A;  3H32 B;  4DZO A;  3KQG A;  1SQV K;  3MIW A;  1M7L A;  5CCH C;  4JYC A;  5KLV K;  3MGN A;  1FZG A;  1N86 A;  5CMZ A;  1YYC A;  5APS A;  1SVF A;  2WIT A;  4M3L A;  4IFD K;  1X79 B;  2HLO A;  2WT7 B;  3MD0 A;  3U1A A;  1T3J A;  1CW5 A;  1JY3 O;  1FJP A;  1LTA C;  1FZA C;  2NPS D;  2LKM A;  2J3F A;  2MJZ A;  3V4Q A;  3BAS A;  1GL2 A;  2XNX A;  3OJA B;  1LWU A;  2HOD C;  2ZXE B;  3V2R A;  4R9J A;  1IK9 A;  1WT6 A;  2Q9I C;  2Z5H A;  5KJ7 C;  3B5N C;  2Q3I A;  3M9B A;  1HBW A;  2KSJ A;  3O8Z A;  2JHM F;  3E1I B;  2J3G A;  2YMY A;  3NXS A;  1KFN A;  3BVH A;  1SQB K;  2JHH C;  1RE4 B;  1LTJ B;  3RK3 B;  2Z5I A;  2J0G A;  1M1J A;  1A02 F;  1NTK K;  3WMM 0;  3OAK A;  3VMX A;  1FZD A;  3H6P A;  3P32 A;  1MFZ A;  3TK1 A;  1RE3 A;  5BU5 A;  4I6M C;  3M0A A;  2J61 A;  2BAS A;  3VMZ A;  3E1I C;  1JC9 A;  3B5N A;  1QL1 A;  3HE5 B;  1N86 C;  1HJB A;  1IFM A;  1LGH B;  4AQR D;  5AW5 B;  1L4A B;  3HUS C;  1SFC A;  3HRN A;  3HD7 B;  2E42 A;  4XA4 A;  4I1L A;  4B86 A;  1G2C A;  5BVZ A;  3VTP C;  1L0L K;  3HTK B;  1A02 J;  2OYH C;  1JUN A;  3FIB A;  1ZV8 A;  2H43 A;  3VMY A;  2GY7 A;  1LT9 C;  5APY A;  1HTL C;  1JTH A;  1T8Z A;  1NAF A;  4GT1 A;  2IFM A;  2I1J A;  4N3Y B;  1G2C B;  5APT A;  1SFC D;  3NTN A;  1GW3 A;  4EIJ A;  2FFD B;  3KPE A;  2HPC C;  4ZKP A;  1IFI A;  1N73 A;  3VP8 A;  1N7S C;  1SFC C;  1J1E C;  1SQQ K;  2IX7 C;  5KJ7 D;  5KJ7 A;  1T2K D;  2OYH B;  5APW A;  2XU6 A;  1N7S D;  1NKZ B;  3T97 A;  2XZR A;  1HGZ A;  1RF0 A;  1FZE B;  1J1D C;  4EOT A;  1FZB B;  1M1J B;  1JY2 N;  2HYN A;  1FZB C;  1IJD B;  1MV8 A;  1J1D B;  5AVQ B;  5AVZ B;  5AW8 B;  4JYO X;  2FFD C;  3R2P A;  1XTG B;  2D39 A;  3NMD A;  1FOS F;  4W7Y A;  3TYY A;  1HGV A;  3CLQ A;  4JYB A;  3N4X A;  1ZLL A;  4LLH A;  2W6B A;  3GHG A;  2C0W A;  3KDP B;  5CCG C;  3EQ2 A;  3NFQ A;  3CI9 A;  2J2P A;  2OYH A;  2J5Z A;  4WY4 A;  3N7N A;  1SP4 A;  3IR9 A;  1IFD A;  3V2P A;  3B5N B;  1EQ7 A;  3M0D C;  5AW0 B;  4EPU A;  4AUW A;  1JTH B;  2P1J A;  1H88 A;  1NTZ K;  3BRT B;  1N73 B;  2ZFC A;  3A7O A;  3TNU B;  3BVH C;  3RK3 C;  1NU1 K;  4XE5 B;  4WY4 D;  2J64 A;  1W2E A;  5AVU B;  3KYQ A;  5AW4 B;  1N73 C;  2O01 H;  1LTJ A;  1T2K C;  5APV A;  3BVH B;  4ZKU A;  2YNY A;  1HUC A;  2Q5U A;  2QM8 A;  1IC2 A;  1KIL C;  2H43 B;  1NH4 A;  1FZB A;  3TSI A;  5APX A;  3EFG A;  2WPR A;  4W7Z A;  4C7N B;  1S9K E;  2J61 B;  2J58 A;  5AVS B;  1WRG A;  2J59 M;  2N1T B;  1MZ9 A;  4DOJ A;  1L4A A;  4GIF A;  1LTI C;  2HFE D;  2N1T A;  1GTW A;  5AVV B;  2R3C A;  4NYT A;  3GHG C;  3GHG B;  3CL3 D;  2CPB A;  4OH8 B;  5APQ A;  4I2L C;  1RE3 C;  5CCG D;  2WTY A;  2JHK F;  3P7K A;  1GK6 A;  1L0N K;  3LIE A;  2YO2 A;  1YTZ T;  1S9K D;  1JCD A;  3TNU A;  3VP9 A;  1GZL A;  3E1I A;  2FIB A;  2N1T C;  3HE5 A;  2PP6 A;  1FZE A;  1VDF A;  1RF0 B;  1FAV A;  1J1E B;  4M7F A;  3RL0 C;  4KHX A;  2A45 H;  2A45 G;  2YKQ A;  2FYZ A;  3V2N A;  5CCH A;  4WY4 B;  3L37 A;  1GL2 B;  3VYI A;  2XKM A;  2XNX B;  2FFD A;  4LGD E;  2POH A;  1JY3 P;  1N2D C;  1NO4 A;  1G1J A;  1NOH A;  1JMM A;  2HLO C;  3U1C A;  2JHL F;  3L35 A;  4IFM A;  4R9T A;  2Z4E C;  2VRS A;  1FZG C;  1FZE C;  1ZN5 A;  1FU1 A;  1GK4 A;  3HTK A;  2NPS C;  1FZG B;  1Z56 A;  1JY2 O;  1IO4 A;  5AW9 B;  3HD7 A;  4GKG A;  1CSB A;  1KQL A;  1PFI A;  1GW4 A;  3L4F A;  1HH0 A;  1ZR4 A;  4C46 A;  1FZA B;  3A2A A;  2CPS A;  3HE4 A;  4WB4 A;  1GD2 E;  1FZF A;  2HLO B;  1X9V A;  1JY3 N;  1QL2 A;  2C9L Y;  3B5N D;  5AW7 B;  5KTB A;  1H8A A;  1HWT C;  1E5W A;  5AVX B;  1FBM A;  2J0Y A;  2YKO A;  1RE4 A;  3MTU E;  4IFF A;  1RF1 B;  1G1I A;  1URQ C;  1JY2 P;  4N78 E;  5AVT B;  3P8M C;  5CCG A;  5APU A;  2QM7 A;  3C9I A;  3PP5 A;  2WT7 A;  2E43 A;  2FYU K;  1N86 B;  2WPS A;  2XV5 A;  3M9Q A;  4HYT B;  1FZC B;  2HPC B;  1SFC B;  3LID A;  3M0D A;  1SLQ A;  2YKP A;  1FIC A;  1T3U A;  1LTB C;  3I5C A;  5AW3 B;  3HD7 D;  2J3O A;  2H7H A;  1LTS C;  2O1K A;  2KOG A;  3HUS A;  5AW1 B;  1RE3 B;  3VN0 A;  1KIL A;  2O1J A;  3HD7 C;  4HH2 A;  4LC1 A;  5AVY B;  3BAT A;  1NWQ A;  5AW6 B;  1CI6 B;  2XDJ A;  4N78 D;  2OYI C;  1IFJ A;  2I1K A;  2OAR A;  2H43 C;  1AQ5 A;  2W6A A;  1FDM A;  3SWY A;  1FIB A;  1L4A C;  3HUS B;  3A5T A;  2Q7C A;  3H32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...