1FZAC

Crystal structure of fibrinogen fragment d
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
309
structure length
309
Chain Sequence
KMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRINOGEN
publication title Crystal structures of fragment D from human fibrinogen and its crosslinked counterpart from fibrin.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 75
structure length 309
sequence length 309
chains with identical sequence F
ec nomenclature
pdb deposition date 1997-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1fzaC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1fzaC02
2JHIF 2HPCC 1LTJB 2J3GA 2FFDC 4M7HA 1N73C 2HPCB 3GHGC 1N86C 2OYIC 3HUSC 2Q9IB 2J3UA 1FZCC 1N73B 1FZGC 2JHLF 1FIBA 3FIBA 1LT9C 3HUSB 2JHMF 2OYHB 1FZBC 3BVHC 2GY7A 1FZFB 1FZGB 1LWUC 4EPUA 1RF1C 1LT9B 1FZBB 3BVHB 1FZAC 1LWUB 2HLOC 2J1GA 1RF1B 2J0GA 4NYTA 1RE4C 4R9JA 2J3FD 2HODC 4ZFGA 1RE4B 2J0YA 2HODB 2FFDB 2XNXC 1N86B 2D39A 2OYIB 1FIDA 1FZCB 2J60A 2J5ZA 2XNXB 4M7FA 1FZEC 4JZCA 2FIBA 2J61A 1FZEB 2H43C 3H32C 1FZAB 2HLOB 1Z3SA 1RF0C 3H32B 1M1JC 2J2PA 1M1JB 1FICA 2J64A 2JHKF 2J3FA 3E1IC 2J3OA 2J61B 2Q9IC 2JHHC 3E1IB 2H43B 4R9TA 2OYHC 1Z3UA 1RE3C 1FZFC 1FZDA 2J0HA 1RF0B 2Z4EC 1RE3B 2Z4EB 2WNPF 1JC9A 1LTJC 4JYOX
chains in the Genus database with same CATH superfamily
2JHIF 2HPCC 1LTJB 2J3GA 2FFDC 4M7HA 1N73C 2HPCB 3GHGC 1N86C 2OYIC 3HUSC 2Q9IB 2J3UA 1FZCC 1N73B 3GHGB 2JHLF 1FZGC 1FIBA 3FIBA 1LT9C 3HUSB 2JHMF 2OYHB 1FZBC 3BVHC 2GY7A 1FZFB 1FZGB 1LWUC 4EPUA 1RF1C 1LT9B 1FZBB 3BVHB 1FZAC 1LWUB 2HLOC 2J1GA 1RF1B 2J0GA 4NYTA 1RE4C 4R9JA 2J3FD 2HODC 4ZFGA 1RE4B 2J0YA 2HODB 2FFDB 2XNXC 1N86B 2D39A 2OYIB 1FIDA 1FZCB 2J60A 2J5ZA 2XNXB 4M7FA 1FZEC 4JZCA 2FIBA 2J61A 1FZEB 2H43C 3H32C 1FZAB 2HLOB 1Z3SA 1RF0C 3H32B 1M1JC 2J2PA 1M1JB 1FICA 2J64A 2JHKF 2J3FA 3E1IC 2J3OA 2J61B 2Q9IC 2JHHC 3E1IB 2H43B 4R9TA 2OYHC 1Z3UA 1RE3C 1FZFC 1FZDA 2J0HA 1RF0B 2Z4EC 1RE3B 2Z4EB 2WNPF 1JC9A 1LTJC 4JYOX
chains in the Genus database with same CATH topology
2JHIF 2HPCC 1LTJB 2J3GA 2FFDC 4M7HA 1N73C 2HPCB 3GHGC 1N86C 2OYIC 3HUSC 2Q9IB 2J3UA 1FZCC 1N73B 1FZGC 2JHLF 1FIBA 3FIBA 1LT9C 3HUSB 2JHMF 2OYHB 1FZBC 3BVHC 2GY7A 1FZFB 1FZGB 1LWUC 4EPUA 1RF1C 1LT9B 1FZBB 3BVHB 1FZAC 1LWUB 2HLOC 2J1GA 1RF1B 2J0GA 4NYTA 1RE4C 4R9JA 2J3FD 2HODC 4ZFGA 1RE4B 2J0YA 2HODB 2FFDB 2XNXC 1N86B 2D39A 2OYIB 1FIDA 1FZCB 2J60A 2J5ZA 2XNXB 4M7FA 1FZEC 4JZCA 2FIBA 2J61A 1FZEB 2H43C 3H32C 1FZAB 2HLOB 1Z3SA 1RF0C 3H32B 1M1JC 2J2PA 1M1JB 1FICA 2J64A 2JHKF 2J3FA 3E1IC 2J3OA 2J61B 2Q9IC 2JHHC 3E1IB 2H43B 4R9TA 2OYHC 1Z3UA 1RE3C 1FZFC 1FZDA 2J0HA 1RF0B 2Z4EC 1RE3B 2Z4EB 2WNPF 1JC9A 1LTJC 4JYOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHI F;  2HPC C;  1LTJ B;  2J3G A;  2FFD C;  4M7H A;  1N73 C;  2HPC B;  3GHG C;  1N86 C;  2OYI C;  3HUS C;  2Q9I B;  2J3U A;  1FZC C;  1N73 B;  1FZG C;  2JHL F;  1FIB A;  3FIB A;  1LT9 C;  3HUS B;  2JHM F;  2OYH B;  1FZB C;  3BVH C;  2GY7 A;  1FZF B;  1FZG B;  1LWU C;  4EPU A;  1RF1 C;  1LT9 B;  1FZB B;  3BVH B;  1FZA C;  1LWU B;  2HLO C;  2J1G A;  1RF1 B;  2J0G A;  4NYT A;  1RE4 C;  4R9J A;  2J3F D;  2HOD C;  4ZFG A;  1RE4 B;  2J0Y A;  2HOD B;  2FFD B;  2XNX C;  1N86 B;  2D39 A;  2OYI B;  1FID A;  1FZC B;  2J60 A;  2J5Z A;  2XNX B;  4M7F A;  1FZE C;  4JZC A;  2FIB A;  2J61 A;  1FZE B;  2H43 C;  3H32 C;  1FZA B;  2HLO B;  1Z3S A;  1RF0 C;  3H32 B;  1M1J C;  2J2P A;  1M1J B;  1FIC A;  2J64 A;  2JHK F;  2J3F A;  3E1I C;  2J3O A;  2J61 B;  2Q9I C;  2JHH C;  3E1I B;  2H43 B;  4R9T A;  2OYH C;  1Z3U A;  1RE3 C;  1FZF C;  1FZD A;  2J0H A;  1RF0 B;  2Z4E C;  1RE3 B;  2Z4E B;  2WNP F;  1JC9 A;  1LTJ C;  4JYO X; 
#chains in the Genus database with same CATH topology
 2JHI F;  2HPC C;  1LTJ B;  2J3G A;  2FFD C;  4M7H A;  1N73 C;  2HPC B;  3GHG C;  1N86 C;  2OYI C;  3HUS C;  2Q9I B;  2J3U A;  1FZC C;  1N73 B;  3GHG B;  2JHL F;  1FZG C;  1FIB A;  3FIB A;  1LT9 C;  3HUS B;  2JHM F;  2OYH B;  1FZB C;  3BVH C;  2GY7 A;  1FZF B;  1FZG B;  1LWU C;  4EPU A;  1RF1 C;  1LT9 B;  1FZB B;  3BVH B;  1FZA C;  1LWU B;  2HLO C;  2J1G A;  1RF1 B;  2J0G A;  4NYT A;  1RE4 C;  4R9J A;  2J3F D;  2HOD C;  4ZFG A;  1RE4 B;  2J0Y A;  2HOD B;  2FFD B;  2XNX C;  1N86 B;  2D39 A;  2OYI B;  1FID A;  1FZC B;  2J60 A;  2J5Z A;  2XNX B;  4M7F A;  1FZE C;  4JZC A;  2FIB A;  2J61 A;  1FZE B;  2H43 C;  3H32 C;  1FZA B;  2HLO B;  1Z3S A;  1RF0 C;  3H32 B;  1M1J C;  2J2P A;  1M1J B;  1FIC A;  2J64 A;  2JHK F;  2J3F A;  3E1I C;  2J3O A;  2J61 B;  2Q9I C;  2JHH C;  3E1I B;  2H43 B;  4R9T A;  2OYH C;  1Z3U A;  1RE3 C;  1FZF C;  1FZD A;  2J0H A;  1RF0 B;  2Z4E C;  1RE3 B;  2Z4E B;  2WNP F;  1JC9 A;  1LTJ C;  4JYO X; 
#chains in the Genus database with same CATH homology
 2JHI F;  2HPC C;  1LTJ B;  2J3G A;  2FFD C;  4M7H A;  1N73 C;  2HPC B;  3GHG C;  1N86 C;  2OYI C;  3HUS C;  2Q9I B;  2J3U A;  1FZC C;  1N73 B;  1FZG C;  2JHL F;  1FIB A;  3FIB A;  1LT9 C;  3HUS B;  2JHM F;  2OYH B;  1FZB C;  3BVH C;  2GY7 A;  1FZF B;  1FZG B;  1LWU C;  4EPU A;  1RF1 C;  1LT9 B;  1FZB B;  3BVH B;  1FZA C;  1LWU B;  2HLO C;  2J1G A;  1RF1 B;  2J0G A;  4NYT A;  1RE4 C;  4R9J A;  2J3F D;  2HOD C;  4ZFG A;  1RE4 B;  2J0Y A;  2HOD B;  2FFD B;  2XNX C;  1N86 B;  2D39 A;  2OYI B;  1FID A;  1FZC B;  2J60 A;  2J5Z A;  2XNX B;  4M7F A;  1FZE C;  4JZC A;  2FIB A;  2J61 A;  1FZE B;  2H43 C;  3H32 C;  1FZA B;  2HLO B;  1Z3S A;  1RF0 C;  3H32 B;  1M1J C;  2J2P A;  1M1J B;  1FIC A;  2J64 A;  2JHK F;  2J3F A;  3E1I C;  2J3O A;  2J61 B;  2Q9I C;  2JHH C;  3E1I B;  2H43 B;  4R9T A;  2OYH C;  1Z3U A;  1RE3 C;  1FZF C;  1FZD A;  2J0H A;  1RF0 B;  2Z4E C;  1RE3 B;  2Z4E B;  2WNP F;  1JC9 A;  1LTJ C;  4JYO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...