2FFDC

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E Chain
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2ffdC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2ffdC03
2JHHC 1FZFB 1N86A 3H32C 2FFDB 1FZFC 3HUSA 4M7HA 3GHGA 1LT9B 3BVHA 4M7FA 2FFDC 2OYHB 1FZCB 2J5ZA 2HODA 2J2PA 1FIDA 1JC9A 1JY3O 1RF1C 1LT9C 2J61B 4JZCA 2H43B 1LWUA 1JY2N 2OYHC 1FZCC 2HLOB 1FZAB 2OYIA 1N73A 3E1IA 3FIBA 2JHMF 2J0YA 2J3FD 1N86B 2JHKF 2HLOC 1M1JA 1FZAC 2D39A 2HPCA 1FZDA 1FICA 1N86C 3HUSB 3GHGB 2Z4EA 1FZEA 3BVHB 4ZFGA 2HODB 1FZGA 1FZBB 1Z3SA 2J3UA 3HUSC 3GHGC 1RF0B 2J1GA 3BVHC 1LWUB 1JY2P 2Q9IA 2HODC 1FZFA 2J3OA 1FZBC 2JHLF 1N73B 1RF0C 2H43C 1LWUC 1LTJA 2FFDA 1M1JB 2HPCB 1N73C 2J0GA 2XNXA 1RF1A 4R9JA 2J3FA 1RE3A 1Z3UA 1JY3N 2JHIF 2WNPF 1W2EA 2HPCC 1T3UA 1RE4A 4NYTA 1FZGB 4EPUA 2A45H 2A45I 3H32A 2J64A 4JYOX 2Q9IB 1FZGC 2OYIB 2J0HA 3E1IB 1JY2O 1LTJB 2Q9IC 2OYIC 1FIBA 2XNXB 3E1IC 1RF1B 1RE3B 1LT9A 2J3GA 1LTJC 1JY3P 2GY7A 2Z4EB 2OYHA 1M1JC 1FZCA 1FZEB 1FZBA 2XNXC 2A45G 1RE4B 2FIBA 1RF0A 1RE3C 2J61A 2H43A 2Z4EC 3H32B 1FZEC 4R9TA 2HLOA 1FZAA 2J60A 1RE4C
chains in the Genus database with same CATH superfamily
4CPGA 5CJ0A 1R8EA 3L70E 4K35A 3RGUA 1T2KD 1BDDA 1VQLP 2NRGA 2FFDB 3RK2B 1PP9E 1GL2A 3OJAB 1KFMA 3GHGA 1WMKA 1GU4A 1YBKA 3Q2YA 3CC2P 1Z56A 1VQNP 1LWUA 2OYHC 1OMIA 1FZAB 2XZRA 2OYIA 1S5LX 1NH4A 1L4AC 2H7HA 3L74J 3CWBJ 1GL2B 4OVNF 1H89A 3GHGB 1KYOI 2G3AA 2Q3IA 1NOHA 5CHXA 1EZVI 2Y9ZA 1IFPA 1DIPA 1E5WA 4HYTB 4LGDE 1LWUB 1JOCA 1G2CB 3JCUH 1FZFA 4C7NA 1YQ4C 1NO4A 1HBWA 2J3FA 2K9YA 4RJTA 5KAFE 1M7LA 2QG4A 3SWKA 3LW5J 2FKWB 1KQGB 1USEA 1AQTA 3C9IA 3VMAA 4C7NB 4H13D 1LTAC 3L37A 4GDOA 3CCJP 1AV1A 3L4FA 5AVRB 2ITAA 2GY7A 1PL5A 4UB6H 5CCGA 3TGUJ 1RY3A 4IFDK 1JM0A 3AEAC 1SQBE 1DH3A 1FC2C 2WSFH 4IL6H 3H1JD 3L73D 4M7HA 1YJWP 1WT6A 5B66E 2JDIH 1FJPA 2J2PA 5M1BA 1LTTC 2W8ZA 4RESB 1N73A 5APTA 5CCHC 1URQD 3H1HE 2IX7C 5APUA 2CPBA 1SQPE 4GODA 3L75G 1L0NJ 5APWA 2Y9YA 3CCLP 3AE1C 1S5LE 4EDFA 1M1KQ 3ZDMA 1FU1A 2HODC 2KB7P 1N73B 2XKMA 1HH0A 1PGQA 3A0HE 1SQQD 1KILC 2BCCD 2RMZA 3H1LE 4GT1A 3CC4P 1FDIA 4JYOX 5BU5A 1ZV8A 4IOIH 4HH2A 1DEBA 4IFFA 1J1DC 3UIAA 3Q5PA 3LW5H 3E1IC 3L74G 4Y28J 3QWOC 3CWBG 1K8AQ 4OGQD 1NJIQ 3MUDC 1HJBA 2H43A 1IFNA 1JO5A 4H0LD 3AEGC 2J60A 2Q1KA 2W6AA 3RBXA 1M90Q 2C9LY 3AE2C 5AVWB 1NU1D 5E79E 2IPPA 4H44D 2Y0DA 5AW7B 1PGOA 1JEKA 3WUVA 4JZCA 2H43B 2C9NY 1SQBK 2FYUK 2M8RA 4D6TJ 2ZYGA 4L73A 3CCVP 1G1IA 3A7OA 3O8ZA 1S2EA 2L5GB 5KJ7C 4PD4E 1S9KD 1LTIC 3B4SA 1YIJP 2HR3A 1GK6A 3HRNA 2E74C 4TLFA 2QM8A 3GMAA 2Y0CA 3TGUG 2JHLF 1NVOA 3L36A 1Q81Q 1G1JA 5CJ4A 3IFMA 2FYUJ 2XNXA 1VF5D 2IZ1A 1SQPK 2I1KA 2K88A 2WSCH 5BU8B 5EFWB 3RL0D 2JEEA 2AEFA 1JNMA 2XDJA 2QJKC 2QRXA 1VQOP 2KK7A 1K9MQ 2D2CD 4UB8E 4I2LC 2XNXB 5AVXB 4ZKUA 3TK1A 3L70D 1FZEB 3CXHE 2R3CA 2XV5A 1LT1A 1RE3C 1PP9D 1L0NG 2HLOA 2B87A 1SVFA 3VN0A 4JQ0D 1RE4C 4LLHA 1Q2NA 1DX7A 1L2PA 2QJYC 2AEJA 2WT7A 4U7JA 4M7FA 3MD0A 2FFDC 4L75A 2J5ZA 3S9OA 3L70G 3H1KE 2PRRA 3BCCJ 2HLOB 2B87B 1BDCA 1JCCA 2JHKF 1FZAC 3L35A 3IAOA 4DJGA 2WT7B 1FICA 3PLNA 4H13B 1R5SA 3TSIA 1GL2C 3T97A 1Z3SA 5H2FH 4Y99C 2AXTE 3GHGC 3H1ID 3V2RA 3CX5E 3L73E 2ZT9D 2Y0EA 3PP5A 1LWUC 4A7PA 1SFCC 1URQA 2W90A 3T97B 4UB6E 1KZUB 4U3FJ 3OW2O 1FS0E 3H32A 2KSEA 2P7JA 4TT3H 2HFED 1SQXE 1SQVJ 1VQKP 1L0LJ 4EI2A 2N9YB 5APSA 1VQ5P 4D6TG 3PJSK 1W5CE 1URQB 1SQBD 2KLVA 3EFFK 1IFIA 1P84I 2V4HA 2UWJE 2YXRB 3KQGA 2A06G 1BE3E 1SQQE 1YJ9P 2JJLA 3H32B 3LIEA 3RL0g 4N3YB 1T8ZA 3HD7D 3AE3C 2FYUG 1S1CX 3H1HD 1MKMA 3V5BA 3CLQA 4HKZH 1E79H 3P8CE 1NTKE 3G4SP 1JY2N 1KB9E 5CCGC 3VP8A 3PH0A 4HB1A 1SQPD 3L71E 1HWTC 5CBNA 3M9HA 1KYOH 1T6AA 4NPFX 3CL3D 1Y9BA 1VQ4P 3H1HG 2KZIA 3MZWB 1U57A 4OGQB 1JY2P 1PPJG 2J58A 1SQPG 3CD6P 3H1LD 2LKMA 4H0LB 1N73C 4JF7A 4ZNCA 1A02F 4H44B 4EPUA 1IFMA 3VOPA 3N4XA 1RQUA 5AVUB 4QMAA 1IO4A 1HTLC 2E75D 1EDJA 1JY2O 2E5TA 3BCCG 1EZVD 1FIBA 4MN4C 1KV4A 3N7NA 3R2PA 1M1JC 1FZBA 2A45G 1RF0A 2YO3A 3I55P 4R9TA 2M3BA 1UIIA 1SQXK 2RN0A 3B8EB 3H1JJ 1AVOA 3L75J 3HUSA 1GU5A 1LTSC 4O9BA 2E5YA 1VF5B 1SQQK 5B5EH 2WSSH 4PD4D 3RL0B 1JMBA 2E43A 3G3ZA 5L8RJ 2E42A 2B88A 1SQVG 1ZN5A 1GMJA 3HUSB 1L0LG 2Z4EA 2AEMA 2D2CB 1ZR4A 1BCCE 2P58A 3SWYA 3WUTA 3I56P 2KSJA 1NTKK 5K5GB 2ZAEB 1FDOA 5KKZC 1SQQJ 3CCRP 5KAIE 5DJUB 3GLMA 2BCCJ 1FDMA 1VQ6P 4NPDA 3B5NC 1K73Q 1NTZE 1M56D 1KC8Q 1NU1K 2A45I 3AE4C 1IFJA 2YIUB 2R5DA 2OYIB 2KS1A 3CXHD 3JSVC 2IZ0A 2WWWA 3H1IE 3BASA 2KNCA 3D70A 3K5BA 3M0DA 1LT9A 3O6QA 1Q86Q 2K1AA 2XNXC 2MKVA 1RHZB 3D71A 1FZEC 4JPZB 4ASWA 1OX3A 1FZFB 2KS1B 1MUUA 2O1KA 2LR2A 3H1KD 1NU1J 2W6JH 2ZT9B 5AW8B 3U1CA 2KNCB 1PIXA 2GUSA 1LT9B 3O6QB 3A5TA 3A0BH 2CK3H 3CCEP 1A02J 1QVFO 4YXDC 3CCMP 5KLVE 3KDPB 1JCDA 4RO0A 3USSA 1BSNA 2HLOC 1MZ9A 3CX5D 2B89A 4PJ0E 5GTIH 1GD2E 1QVGO 4XE5B 3HD7A 2KYVA 4JYBA 2W27A 2ZVOB 4H13C 4AYCA 1NTME 2Q9IA 1FBMA 1EXJA 1LTJA 1R5LA 1RQVA 3H1JG 4C46A 3L73G 1SQXD 2WNPF 3HD7B 4NYTA 3VMYA 4JYCA 2Q9IB 1MV8A 1BGYE 4WWIA 3MP7B 1LTJB 3EQ2A 1BE3D 2WITA 3L70J 1KD1Q 2OARA 2KLUA 1URQC 2GUVA 1PP9J 1YQ3C 1PGJA 2QEXP 3P32A 1N8RQ 2QM7A 2ZXEB 1KMIZ 1VQ8P 3H32C 2KIKA 1OW8A 3L72E 3P8CD 1LP1A 1NTKD 2H89C 2IBZD 3MHVA 1KB9D 1SQQG 2SPZA 2BCCG 2GA1A 3L71D 2QA4P 1KYOE 4XA4A 4ZMDA 1OXZA 1RF1C 1EZVE 2OTLP 5KLIB 3FIBA 2RH0A 3MIWA 2CPSA 1ZMEC 1QL2A 3SWFA 1QGKB 1LP1B 1N7SD 1SS1A 1KQLA 2E75B 1LNQA 3ABVC 3KZIH 1LTBC 4HJGH 1FOSE 2O01N 3WU2H 4XFJA 1Q90D 4K3AA 5KJ7D 2JR8A 3V2PA 2QJPC 4KJMA 5GTHE 4DOJA 1LGHB 2E74D 5KLVK 2KP8A 4OGQC 1JTHA 3Q5SA 2N1TD 2ZXXA 3RK3C 5TISH 2ZVNB 3A2AA 1NU1G 1KQFB 2JP3A 1OW6A 1GK4A 1XTCC 2E76D 3G6EP 1NTMK 3Q3DA 2N9BA 4H44C 1ZR2A 1JTHB 2GM4A 1SQBJ 4GOFA 3BATA 1P84H 4IL6X 5APVA 3CCUP 1M8OB 3W67A 1YITP 3G9RA 3VTPC 4DCKA 4DT0A 3CPWO 2O1JA 2R3SA 2KXPB 3CC7P 3TYYA 5AW3B 3I5CA 2HG5D 2YXQB 3H1HJ 4AUWA 1HJ0A 2PP6A 2O01J 1YHQP 1SQPJ 3C1LA 1VF5C 1BCCD 5AW5B 2H8PD 2D39A 1OWAA 2C0WA 3FGAD 2Q6QA 3VP9A 4PV1D 4BXLA 3RK2C 2J3UA 2M0BA 3HUSC 2Z5HA 2D2CC 2J3OA 1NTZD 1PP9G 3H1LJ 2P2UA 1IK9A 3JCUE 1BCCG 3U59A 5AW2B 1J2JB 5CBOA 3P8MC 2ZYAA 1IC2A 1SFCD 2QSIA 3HE5A 3PHLA 2QE7H 2WPVB 1CI6A 2AXCA 1VDFA 1VQMP 2YIUC 1OVUA 2OYIC 1NWQA 2BEQD 1EXIA 1FAVA 3HTKA 1OVRA 2FYNB 4LC1A 2FIBA 1JUNA 4RKUJ 2M3EA 3HE5B 3H1IG 3AECC 1T3JA 2ZFCA 1CI6B 1WRGA 2YO2A 1KILE 2L91A 1FZFC 4IL6E 1DD4A 2LXCB 5KLVD 3HTKB 1LTGC 3TF5A 2M5AA 2LXBA 3M0DC 1LT9C 1W2BO 2OYOA 1MFZA 3E1IA 1VPCA 2JHMF 2O01H 2J0YA 1NTMD 2QIWA 4KHXA 4WY4D 1SQBG 4W80A 3L74E 1CW5A 1J1DB 2J1GA 3CWBE 2IBZE 1PZQA 1JB0J 5DJTB 1U7MA 1SP4A 2FXMA 2V7QJ 3EFGA 4NPEA 1Q7YQ 2QVAA 1Z3UA 1BGYD 1W2EA 1NYHA 1N7SA 3G71P 3V2QA 5AW0B 3FWLA 2A45H 1OIPA 3HD7C 3EWKA 5AVQB 5KJ7A 4I1LA 2G8YA 2Q9IC 3PTZA 3MGNA 1LTJC 1ZW0A 3FXDA 1N7SB 2N1TA 2YKQA 3GF7A 3L72D 2I8DA 2J5UA 1Y8AA 2JHHC 2P1JA 5E79H 3H1KJ 1KYOD 1EQ7A 2I1JA 3TGUE 1YI2P 3H1LG 2E74B 1AQ5A 1X0TA 3BVHA 2WPSA 1OFCX 3KZIE 2N1TB 3M06A 2NPSD 3AE7C 5TJHA 2O3JA 2KI7B 2E76B 1K05A 4PD4H 2PAJA 2K37A 3L73J 1EZVG 3BRVB 3AE9C 2R32A 1AFOA 3BVHB 2E75C 1FZGA 1FZBB 1RF0B 4U3FD 1NKZB 1IK7A 2H43C 1L0NE 2FFDA 2IYOA 3E7KA 3NMDA 1L4AD 1SQXJ 3MTUE 2KUBA 3CCSP 2OGUA 2WSFJ 4WB4A 1FZGB 1P84E 3BRTB 2WZ7A 3B5ND 3NTNA 4UB8H 1BE3J 3JC22 5AVSB 1AVYA 1S3JA 4DZOA 1YTZT 1EDKA 3CXHH 4YXWH 1AA0A 2J3GA 1JMMA 2Z4EB 4R4MA 1FZCA 1KQSO 1X79B 1PV3A 4R4LA 5BVZA 3H6PA 1G2CA 2JO1A 1T2KC 2WPQA 4PV1B 1SFCA 3S4RA 4BWNA 1N86A 1NTKJ 4Y99B 3L71J 1FZCB 3KXDA 2FY8A 2WTYA 1H8AA 4EOTA 3WUUA 1SFCB 1N86B 1GTWA 1ZRTE 1YYCA 2HPCA 2AXTH 4BRYA 3CX5H 2R44A 4B86A 4D6TE 3AEFC 4L74A 4Z1MH 2IFMA 1ZLLA 2MJZA 5C39A 5H2FE 2A06E 2XNDH 3GF3A 3B71A 1MFTA 1EDIA 4PD4I 2HPCB 2KZJA 3H1KG 1OZHA 2FYZA 4IFMA 2OTJP 1JY3N 3F89A 4BRYB 5CCHD 1GW3A 1TU3F 5AW6B 1HF9A 2R5BA 4M3LA 4I7ZB 2NZ2A 1OW7A 4W7ZA 4WY4A 2FYUE 3V4QA 2P67A 5AW9B 3KPEA 5AW4B 4N78E 1S4XA 1L0NK 1YJNP 3L75D 1JY3P 3V6IA 1KILD 4WY4B 1LJ2A 2FYNC 3Q1MA 5APYA 1PGPA 1PPJE 1J1EB 3CXHI 2Q5UA 1NTZK 1NGMB 3CMAP 1KB9H 1SQXG 1JY3O 1BCCJ 1M57D 3FWNA 2WSCJ 3LIDA 3GW6A 2PFXA 1M1JA 3L74D 3CWBD 1FZDA 2WSEJ 1AJYA 1FE6A 1BE3G 3BCCE 3A3YB 1NHLA 3AE5C 1ZXGA 5CMZA 4YTPC 1NTZJ 1NAYA 2NPSA 3M0AA 1M1JB 3F5HA 3V4WA 3OAKA 2J0GA 3RBZA 1NTKG 2IBZG 2JHIF 1HGZA 3CX5I 3H1IJ 3RK3D 1FOSF 3L71G 3HE4A 1QX8A 1CZQA 2DW3A 2W6BA 2J0HA 2NPSB 1D7MA 4GIFA 3WMM0 4U3FE 3NXSA 1QL1A 1OVVA 4H0LC 2OYHA 4OWFA 3TGUD 1L4AA 1SQVE 2Q3EA 2J61A 1GZLA 1L0LE 3HE4B 1UIXA 3TDKA 3KHUA 1N7SC 2Q7CA 3AE8C 2WMMA 3M9BA 3B5NA 1YTZI 1Y47A 3Q5RA 4GKGA 5KLVJ 2OYHB 1Q82Q 1JC9A 5KKZB 1L4AB 2J61B 3KYQA 2N1TC 4EYYQ 5B5EE 3B5NB 1GW4A 1NTMJ 2WQYC 2J59M 2E76C 1H88A 1FZEA 1X22A 1KN7A 2WSEH 2FBWC 1L0ND 2IBZI 1KB9I 3BVHC 3AE6C 5KAIH 1KORA 5AVZB 1FZBC 3RK2D 2IYPA 1RH5B 1RF0C 4WVZA 5KTBA 1P84D 2Z5IA 2JWAA 5AVVB 3RL0C 4KT0J 3P7KA 4W7YA 1BGYJ 1KTMA 1IJDB 3H25A 2ZYDA 1N7LA 4GOEA 4JBZA 3TNUA 2JWDA 1ZOYC 1FZGC 1GL2D 2YKOA 4I6MC 3SSUA 5KAFH 4AQRD 3CCQP 3L72J 5APXA 1VQPP 5CCHA 2Z4EC 1HUCA 3TNUB 5AVYB 1NTZG 1XTGB 4PV1C 2XU6A 3OA7A 4ZKPA 1DEEG 2HODA 3ITKA 1SQVK 3IR9A 1ZRTD 1L0LK 3H1JE 3A0BE 5AVTB 1FZCC 4C7RA 2YNYA 3PRJA 3L75E 3C8VA 3W68A 1KILA 4D6TD 4PJ0H 2J3FD 2P10A 3VMZA 1X9VA 5B66H 1N86C 2A06D 3NFQA 2ZT9C 2HODB 5GTIE 3GG2A 2OQQA 1EC5A 2VRSA 3V2NA 1QLED 5APQA 3CI9A 1U7JA 1KILB 2WVRA 1FJKA 3FXEA 1SLQA 5CCGD 4YPCA 2ZJSE 2FYUD 1RF1A 3MUDA 1VL2A 1X8YA 4N78D 2HPCC 1S5LH 4WBAA 2PGDA 5KLVG 2M5AB 2J64A 2BCCE 1N2DC 4I7ZC 1KFNA 3A0HH 5AW1B 2FXOA 3II6A 3E1IB 4L76A 1EDLA 1DD3A 1RF1B 3M91A 1NTMG 2POHA 2W83C 3CMEP 2BEZF 2H88C 3QH9A 3SFEC 2HYNA 1PPJD 4OH8B 2OTKE 3U1AA 3VYIA 3M9QA 3AEEC 1VQ7P 4WY4C 1HVVA 1H0TA 2IFNA 1NKNA 3RK3E 1NAFA 2FXPA 3AEDC 3FX0A 2QJPB 3IN6A 2YKPA 1FIDA 1J1EC 1BGYG 2YMKA 1NU1E 1HGVA 3BCCD 3RK3B 2RKLA 1H0TB 3D6YA 2WPRA 4ASVA 2IDBA 2K9JA 4ZFGA 1K04A 5GTHH 2KOGA 3WU2E 1S72P 1S9KE 3L72G 3R4YA 3VMXA 1VQ9P 1IFDA 1BSHA 2C0XA 5KLIC 3S1KA 4R9JA 1RE3A 2K9JB 2K3RA 2QJKB 1T3UA 1RE4A 2JKVA 3IF4A 5TISE 3AEBC 1PFIA 1QEXA 1CSBA 1SQVD 1L0LD 1IZNB 2YMYA 4N6JA 2NPSC 1RE3B 1USDA 3D6ZA 1ZP0C 1RE4B 2V7QH 4EIJA 1GDTA 2QJYB 2BASA 3E1RA 1FZAA 2B9BA 3SFDC 4U3FG
chains in the Genus database with same CATH topology
5CJ0A 3VTPC 4N3YB 5APYA 2O1JA 1T8ZA 1T2KD 3HD7D 2FFDB 3RK2B 1GL2A 3OJAB 1J1EB 1KFMA 3GHGA 3TYYA 5AW3B 2Q5UA 3I5CA 2HG5D 1NTZK 4AUWA 1GU4A 2PP6A 3V5BA 3CLQA 1JY3O 3P8CE 1Z56A 1LWUA 1JY2N 2OYHC 5CCGC 3VP8A 1FZAB 2XZRA 2OYIA 1NH4A 1L4AC 1HWTC 2H7HA 3LIDA 1M1JA 2H8PD 5AW5B 2D39A 1OWAA 2C0WA 1FZDA 1GL2B 3M9HA 1H89A 3A3YB 3GHGB 3CL3D 2Q3IA 1NOHA 5CHXA 3VP9A 1NHLA 3RK2C 2J3UA 3HUSC 2Z5HA 5CMZA 1E5WA 4HYTB 4LGDE 1LWUB 1JOCA 1JY2P 1G2CB 1FZFA 2J3OA 2J58A 2NPSA 4C7NA 2P2UA 2LKMA 1IK9A 3M0AA 1M1JB 3V4WA 3U59A 1NO4A 3OAKA 1N73C 2J0GA 4JF7A 5AW2B 1HBWA 1J2JB 2J3FA 3P8MC 2JHIF 1A02F 1HGZA 1IC2A 1M7LA 1SFCD 4EPUA 1IFMA 3RK3D 1FOSF 3VOPA 3N4XA 3HE4A 3HE5A 5AVUB 2FKWB 1CZQA 3C9IA 1IO4A 1HTLC 2W6BA 2J0HA 2NPSB 1CI6A 4C7NB 1JY2O 1VDFA 1LTAC 3L37A 4GIFA 2OYIC 1NWQA 1FIBA 3WMM0 3N7NA 3NXSA 3R2PA 3L4FA 5AVRB 1QL1A 2GY7A 1FAVA 2OYHA 1M1JC 3HTKA 5CCGA 1FZBA 4LC1A 2A45G 2FIBA 1L4AA 1RF0A 2J61A 1JUNA 1GZLA 2YO3A 1RY3A 4IFDK 3HE4B 3HE5B 4R9TA 1N7SC 2Q7CA 2M3BA 3M9BA 1SQXK 1DH3A 1T3JA 2ZFCA 2WSFH 1CI6B 3B5NA 3B8EB 1WRGA 2YO2A 1YTZI 1FZFC 3HUSA 4GKGA 4M7HA 1WT6A 1GU5A 1LTSC 2OYHB 3HTKB 1LTGC 1FJPA 4O9BA 2J2PA 1JC9A 1L4AB 3M0DC 2J61B 1LT9C 1LTTC 1SQQK 4RESB 3KYQA 2N1TC 3RL0B 1MFZA 3E1IA 1N73A 1VPCA 5APTA 2JHMF 2O01H 5CCHC 1URQD 2E43A 2J0YA 3B5NB 1GW4A 3G3ZA 2IX7C 2E42A 5APUA 2J59M 2CPBA 1ZN5A 4KHXA 3HUSB 1H88A 2Z4EA 1FZEA 4WY4D 1ZR4A 5APWA 4W80A 2WSEH 3SWYA 1CW5A 1J1DB 2KSJA 2J1GA 1NTKK 3BVHC 1FU1A 2HODC 5AVZB 1FZBC 2KB7P 3RK2D 1N73B 1RF0C 2XKMA 5KTBA 1HH0A 1SP4A 2Z5IA 2FXMA 3EFGA 5AVVB 3RL0C 1FDMA 1KILC 3P7KA 4W7YA 1Z3UA 3B5NC 1IJDB 1W2EA 1N7SA 4GT1A 3V2QA 5AW0B 2A45H 1NU1K 2A45I 3HD7C 1N7LA 3TNUA 1IFJA 5BU5A 4JYOX 5AVQB 2R5DA 1FZGC 5KJ7A 2OYIB 1ZV8A 4HH2A 1DEBA 1GL2D 4I1LA 4IFFA 1J1DC 2YKOA 4I6MC 3UIAA 2Q9IC 3LW5H 2WWWA 3BASA 3MGNA 3E1IC 3M0DA 1LT9A 1LTJC 4AQRD 1N7SB 2N1TA 2XNXC 5APXA 2YKQA 1HJBA 2H43A 5CCHA 2Z4EC 1IFNA 1JO5A 1FZEC 1HUCA 2J60A 3TNUB 2W6AA 2JHHC 1FZFB 1MUUA 2P1JA 2O1KA 2C9LY 5AVYB 1XTGB 1EQ7A 2I1JA 5AW8B 3U1CA 5AVWB 2IPPA 1AQ5A 2XU6A 2GUSA 1LT9B 3OA7A 4ZKPA 3A5TA 3BVHA 2WPSA 5AW7B 2HODA 2N1TB 1A02J 1SQVK 3M06A 3IR9A 4JZCA 2NPSD 1L0LK 2H43B 2C9NY 5AVTB 1FZCC 4C7RA 1SQBK 2YNYA 2FYUK 2M8RA 1KILA 3KDPB 1JCDA 2J3FD 1G1IA 2HLOC 2PAJA 3A7OA 1MZ9A 3O8ZA 3VMZA 2L5GB 5KJ7C 1X9VA 3BRVB 1GD2E 1S9KD 2R32A 1LTIC 1N86C 1AFOA 3BVHB 4XE5B 3HD7A 2KYVA 3NFQA 4JYBA 2HODB 2W27A 1GK6A 3HRNA 1FZGA 1FZBB 2QM8A 2VRSA 4AYCA 1RF0B 3V2NA 5APQA 2Q9IA 3CI9A 1FBMA 2JHLF 1NKZB 3L36A 1G1JA 5CJ4A 1KILB 2H43C 3IFMA 1LTJA 2FFDA 1FJKA 1SLQA 5CCGD 2XNXA 3NMDA 1RF1A 1L4AD 3MUDA 3MTUE 1SQPK 2I1KA 2WSCH 4C46A 2WNPF 5BU8B 3HD7B 1X8YA 4N78D 2HPCC 4WBAA 3RL0D 4NYTA 4WB4A 1FZGB 3BRTB 2JEEA 2WZ7A 1JNMA 2XDJA 3VMYA 3B5ND 2J64A 1N2DC 3NTNA 4JYCA 2Q9IB 1MV8A 1KFNA 5AW1B 3II6A 3E1IB 5AVSB 1LTJB 3EQ2A 4DZOA 1YTZT 4I2LC 2XNXB 2WITA 1RF1B 5AVXB 2J3GA 3M91A 1JMMA 4ZKUA 2Z4EB 2OARA 3TK1A 2POHA 1FZCA 1FZEB 2R3CA 2XV5A 1URQC 1X79B 2GUVA 5BVZA 1RE3C 2HYNA 3H6PA 1G2CA 1T2KC 4OH8B 2WPQA 2HLOA 1SVFA 3P32A 3VN0A 1RE4C 4LLHA 1SFCA 3U1AA 3VYIA 3M9QA 1DX7A 2QM7A 4WY4C 2ZXEB 1N86A 3H32C 1HVVA 2IFNA 3P8CD 1NKNA 1NAFA 2WT7A 4Y99B 4M7FA 3MD0A 2FFDC 2YKPA 1FZCB 2J5ZA 4XA4A 1FIDA 1J1EC 1OXZA 1RF1C 2WTYA 1H8AA 1HGVA 2HLOB 4EOTA 1JCCA 1SFCB 3FIBA 3RK3B 3MIWA 2CPSA 1N86B 2JHKF 1FZAC 1QL2A 1GTWA 3SWFA 1YYCA 2HPCA 1N7SD 2WPRA 3L35A 1KQLA 2WT7B 1LTBC 1FICA 1FOSE 4ZFGA 3TSIA 4B86A 2KOGA 1GL2C 3T97A 1Z3SA 5KJ7D 4Y99C 3GHGC 3V2RA 3V2PA 2IFMA 1ZLLA 2MJZA 1S9KE 4DOJA 1LGHB 3VMXA 1IFDA 3PP5A 5KLVK 2C0XA 2KP8A 1JTHA 1LWUC 2HPCB 1SFCC 2N1TD 2FYZA 1URQA 3RK3C 4R9JA 1RE3A 4IFMA 3A2AA 1JY3N 5CCHD 1GW3A 5AW6B 2R5BA 1T3UA 1GK4A 4M3LA 1RE4A 1XTCC 1KZUB 4W7ZA 4WY4A 1PFIA 1NTMK 3H32A 3V4QA 2N9BA 2P67A 2P7JA 5AW9B 3KPEA 5AW4B 2HFED 1CSBA 4N78E 1ZR2A 1JTHB 2GM4A 1L0NK 5APSA 2YMYA 4N6JA 2NPSC 3BATA 1URQB 2KLVA 1RE3B 1JY3P 1IFIA 5APVA 3KQGA 1RE4B 4EIJA 1GDTA 1KILD 4WY4B 2BASA 2JJLA 3H32B 3LIEA 1FZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHH C;  1FZF B;  1N86 A;  3H32 C;  2FFD B;  1FZF C;  3HUS A;  4M7H A;  3GHG A;  1LT9 B;  3BVH A;  4M7F A;  2FFD C;  2OYH B;  1FZC B;  2J5Z A;  2HOD A;  2J2P A;  1FID A;  1JC9 A;  1JY3 O;  1RF1 C;  1LT9 C;  2J61 B;  4JZC A;  2H43 B;  1LWU A;  1JY2 N;  2OYH C;  1FZC C;  2HLO B;  1FZA B;  2OYI A;  1N73 A;  3E1I A;  3FIB A;  2JHM F;  2J0Y A;  2J3F D;  1N86 B;  2JHK F;  2HLO C;  1M1J A;  1FZA C;  2D39 A;  2HPC A;  1FZD A;  1FIC A;  1N86 C;  3HUS B;  3GHG B;  2Z4E A;  1FZE A;  3BVH B;  4ZFG A;  2HOD B;  1FZG A;  1FZB B;  1Z3S A;  2J3U A;  3HUS C;  3GHG C;  1RF0 B;  2J1G A;  3BVH C;  1LWU B;  1JY2 P;  2Q9I A;  2HOD C;  1FZF A;  2J3O A;  1FZB C;  2JHL F;  1N73 B;  1RF0 C;  2H43 C;  1LWU C;  1LTJ A;  2FFD A;  1M1J B;  2HPC B;  1N73 C;  2J0G A;  2XNX A;  1RF1 A;  4R9J A;  2J3F A;  1RE3 A;  1Z3U A;  1JY3 N;  2JHI F;  2WNP F;  1W2E A;  2HPC C;  1T3U A;  1RE4 A;  4NYT A;  1FZG B;  4EPU A;  2A45 H;  2A45 I;  3H32 A;  2J64 A;  4JYO X;  2Q9I B;  1FZG C;  2OYI B;  2J0H A;  3E1I B;  1JY2 O;  1LTJ B;  2Q9I C;  2OYI C;  1FIB A;  2XNX B;  3E1I C;  1RF1 B;  1RE3 B;  1LT9 A;  2J3G A;  1LTJ C;  1JY3 P;  2GY7 A;  2Z4E B;  2OYH A;  1M1J C;  1FZC A;  1FZE B;  1FZB A;  2XNX C;  2A45 G;  1RE4 B;  2FIB A;  1RF0 A;  1RE3 C;  2J61 A;  2H43 A;  2Z4E C;  3H32 B;  1FZE C;  4R9T A;  2HLO A;  1FZA A;  2J60 A;  1RE4 C; 
#chains in the Genus database with same CATH topology
 4CPG A;  5CJ0 A;  1R8E A;  3L70 E;  4K35 A;  3RGU A;  1T2K D;  1BDD A;  1VQL P;  2NRG A;  2FFD B;  3RK2 B;  1PP9 E;  1GL2 A;  3OJA B;  1KFM A;  3GHG A;  1WMK A;  1GU4 A;  1YBK A;  3Q2Y A;  3CC2 P;  1Z56 A;  1VQN P;  1LWU A;  2OYH C;  1OMI A;  1FZA B;  2XZR A;  2OYI A;  1S5L X;  1NH4 A;  1L4A C;  2H7H A;  3L74 J;  3CWB J;  1GL2 B;  4OVN F;  1H89 A;  3GHG B;  1KYO I;  2G3A A;  2Q3I A;  1NOH A;  5CHX A;  1EZV I;  2Y9Z A;  1IFP A;  1DIP A;  1E5W A;  4HYT B;  4LGD E;  1LWU B;  1JOC A;  1G2C B;  3JCU H;  1FZF A;  4C7N A;  1YQ4 C;  1NO4 A;  1HBW A;  2J3F A;  2K9Y A;  4RJT A;  5KAF E;  1M7L A;  2QG4 A;  3SWK A;  3LW5 J;  2FKW B;  1KQG B;  1USE A;  1AQT A;  3C9I A;  3VMA A;  4C7N B;  4H13 D;  1LTA C;  3L37 A;  4GDO A;  3CCJ P;  1AV1 A;  3L4F A;  5AVR B;  2ITA A;  2GY7 A;  1PL5 A;  4UB6 H;  5CCG A;  3TGU J;  1RY3 A;  4IFD K;  1JM0 A;  3AEA C;  1SQB E;  1DH3 A;  1FC2 C;  2WSF H;  4IL6 H;  3H1J D;  3L73 D;  4M7H A;  1YJW P;  1WT6 A;  5B66 E;  2JDI H;  1FJP A;  2J2P A;  5M1B A;  1LTT C;  2W8Z A;  4RES B;  1N73 A;  5APT A;  5CCH C;  1URQ D;  3H1H E;  2IX7 C;  5APU A;  2CPB A;  1SQP E;  4GOD A;  3L75 G;  1L0N J;  5APW A;  2Y9Y A;  3CCL P;  3AE1 C;  1S5L E;  4EDF A;  1M1K Q;  3ZDM A;  1FU1 A;  2HOD C;  2KB7 P;  1N73 B;  2XKM A;  1HH0 A;  1PGQ A;  3A0H E;  1SQQ D;  1KIL C;  2BCC D;  2RMZ A;  3H1L E;  4GT1 A;  3CC4 P;  1FDI A;  4JYO X;  5BU5 A;  1ZV8 A;  4IOI H;  4HH2 A;  1DEB A;  4IFF A;  1J1D C;  3UIA A;  3Q5P A;  3LW5 H;  3E1I C;  3L74 G;  4Y28 J;  3QWO C;  3CWB G;  1K8A Q;  4OGQ D;  1NJI Q;  3MUD C;  1HJB A;  2H43 A;  1IFN A;  1JO5 A;  4H0L D;  3AEG C;  2J60 A;  2Q1K A;  2W6A A;  3RBX A;  1M90 Q;  2C9L Y;  3AE2 C;  5AVW B;  1NU1 D;  5E79 E;  2IPP A;  4H44 D;  2Y0D A;  5AW7 B;  1PGO A;  1JEK A;  3WUV A;  4JZC A;  2H43 B;  2C9N Y;  1SQB K;  2FYU K;  2M8R A;  4D6T J;  2ZYG A;  4L73 A;  3CCV P;  1G1I A;  3A7O A;  3O8Z A;  1S2E A;  2L5G B;  5KJ7 C;  4PD4 E;  1S9K D;  1LTI C;  3B4S A;  1YIJ P;  2HR3 A;  1GK6 A;  3HRN A;  2E74 C;  4TLF A;  2QM8 A;  3GMA A;  2Y0C A;  3TGU G;  2JHL F;  1NVO A;  3L36 A;  1Q81 Q;  1G1J A;  5CJ4 A;  3IFM A;  2FYU J;  2XNX A;  1VF5 D;  2IZ1 A;  1SQP K;  2I1K A;  2K88 A;  2WSC H;  5BU8 B;  5EFW B;  3RL0 D;  2JEE A;  2AEF A;  1JNM A;  2XDJ A;  2QJK C;  2QRX A;  1VQO P;  2KK7 A;  1K9M Q;  2D2C D;  4UB8 E;  4I2L C;  2XNX B;  5AVX B;  4ZKU A;  3TK1 A;  3L70 D;  1FZE B;  3CXH E;  2R3C A;  2XV5 A;  1LT1 A;  1RE3 C;  1PP9 D;  1L0N G;  2HLO A;  2B87 A;  1SVF A;  3VN0 A;  4JQ0 D;  1RE4 C;  4LLH A;  1Q2N A;  1DX7 A;  1L2P A;  2QJY C;  2AEJ A;  2WT7 A;  4U7J A;  4M7F A;  3MD0 A;  2FFD C;  4L75 A;  2J5Z A;  3S9O A;  3L70 G;  3H1K E;  2PRR A;  3BCC J;  2HLO B;  2B87 B;  1BDC A;  1JCC A;  2JHK F;  1FZA C;  3L35 A;  3IAO A;  4DJG A;  2WT7 B;  1FIC A;  3PLN A;  4H13 B;  1R5S A;  3TSI A;  1GL2 C;  3T97 A;  1Z3S A;  5H2F H;  4Y99 C;  2AXT E;  3GHG C;  3H1I D;  3V2R A;  3CX5 E;  3L73 E;  2ZT9 D;  2Y0E A;  3PP5 A;  1LWU C;  4A7P A;  1SFC C;  1URQ A;  2W90 A;  3T97 B;  4UB6 E;  1KZU B;  4U3F J;  3OW2 O;  1FS0 E;  3H32 A;  2KSE A;  2P7J A;  4TT3 H;  2HFE D;  1SQX E;  1SQV J;  1VQK P;  1L0L J;  4EI2 A;  2N9Y B;  5APS A;  1VQ5 P;  4D6T G;  3PJS K;  1W5C E;  1URQ B;  1SQB D;  2KLV A;  3EFF K;  1IFI A;  1P84 I;  2V4H A;  2UWJ E;  2YXR B;  3KQG A;  2A06 G;  1BE3 E;  1SQQ E;  1YJ9 P;  2JJL A;  3H32 B;  3LIE A;  3RL0 g;  4N3Y B;  1T8Z A;  3HD7 D;  3AE3 C;  2FYU G;  1S1C X;  3H1H D;  1MKM A;  3V5B A;  3CLQ A;  4HKZ H;  1E79 H;  3P8C E;  1NTK E;  3G4S P;  1JY2 N;  1KB9 E;  5CCG C;  3VP8 A;  3PH0 A;  4HB1 A;  1SQP D;  3L71 E;  1HWT C;  5CBN A;  3M9H A;  1KYO H;  1T6A A;  4NPF X;  3CL3 D;  1Y9B A;  1VQ4 P;  3H1H G;  2KZI A;  3MZW B;  1U57 A;  4OGQ B;  1JY2 P;  1PPJ G;  2J58 A;  1SQP G;  3CD6 P;  3H1L D;  2LKM A;  4H0L B;  1N73 C;  4JF7 A;  4ZNC A;  1A02 F;  4H44 B;  4EPU A;  1IFM A;  3VOP A;  3N4X A;  1RQU A;  5AVU B;  4QMA A;  1IO4 A;  1HTL C;  2E75 D;  1EDJ A;  1JY2 O;  2E5T A;  3BCC G;  1EZV D;  1FIB A;  4MN4 C;  1KV4 A;  3N7N A;  3R2P A;  1M1J C;  1FZB A;  2A45 G;  1RF0 A;  2YO3 A;  3I55 P;  4R9T A;  2M3B A;  1UII A;  1SQX K;  2RN0 A;  3B8E B;  3H1J J;  1AVO A;  3L75 J;  3HUS A;  1GU5 A;  1LTS C;  4O9B A;  2E5Y A;  1VF5 B;  1SQQ K;  5B5E H;  2WSS H;  4PD4 D;  3RL0 B;  1JMB A;  2E43 A;  3G3Z A;  5L8R J;  2E42 A;  2B88 A;  1SQV G;  1ZN5 A;  1GMJ A;  3HUS B;  1L0L G;  2Z4E A;  2AEM A;  2D2C B;  1ZR4 A;  1BCC E;  2P58 A;  3SWY A;  3WUT A;  3I56 P;  2KSJ A;  1NTK K;  5K5G B;  2ZAE B;  1FDO A;  5KKZ C;  1SQQ J;  3CCR P;  5KAI E;  5DJU B;  3GLM A;  2BCC J;  1FDM A;  1VQ6 P;  4NPD A;  3B5N C;  1K73 Q;  1NTZ E;  1M56 D;  1KC8 Q;  1NU1 K;  2A45 I;  3AE4 C;  1IFJ A;  2YIU B;  2R5D A;  2OYI B;  2KS1 A;  3CXH D;  3JSV C;  2IZ0 A;  2WWW A;  3H1I E;  3BAS A;  2KNC A;  3D70 A;  3K5B A;  3M0D A;  1LT9 A;  3O6Q A;  1Q86 Q;  2K1A A;  2XNX C;  2MKV A;  1RHZ B;  3D71 A;  1FZE C;  4JPZ B;  4ASW A;  1OX3 A;  1FZF B;  2KS1 B;  1MUU A;  2O1K A;  2LR2 A;  3H1K D;  1NU1 J;  2W6J H;  2ZT9 B;  5AW8 B;  3U1C A;  2KNC B;  1PIX A;  2GUS A;  1LT9 B;  3O6Q B;  3A5T A;  3A0B H;  2CK3 H;  3CCE P;  1A02 J;  1QVF O;  4YXD C;  3CCM P;  5KLV E;  3KDP B;  1JCD A;  4RO0 A;  3USS A;  1BSN A;  2HLO C;  1MZ9 A;  3CX5 D;  2B89 A;  4PJ0 E;  5GTI H;  1GD2 E;  1QVG O;  4XE5 B;  3HD7 A;  2KYV A;  4JYB A;  2W27 A;  2ZVO B;  4H13 C;  4AYC A;  1NTM E;  2Q9I A;  1FBM A;  1EXJ A;  1LTJ A;  1R5L A;  1RQV A;  3H1J G;  4C46 A;  3L73 G;  1SQX D;  2WNP F;  3HD7 B;  4NYT A;  3VMY A;  4JYC A;  2Q9I B;  1MV8 A;  1BGY E;  4WWI A;  3MP7 B;  1LTJ B;  3EQ2 A;  1BE3 D;  2WIT A;  3L70 J;  1KD1 Q;  2OAR A;  2KLU A;  1URQ C;  2GUV A;  1PP9 J;  1YQ3 C;  1PGJ A;  2QEX P;  3P32 A;  1N8R Q;  2QM7 A;  2ZXE B;  1KMI Z;  1VQ8 P;  3H32 C;  2KIK A;  1OW8 A;  3L72 E;  3P8C D;  1LP1 A;  1NTK D;  2H89 C;  2IBZ D;  3MHV A;  1KB9 D;  1SQQ G;  2SPZ A;  2BCC G;  2GA1 A;  3L71 D;  2QA4 P;  1KYO E;  4XA4 A;  4ZMD A;  1OXZ A;  1RF1 C;  1EZV E;  2OTL P;  5KLI B;  3FIB A;  2RH0 A;  3MIW A;  2CPS A;  1ZME C;  1QL2 A;  3SWF A;  1QGK B;  1LP1 B;  1N7S D;  1SS1 A;  1KQL A;  2E75 B;  1LNQ A;  3ABV C;  3KZI H;  1LTB C;  4HJG H;  1FOS E;  2O01 N;  3WU2 H;  4XFJ A;  1Q90 D;  4K3A A;  5KJ7 D;  2JR8 A;  3V2P A;  2QJP C;  4KJM A;  5GTH E;  4DOJ A;  1LGH B;  2E74 D;  5KLV K;  2KP8 A;  4OGQ C;  1JTH A;  3Q5S A;  2N1T D;  2ZXX A;  3RK3 C;  5TIS H;  2ZVN B;  3A2A A;  1NU1 G;  1KQF B;  2JP3 A;  1OW6 A;  1GK4 A;  1XTC C;  2E76 D;  3G6E P;  1NTM K;  3Q3D A;  2N9B A;  4H44 C;  1ZR2 A;  1JTH B;  2GM4 A;  1SQB J;  4GOF A;  3BAT A;  1P84 H;  4IL6 X;  5APV A;  3CCU P;  1M8O B;  3W67 A;  1YIT P;  3G9R A;  3VTP C;  4DCK A;  4DT0 A;  3CPW O;  2O1J A;  2R3S A;  2KXP B;  3CC7 P;  3TYY A;  5AW3 B;  3I5C A;  2HG5 D;  2YXQ B;  3H1H J;  4AUW A;  1HJ0 A;  2PP6 A;  2O01 J;  1YHQ P;  1SQP J;  3C1L A;  1VF5 C;  1BCC D;  5AW5 B;  2H8P D;  2D39 A;  1OWA A;  2C0W A;  3FGA D;  2Q6Q A;  3VP9 A;  4PV1 D;  4BXL A;  3RK2 C;  2J3U A;  2M0B A;  3HUS C;  2Z5H A;  2D2C C;  2J3O A;  1NTZ D;  1PP9 G;  3H1L J;  2P2U A;  1IK9 A;  3JCU E;  1BCC G;  3U59 A;  5AW2 B;  1J2J B;  5CBO A;  3P8M C;  2ZYA A;  1IC2 A;  1SFC D;  2QSI A;  3HE5 A;  3PHL A;  2QE7 H;  2WPV B;  1CI6 A;  2AXC A;  1VDF A;  1VQM P;  2YIU C;  1OVU A;  2OYI C;  1NWQ A;  2BEQ D;  1EXI A;  1FAV A;  3HTK A;  1OVR A;  2FYN B;  4LC1 A;  2FIB A;  1JUN A;  4RKU J;  2M3E A;  3HE5 B;  3H1I G;  3AEC C;  1T3J A;  2ZFC A;  1CI6 B;  1WRG A;  2YO2 A;  1KIL E;  2L91 A;  1FZF C;  4IL6 E;  1DD4 A;  2LXC B;  5KLV D;  3HTK B;  1LTG C;  3TF5 A;  2M5A A;  2LXB A;  3M0D C;  1LT9 C;  1W2B O;  2OYO A;  1MFZ A;  3E1I A;  1VPC A;  2JHM F;  2O01 H;  2J0Y A;  1NTM D;  2QIW A;  4KHX A;  4WY4 D;  1SQB G;  4W80 A;  3L74 E;  1CW5 A;  1J1D B;  2J1G A;  3CWB E;  2IBZ E;  1PZQ A;  1JB0 J;  5DJT B;  1U7M A;  1SP4 A;  2FXM A;  2V7Q J;  3EFG A;  4NPE A;  1Q7Y Q;  2QVA A;  1Z3U A;  1BGY D;  1W2E A;  1NYH A;  1N7S A;  3G71 P;  3V2Q A;  5AW0 B;  3FWL A;  2A45 H;  1OIP A;  3HD7 C;  3EWK A;  5AVQ B;  5KJ7 A;  4I1L A;  2G8Y A;  2Q9I C;  3PTZ A;  3MGN A;  1LTJ C;  1ZW0 A;  3FXD A;  1N7S B;  2N1T A;  2YKQ A;  3GF7 A;  3L72 D;  2I8D A;  2J5U A;  1Y8A A;  2JHH C;  2P1J A;  5E79 H;  3H1K J;  1KYO D;  1EQ7 A;  2I1J A;  3TGU E;  1YI2 P;  3H1L G;  2E74 B;  1AQ5 A;  1X0T A;  3BVH A;  2WPS A;  1OFC X;  3KZI E;  2N1T B;  3M06 A;  2NPS D;  3AE7 C;  5TJH A;  2O3J A;  2KI7 B;  2E76 B;  1K05 A;  4PD4 H;  2PAJ A;  2K37 A;  3L73 J;  1EZV G;  3BRV B;  3AE9 C;  2R32 A;  1AFO A;  3BVH B;  2E75 C;  1FZG A;  1FZB B;  1RF0 B;  4U3F D;  1NKZ B;  1IK7 A;  2H43 C;  1L0N E;  2FFD A;  2IYO A;  3E7K A;  3NMD A;  1L4A D;  1SQX J;  3MTU E;  2KUB A;  3CCS P;  2OGU A;  2WSF J;  4WB4 A;  1FZG B;  1P84 E;  3BRT B;  2WZ7 A;  3B5N D;  3NTN A;  4UB8 H;  1BE3 J;  3JC2 2;  5AVS B;  1AVY A;  1S3J A;  4DZO A;  1YTZ T;  1EDK A;  3CXH H;  4YXW H;  1AA0 A;  2J3G A;  1JMM A;  2Z4E B;  4R4M A;  1FZC A;  1KQS O;  1X79 B;  1PV3 A;  4R4L A;  5BVZ A;  3H6P A;  1G2C A;  2JO1 A;  1T2K C;  2WPQ A;  4PV1 B;  1SFC A;  3S4R A;  4BWN A;  1N86 A;  1NTK J;  4Y99 B;  3L71 J;  1FZC B;  3KXD A;  2FY8 A;  2WTY A;  1H8A A;  4EOT A;  3WUU A;  1SFC B;  1N86 B;  1GTW A;  1ZRT E;  1YYC A;  2HPC A;  2AXT H;  4BRY A;  3CX5 H;  2R44 A;  4B86 A;  4D6T E;  3AEF C;  4L74 A;  4Z1M H;  2IFM A;  1ZLL A;  2MJZ A;  5C39 A;  5H2F E;  2A06 E;  2XND H;  3GF3 A;  3B71 A;  1MFT A;  1EDI A;  4PD4 I;  2HPC B;  2KZJ A;  3H1K G;  1OZH A;  2FYZ A;  4IFM A;  2OTJ P;  1JY3 N;  3F89 A;  4BRY B;  5CCH D;  1GW3 A;  1TU3 F;  5AW6 B;  1HF9 A;  2R5B A;  4M3L A;  4I7Z B;  2NZ2 A;  1OW7 A;  4W7Z A;  4WY4 A;  2FYU E;  3V4Q A;  2P67 A;  5AW9 B;  3KPE A;  5AW4 B;  4N78 E;  1S4X A;  1L0N K;  1YJN P;  3L75 D;  1JY3 P;  3V6I A;  1KIL D;  4WY4 B;  1LJ2 A;  2FYN C;  3Q1M A;  5APY A;  1PGP A;  1PPJ E;  1J1E B;  3CXH I;  2Q5U A;  1NTZ K;  1NGM B;  3CMA P;  1KB9 H;  1SQX G;  1JY3 O;  1BCC J;  1M57 D;  3FWN A;  2WSC J;  3LID A;  3GW6 A;  2PFX A;  1M1J A;  3L74 D;  3CWB D;  1FZD A;  2WSE J;  1AJY A;  1FE6 A;  1BE3 G;  3BCC E;  3A3Y B;  1NHL A;  3AE5 C;  1ZXG A;  5CMZ A;  4YTP C;  1NTZ J;  1NAY A;  2NPS A;  3M0A A;  1M1J B;  3F5H A;  3V4W A;  3OAK A;  2J0G A;  3RBZ A;  1NTK G;  2IBZ G;  2JHI F;  1HGZ A;  3CX5 I;  3H1I J;  3RK3 D;  1FOS F;  3L71 G;  3HE4 A;  1QX8 A;  1CZQ A;  2DW3 A;  2W6B A;  2J0H A;  2NPS B;  1D7M A;  4GIF A;  3WMM 0;  4U3F E;  3NXS A;  1QL1 A;  1OVV A;  4H0L C;  2OYH A;  4OWF A;  3TGU D;  1L4A A;  1SQV E;  2Q3E A;  2J61 A;  1GZL A;  1L0L E;  3HE4 B;  1UIX A;  3TDK A;  3KHU A;  1N7S C;  2Q7C A;  3AE8 C;  2WMM A;  3M9B A;  3B5N A;  1YTZ I;  1Y47 A;  3Q5R A;  4GKG A;  5KLV J;  2OYH B;  1Q82 Q;  1JC9 A;  5KKZ B;  1L4A B;  2J61 B;  3KYQ A;  2N1T C;  4EYY Q;  5B5E E;  3B5N B;  1GW4 A;  1NTM J;  2WQY C;  2J59 M;  2E76 C;  1H88 A;  1FZE A;  1X22 A;  1KN7 A;  2WSE H;  2FBW C;  1L0N D;  2IBZ I;  1KB9 I;  3BVH C;  3AE6 C;  5KAI H;  1KOR A;  5AVZ B;  1FZB C;  3RK2 D;  2IYP A;  1RH5 B;  1RF0 C;  4WVZ A;  5KTB A;  1P84 D;  2Z5I A;  2JWA A;  5AVV B;  3RL0 C;  4KT0 J;  3P7K A;  4W7Y A;  1BGY J;  1KTM A;  1IJD B;  3H25 A;  2ZYD A;  1N7L A;  4GOE A;  4JBZ A;  3TNU A;  2JWD A;  1ZOY C;  1FZG C;  1GL2 D;  2YKO A;  4I6M C;  3SSU A;  5KAF H;  4AQR D;  3CCQ P;  3L72 J;  5APX A;  1VQP P;  5CCH A;  2Z4E C;  1HUC A;  3TNU B;  5AVY B;  1NTZ G;  1XTG B;  4PV1 C;  2XU6 A;  3OA7 A;  4ZKP A;  1DEE G;  2HOD A;  3ITK A;  1SQV K;  3IR9 A;  1ZRT D;  1L0L K;  3H1J E;  3A0B E;  5AVT B;  1FZC C;  4C7R A;  2YNY A;  3PRJ A;  3L75 E;  3C8V A;  3W68 A;  1KIL A;  4D6T D;  4PJ0 H;  2J3F D;  2P10 A;  3VMZ A;  1X9V A;  5B66 H;  1N86 C;  2A06 D;  3NFQ A;  2ZT9 C;  2HOD B;  5GTI E;  3GG2 A;  2OQQ A;  1EC5 A;  2VRS A;  3V2N A;  1QLE D;  5APQ A;  3CI9 A;  1U7J A;  1KIL B;  2WVR A;  1FJK A;  3FXE A;  1SLQ A;  5CCG D;  4YPC A;  2ZJS E;  2FYU D;  1RF1 A;  3MUD A;  1VL2 A;  1X8Y A;  4N78 D;  2HPC C;  1S5L H;  4WBA A;  2PGD A;  5KLV G;  2M5A B;  2J64 A;  2BCC E;  1N2D C;  4I7Z C;  1KFN A;  3A0H H;  5AW1 B;  2FXO A;  3II6 A;  3E1I B;  4L76 A;  1EDL A;  1DD3 A;  1RF1 B;  3M91 A;  1NTM G;  2POH A;  2W83 C;  3CME P;  2BEZ F;  2H88 C;  3QH9 A;  3SFE C;  2HYN A;  1PPJ D;  4OH8 B;  2OTK E;  3U1A A;  3VYI A;  3M9Q A;  3AEE C;  1VQ7 P;  4WY4 C;  1HVV A;  1H0T A;  2IFN A;  1NKN A;  3RK3 E;  1NAF A;  2FXP A;  3AED C;  3FX0 A;  2QJP B;  3IN6 A;  2YKP A;  1FID A;  1J1E C;  1BGY G;  2YMK A;  1NU1 E;  1HGV A;  3BCC D;  3RK3 B;  2RKL A;  1H0T B;  3D6Y A;  2WPR A;  4ASV A;  2IDB A;  2K9J A;  4ZFG A;  1K04 A;  5GTH H;  2KOG A;  3WU2 E;  1S72 P;  1S9K E;  3L72 G;  3R4Y A;  3VMX A;  1VQ9 P;  1IFD A;  1BSH A;  2C0X A;  5KLI C;  3S1K A;  4R9J A;  1RE3 A;  2K9J B;  2K3R A;  2QJK B;  1T3U A;  1RE4 A;  2JKV A;  3IF4 A;  5TIS E;  3AEB C;  1PFI A;  1QEX A;  1CSB A;  1SQV D;  1L0L D;  1IZN B;  2YMY A;  4N6J A;  2NPS C;  1RE3 B;  1USD A;  3D6Z A;  1ZP0 C;  1RE4 B;  2V7Q H;  4EIJ A;  1GDT A;  2QJY B;  2BAS A;  3E1R A;  1FZA A;  2B9B A;  3SFD C;  4U3F G; 
#chains in the Genus database with same CATH homology
 5CJ0 A;  3VTP C;  4N3Y B;  5APY A;  2O1J A;  1T8Z A;  1T2K D;  3HD7 D;  2FFD B;  3RK2 B;  1GL2 A;  3OJA B;  1J1E B;  1KFM A;  3GHG A;  3TYY A;  5AW3 B;  2Q5U A;  3I5C A;  2HG5 D;  1NTZ K;  4AUW A;  1GU4 A;  2PP6 A;  3V5B A;  3CLQ A;  1JY3 O;  3P8C E;  1Z56 A;  1LWU A;  1JY2 N;  2OYH C;  5CCG C;  3VP8 A;  1FZA B;  2XZR A;  2OYI A;  1NH4 A;  1L4A C;  1HWT C;  2H7H A;  3LID A;  1M1J A;  2H8P D;  5AW5 B;  2D39 A;  1OWA A;  2C0W A;  1FZD A;  1GL2 B;  3M9H A;  1H89 A;  3A3Y B;  3GHG B;  3CL3 D;  2Q3I A;  1NOH A;  5CHX A;  3VP9 A;  1NHL A;  3RK2 C;  2J3U A;  3HUS C;  2Z5H A;  5CMZ A;  1E5W A;  4HYT B;  4LGD E;  1LWU B;  1JOC A;  1JY2 P;  1G2C B;  1FZF A;  2J3O A;  2J58 A;  2NPS A;  4C7N A;  2P2U A;  2LKM A;  1IK9 A;  3M0A A;  1M1J B;  3V4W A;  3U59 A;  1NO4 A;  3OAK A;  1N73 C;  2J0G A;  4JF7 A;  5AW2 B;  1HBW A;  1J2J B;  2J3F A;  3P8M C;  2JHI F;  1A02 F;  1HGZ A;  1IC2 A;  1M7L A;  1SFC D;  4EPU A;  1IFM A;  3RK3 D;  1FOS F;  3VOP A;  3N4X A;  3HE4 A;  3HE5 A;  5AVU B;  2FKW B;  1CZQ A;  3C9I A;  1IO4 A;  1HTL C;  2W6B A;  2J0H A;  2NPS B;  1CI6 A;  4C7N B;  1JY2 O;  1VDF A;  1LTA C;  3L37 A;  4GIF A;  2OYI C;  1NWQ A;  1FIB A;  3WMM 0;  3N7N A;  3NXS A;  3R2P A;  3L4F A;  5AVR B;  1QL1 A;  2GY7 A;  1FAV A;  2OYH A;  1M1J C;  3HTK A;  5CCG A;  1FZB A;  4LC1 A;  2A45 G;  2FIB A;  1L4A A;  1RF0 A;  2J61 A;  1JUN A;  1GZL A;  2YO3 A;  1RY3 A;  4IFD K;  3HE4 B;  3HE5 B;  4R9T A;  1N7S C;  2Q7C A;  2M3B A;  3M9B A;  1SQX K;  1DH3 A;  1T3J A;  2ZFC A;  2WSF H;  1CI6 B;  3B5N A;  3B8E B;  1WRG A;  2YO2 A;  1YTZ I;  1FZF C;  3HUS A;  4GKG A;  4M7H A;  1WT6 A;  1GU5 A;  1LTS C;  2OYH B;  3HTK B;  1LTG C;  1FJP A;  4O9B A;  2J2P A;  1JC9 A;  1L4A B;  3M0D C;  2J61 B;  1LT9 C;  1LTT C;  1SQQ K;  4RES B;  3KYQ A;  2N1T C;  3RL0 B;  1MFZ A;  3E1I A;  1N73 A;  1VPC A;  5APT A;  2JHM F;  2O01 H;  5CCH C;  1URQ D;  2E43 A;  2J0Y A;  3B5N B;  1GW4 A;  3G3Z A;  2IX7 C;  2E42 A;  5APU A;  2J59 M;  2CPB A;  1ZN5 A;  4KHX A;  3HUS B;  1H88 A;  2Z4E A;  1FZE A;  4WY4 D;  1ZR4 A;  5APW A;  4W80 A;  2WSE H;  3SWY A;  1CW5 A;  1J1D B;  2KSJ A;  2J1G A;  1NTK K;  3BVH C;  1FU1 A;  2HOD C;  5AVZ B;  1FZB C;  2KB7 P;  3RK2 D;  1N73 B;  1RF0 C;  2XKM A;  5KTB A;  1HH0 A;  1SP4 A;  2Z5I A;  2FXM A;  3EFG A;  5AVV B;  3RL0 C;  1FDM A;  1KIL C;  3P7K A;  4W7Y A;  1Z3U A;  3B5N C;  1IJD B;  1W2E A;  1N7S A;  4GT1 A;  3V2Q A;  5AW0 B;  2A45 H;  1NU1 K;  2A45 I;  3HD7 C;  1N7L A;  3TNU A;  1IFJ A;  5BU5 A;  4JYO X;  5AVQ B;  2R5D A;  1FZG C;  5KJ7 A;  2OYI B;  1ZV8 A;  4HH2 A;  1DEB A;  1GL2 D;  4I1L A;  4IFF A;  1J1D C;  2YKO A;  4I6M C;  3UIA A;  2Q9I C;  3LW5 H;  2WWW A;  3BAS A;  3MGN A;  3E1I C;  3M0D A;  1LT9 A;  1LTJ C;  4AQR D;  1N7S B;  2N1T A;  2XNX C;  5APX A;  2YKQ A;  1HJB A;  2H43 A;  5CCH A;  2Z4E C;  1IFN A;  1JO5 A;  1FZE C;  1HUC A;  2J60 A;  3TNU B;  2W6A A;  2JHH C;  1FZF B;  1MUU A;  2P1J A;  2O1K A;  2C9L Y;  5AVY B;  1XTG B;  1EQ7 A;  2I1J A;  5AW8 B;  3U1C A;  5AVW B;  2IPP A;  1AQ5 A;  2XU6 A;  2GUS A;  1LT9 B;  3OA7 A;  4ZKP A;  3A5T A;  3BVH A;  2WPS A;  5AW7 B;  2HOD A;  2N1T B;  1A02 J;  1SQV K;  3M06 A;  3IR9 A;  4JZC A;  2NPS D;  1L0L K;  2H43 B;  2C9N Y;  5AVT B;  1FZC C;  4C7R A;  1SQB K;  2YNY A;  2FYU K;  2M8R A;  1KIL A;  3KDP B;  1JCD A;  2J3F D;  1G1I A;  2HLO C;  2PAJ A;  3A7O A;  1MZ9 A;  3O8Z A;  3VMZ A;  2L5G B;  5KJ7 C;  1X9V A;  3BRV B;  1GD2 E;  1S9K D;  2R32 A;  1LTI C;  1N86 C;  1AFO A;  3BVH B;  4XE5 B;  3HD7 A;  2KYV A;  3NFQ A;  4JYB A;  2HOD B;  2W27 A;  1GK6 A;  3HRN A;  1FZG A;  1FZB B;  2QM8 A;  2VRS A;  4AYC A;  1RF0 B;  3V2N A;  5APQ A;  2Q9I A;  3CI9 A;  1FBM A;  2JHL F;  1NKZ B;  3L36 A;  1G1J A;  5CJ4 A;  1KIL B;  2H43 C;  3IFM A;  1LTJ A;  2FFD A;  1FJK A;  1SLQ A;  5CCG D;  2XNX A;  3NMD A;  1RF1 A;  1L4A D;  3MUD A;  3MTU E;  1SQP K;  2I1K A;  2WSC H;  4C46 A;  2WNP F;  5BU8 B;  3HD7 B;  1X8Y A;  4N78 D;  2HPC C;  4WBA A;  3RL0 D;  4NYT A;  4WB4 A;  1FZG B;  3BRT B;  2JEE A;  2WZ7 A;  1JNM A;  2XDJ A;  3VMY A;  3B5N D;  2J64 A;  1N2D C;  3NTN A;  4JYC A;  2Q9I B;  1MV8 A;  1KFN A;  5AW1 B;  3II6 A;  3E1I B;  5AVS B;  1LTJ B;  3EQ2 A;  4DZO A;  1YTZ T;  4I2L C;  2XNX B;  2WIT A;  1RF1 B;  5AVX B;  2J3G A;  3M91 A;  1JMM A;  4ZKU A;  2Z4E B;  2OAR A;  3TK1 A;  2POH A;  1FZC A;  1FZE B;  2R3C A;  2XV5 A;  1URQ C;  1X79 B;  2GUV A;  5BVZ A;  1RE3 C;  2HYN A;  3H6P A;  1G2C A;  1T2K C;  4OH8 B;  2WPQ A;  2HLO A;  1SVF A;  3P32 A;  3VN0 A;  1RE4 C;  4LLH A;  1SFC A;  3U1A A;  3VYI A;  3M9Q A;  1DX7 A;  2QM7 A;  4WY4 C;  2ZXE B;  1N86 A;  3H32 C;  1HVV A;  2IFN A;  3P8C D;  1NKN A;  1NAF A;  2WT7 A;  4Y99 B;  4M7F A;  3MD0 A;  2FFD C;  2YKP A;  1FZC B;  2J5Z A;  4XA4 A;  1FID A;  1J1E C;  1OXZ A;  1RF1 C;  2WTY A;  1H8A A;  1HGV A;  2HLO B;  4EOT A;  1JCC A;  1SFC B;  3FIB A;  3RK3 B;  3MIW A;  2CPS A;  1N86 B;  2JHK F;  1FZA C;  1QL2 A;  1GTW A;  3SWF A;  1YYC A;  2HPC A;  1N7S D;  2WPR A;  3L35 A;  1KQL A;  2WT7 B;  1LTB C;  1FIC A;  1FOS E;  4ZFG A;  3TSI A;  4B86 A;  2KOG A;  1GL2 C;  3T97 A;  1Z3S A;  5KJ7 D;  4Y99 C;  3GHG C;  3V2R A;  3V2P A;  2IFM A;  1ZLL A;  2MJZ A;  1S9K E;  4DOJ A;  1LGH B;  3VMX A;  1IFD A;  3PP5 A;  5KLV K;  2C0X A;  2KP8 A;  1JTH A;  1LWU C;  2HPC B;  1SFC C;  2N1T D;  2FYZ A;  1URQ A;  3RK3 C;  4R9J A;  1RE3 A;  4IFM A;  3A2A A;  1JY3 N;  5CCH D;  1GW3 A;  5AW6 B;  2R5B A;  1T3U A;  1GK4 A;  4M3L A;  1RE4 A;  1XTC C;  1KZU B;  4W7Z A;  4WY4 A;  1PFI A;  1NTM K;  3H32 A;  3V4Q A;  2N9B A;  2P67 A;  2P7J A;  5AW9 B;  3KPE A;  5AW4 B;  2HFE D;  1CSB A;  4N78 E;  1ZR2 A;  1JTH B;  2GM4 A;  1L0N K;  5APS A;  2YMY A;  4N6J A;  2NPS C;  3BAT A;  1URQ B;  2KLV A;  1RE3 B;  1JY3 P;  1IFI A;  5APV A;  3KQG A;  1RE4 B;  4EIJ A;  1GDT A;  1KIL D;  4WY4 B;  2BAS A;  2JJL A;  3H32 B;  3LIE A;  1FZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...