2J3OA

L-ficolin complexed to n-acetyl-d-glucosamine
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
217
Chain Sequence
PCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j3oA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j3oA02
1FIDA 2JHHC 2H43B 2HLOB 1LWUC 4EPUA 2J60A 1LWUB 2J5ZA 2J1GA 4JYOX 2J0GA 4R9JA 2FIBA 4R9TA 1FZEC 3E1IC 1FZAC 3GHGC 1FZEB 3E1IB 2J3UA 1RF1C 2J61A 2XNXC 1N73C 3HUSC 1RF1B 2OYHC 2OYIC 2XNXB 1N73B 2J0HA 3HUSB 3BVHC 2HODC 2OYHB 2OYIB 2JHIF 1N86C 3BVHB 1FIBA 1N86B 2J3FA 2J3GA 3H32C 2FFDC 3FIBA 3H32B 1FZAB 2FFDB 2Z4EC 2Q9IC 4JZCA 2J64A 2JHKF 2Z4EB 2Q9IB 2J3FD 1LTJC 4ZFGA 2HODB 2D39A 1Z3UA 1FZCC 1FZDA 1Z3SA 1LTJB 1RF0C 1FZCB 1FZFC 1FZBC 2J3OA 2HLOC 4M7HA 1RF0B 2WNPF 1FZFB 1FZBB 2J0YA 4NYTA 1M1JC 1JC9A 2HPCC 2J2PA 1M1JB 1FZGC 2HPCB 2JHMF 1FZGB 4M7FA 1LT9C 1RE3C 1RE4C 1FICA 1LT9B 2J61B 1RE4B 1RE3B 2JHLF 2GY7A 2H43C
chains in the Genus database with same CATH superfamily
1FIDA 2JHHC 2H43B 2HLOB 1LWUC 4EPUA 2J60A 1LWUB 2J5ZA 2J1GA 4JYOX 2J0GA 4R9JA 2FIBA 4R9TA 1FZEC 3E1IC 1FZAC 3GHGC 1FZEB 3E1IB 2J3UA 1RF1C 2J61A 3GHGB 2XNXC 1N73C 3HUSC 1RF1B 2OYHC 2OYIC 2XNXB 1N73B 2J0HA 3HUSB 3BVHC 2HODC 2OYHB 2OYIB 2JHIF 1N86C 3BVHB 1FIBA 1N86B 2J3FA 2J3GA 3H32C 2FFDC 3FIBA 3H32B 1FZAB 2FFDB 2Z4EC 2Q9IC 4JZCA 2J64A 2JHKF 2Z4EB 2Q9IB 2J3FD 1LTJC 4ZFGA 2HODB 2D39A 1Z3UA 1FZCC 1FZDA 1Z3SA 1LTJB 1RF0C 1FZCB 1FZFC 1FZBC 2J3OA 2HLOC 4M7HA 1RF0B 2WNPF 1FZFB 1FZBB 2J0YA 4NYTA 1M1JC 1JC9A 2HPCC 2J2PA 1M1JB 1FZGC 2HPCB 2JHMF 1FZGB 4M7FA 1LT9C 1RE3C 1RE4C 1FICA 1LT9B 2J61B 1RE4B 1RE3B 2JHLF 2GY7A 2H43C
chains in the Genus database with same CATH topology
1FIDA 2JHHC 2H43B 2HLOB 1LWUC 4EPUA 2J60A 1LWUB 2J5ZA 2J1GA 4JYOX 2J0GA 4R9JA 2FIBA 4R9TA 1FZEC 3E1IC 1FZAC 3GHGC 1FZEB 3E1IB 2J3UA 1RF1C 2J61A 2XNXC 1N73C 3HUSC 1RF1B 2OYHC 2OYIC 2XNXB 1N73B 2J0HA 3HUSB 3BVHC 2HODC 2OYHB 2OYIB 2JHIF 1N86C 3BVHB 1FIBA 1N86B 2J3FA 2J3GA 3H32C 2FFDC 3FIBA 3H32B 1FZAB 2FFDB 2Z4EC 2Q9IC 4JZCA 2J64A 2JHKF 2Z4EB 2Q9IB 2J3FD 1LTJC 4ZFGA 2HODB 2D39A 1Z3UA 1FZCC 1FZDA 1Z3SA 1LTJB 1RF0C 1FZCB 1FZFC 1FZBC 2J3OA 2HLOC 4M7HA 1RF0B 2WNPF 1FZFB 1FZBB 2J0YA 4NYTA 1M1JC 1JC9A 2HPCC 2J2PA 1M1JB 1FZGC 2HPCB 2JHMF 1FZGB 4M7FA 1LT9C 1RE3C 1RE4C 1FICA 1LT9B 2J61B 1RE4B 1RE3B 2JHLF 2GY7A 2H43C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FID A;  2JHH C;  2H43 B;  2HLO B;  1LWU C;  4EPU A;  2J60 A;  1LWU B;  2J5Z A;  2J1G A;  4JYO X;  2J0G A;  4R9J A;  2FIB A;  4R9T A;  1FZE C;  3E1I C;  1FZA C;  3GHG C;  1FZE B;  3E1I B;  2J3U A;  1RF1 C;  2J61 A;  2XNX C;  1N73 C;  3HUS C;  1RF1 B;  2OYH C;  2OYI C;  2XNX B;  1N73 B;  2J0H A;  3HUS B;  3BVH C;  2HOD C;  2OYH B;  2OYI B;  2JHI F;  1N86 C;  3BVH B;  1FIB A;  1N86 B;  2J3F A;  2J3G A;  3H32 C;  2FFD C;  3FIB A;  3H32 B;  1FZA B;  2FFD B;  2Z4E C;  2Q9I C;  4JZC A;  2J64 A;  2JHK F;  2Z4E B;  2Q9I B;  2J3F D;  1LTJ C;  4ZFG A;  2HOD B;  2D39 A;  1Z3U A;  1FZC C;  1FZD A;  1Z3S A;  1LTJ B;  1RF0 C;  1FZC B;  1FZF C;  1FZB C;  2J3O A;  2HLO C;  4M7H A;  1RF0 B;  2WNP F;  1FZF B;  1FZB B;  2J0Y A;  4NYT A;  1M1J C;  1JC9 A;  2HPC C;  2J2P A;  1M1J B;  1FZG C;  2HPC B;  2JHM F;  1FZG B;  4M7F A;  1LT9 C;  1RE3 C;  1RE4 C;  1FIC A;  1LT9 B;  2J61 B;  1RE4 B;  1RE3 B;  2JHL F;  2GY7 A;  2H43 C; 
#chains in the Genus database with same CATH topology
 1FID A;  2JHH C;  2H43 B;  2HLO B;  1LWU C;  4EPU A;  2J60 A;  1LWU B;  2J5Z A;  2J1G A;  4JYO X;  2J0G A;  4R9J A;  2FIB A;  4R9T A;  1FZE C;  3E1I C;  1FZA C;  3GHG C;  1FZE B;  3E1I B;  2J3U A;  1RF1 C;  2J61 A;  3GHG B;  2XNX C;  1N73 C;  3HUS C;  1RF1 B;  2OYH C;  2OYI C;  2XNX B;  1N73 B;  2J0H A;  3HUS B;  3BVH C;  2HOD C;  2OYH B;  2OYI B;  2JHI F;  1N86 C;  3BVH B;  1FIB A;  1N86 B;  2J3F A;  2J3G A;  3H32 C;  2FFD C;  3FIB A;  3H32 B;  1FZA B;  2FFD B;  2Z4E C;  2Q9I C;  4JZC A;  2J64 A;  2JHK F;  2Z4E B;  2Q9I B;  2J3F D;  1LTJ C;  4ZFG A;  2HOD B;  2D39 A;  1Z3U A;  1FZC C;  1FZD A;  1Z3S A;  1LTJ B;  1RF0 C;  1FZC B;  1FZF C;  1FZB C;  2J3O A;  2HLO C;  4M7H A;  1RF0 B;  2WNP F;  1FZF B;  1FZB B;  2J0Y A;  4NYT A;  1M1J C;  1JC9 A;  2HPC C;  2J2P A;  1M1J B;  1FZG C;  2HPC B;  2JHM F;  1FZG B;  4M7F A;  1LT9 C;  1RE3 C;  1RE4 C;  1FIC A;  1LT9 B;  2J61 B;  1RE4 B;  1RE3 B;  2JHL F;  2GY7 A;  2H43 C; 
#chains in the Genus database with same CATH homology
 1FID A;  2JHH C;  2H43 B;  2HLO B;  1LWU C;  4EPU A;  2J60 A;  1LWU B;  2J5Z A;  2J1G A;  4JYO X;  2J0G A;  4R9J A;  2FIB A;  4R9T A;  1FZE C;  3E1I C;  1FZA C;  3GHG C;  1FZE B;  3E1I B;  2J3U A;  1RF1 C;  2J61 A;  2XNX C;  1N73 C;  3HUS C;  1RF1 B;  2OYH C;  2OYI C;  2XNX B;  1N73 B;  2J0H A;  3HUS B;  3BVH C;  2HOD C;  2OYH B;  2OYI B;  2JHI F;  1N86 C;  3BVH B;  1FIB A;  1N86 B;  2J3F A;  2J3G A;  3H32 C;  2FFD C;  3FIB A;  3H32 B;  1FZA B;  2FFD B;  2Z4E C;  2Q9I C;  4JZC A;  2J64 A;  2JHK F;  2Z4E B;  2Q9I B;  2J3F D;  1LTJ C;  4ZFG A;  2HOD B;  2D39 A;  1Z3U A;  1FZC C;  1FZD A;  1Z3S A;  1LTJ B;  1RF0 C;  1FZC B;  1FZF C;  1FZB C;  2J3O A;  2HLO C;  4M7H A;  1RF0 B;  2WNP F;  1FZF B;  1FZB B;  2J0Y A;  4NYT A;  1M1J C;  1JC9 A;  2HPC C;  2J2P A;  1M1J B;  1FZG C;  2HPC B;  2JHM F;  1FZG B;  4M7F A;  1LT9 C;  1RE3 C;  1RE4 C;  1FIC A;  1LT9 B;  2J61 B;  1RE4 B;  1RE3 B;  2JHL F;  2GY7 A;  2H43 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...