2J3OA

L-ficolin complexed to n-acetyl-d-glucosamine
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
217
Chain Sequence
PCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 64
structure length 217
sequence length 217
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j3oA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j3oA02
2HODC 1FZAC 2HLOC 1FICA 3E1IB 2GY7A 2Z4EC 2J3OA 2OYHB 2Q9IB 2J61B 4R9TA 1M1JC 3HUSB 2HPCC 2J3UA 2J64A 1FZGB 1FZEB 4JZCA 3E1IC 2J3FA 2OYHC 4M7HA 2Q9IC 3HUSC 3BVHC 2JHKF 4JYOX 2H43C 2FFDB 3FIBA 1RE3C 1RF1C 3H32B 2JHLF 1RE4B 1LWUB 1FZCB 1N73B 1LT9B 2FIBA 2FFDC 1FZDA 4EPUA 2J0HA 2OYIB 1RF0B 1RF1B 2WNPF 2J61A 2J3GA 1FZAB 1FZGC 1FZEC 2J1GA 1Z3UA 2JHHC 1FZFB 2J3FD 1RE4C 1LWUC 2J0GA 1FZBB 3GHGC 1FIDA 1N86B 2HPCB 1RF0C 2J2PA 2D39A 1LTJB 2J0YA 2XNXB 1FZFC 1JC9A 2HODB 2J60A 2HLOB 4ZFGA 1FIBA 3BVHB 1FZBC 1N86C 3H32C 2Z4EB 2H43B 1FZCC 4M7FA 2J5ZA 1M1JB 1Z3SA 1RE3B 2JHMF 2JHIF 1N73C 1LTJC 1LT9C 2OYIC 2XNXC 4NYTA 4R9JA
chains in the Genus database with same CATH superfamily
2HODC 1FZAC 2HLOC 1FICA 3E1IB 2GY7A 2Z4EC 2J3OA 2OYHB 2Q9IB 2J61B 4R9TA 1M1JC 3HUSB 2HPCC 2J3UA 2J64A 1FZGB 1FZEB 4JZCA 3E1IC 2J3FA 3GHGB 2OYHC 4M7HA 2Q9IC 3HUSC 3BVHC 2JHKF 4JYOX 2H43C 2FFDB 3FIBA 1RE3C 1RF1C 3H32B 2JHLF 1RE4B 1LWUB 1FZCB 1N73B 1LT9B 2FIBA 2FFDC 1FZDA 4EPUA 2J0HA 2OYIB 1RF0B 1RF1B 2WNPF 2J61A 2J3GA 1FZAB 1FZGC 1FZEC 2J1GA 1Z3UA 2JHHC 1FZFB 2J3FD 1RE4C 1LWUC 2J0GA 1FZBB 3GHGC 1FIDA 1N86B 2HPCB 1RF0C 2J2PA 2D39A 1LTJB 2J0YA 2XNXB 1FZFC 1JC9A 2HODB 2J60A 2HLOB 4ZFGA 1FIBA 3BVHB 1FZBC 1N86C 3H32C 2Z4EB 2H43B 1FZCC 4M7FA 2J5ZA 1M1JB 1Z3SA 1RE3B 2JHMF 2JHIF 1N73C 1LTJC 1LT9C 2OYIC 2XNXC 4NYTA 4R9JA
chains in the Genus database with same CATH topology
2HODC 1FZAC 2HLOC 1FICA 3E1IB 2GY7A 2Z4EC 2J3OA 2OYHB 2Q9IB 2J61B 4R9TA 1M1JC 3HUSB 2HPCC 2J3UA 2J64A 1FZGB 1FZEB 4JZCA 3E1IC 2J3FA 2OYHC 4M7HA 2Q9IC 3HUSC 3BVHC 2JHKF 4JYOX 2H43C 2FFDB 3FIBA 1RE3C 1RF1C 3H32B 2JHLF 1RE4B 1LWUB 1FZCB 1N73B 1LT9B 2FIBA 2FFDC 1FZDA 4EPUA 2J0HA 2OYIB 1RF0B 1RF1B 2WNPF 2J61A 2J3GA 1FZAB 1FZGC 1FZEC 2J1GA 1Z3UA 2JHHC 1FZFB 2J3FD 1RE4C 1LWUC 2J0GA 1FZBB 3GHGC 1FIDA 1N86B 2HPCB 1RF0C 2J2PA 2D39A 1LTJB 2J0YA 2XNXB 1FZFC 1JC9A 2HODB 2J60A 2HLOB 4ZFGA 1FIBA 3BVHB 1FZBC 1N86C 3H32C 2Z4EB 2H43B 1FZCC 4M7FA 2J5ZA 1M1JB 1Z3SA 1RE3B 2JHMF 2JHIF 1N73C 1LTJC 1LT9C 2OYIC 2XNXC 4NYTA 4R9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOD C;  1FZA C;  2HLO C;  1FIC A;  3E1I B;  2GY7 A;  2Z4E C;  2J3O A;  2OYH B;  2Q9I B;  2J61 B;  4R9T A;  1M1J C;  3HUS B;  2HPC C;  2J3U A;  2J64 A;  1FZG B;  1FZE B;  4JZC A;  3E1I C;  2J3F A;  2OYH C;  4M7H A;  2Q9I C;  3HUS C;  3BVH C;  2JHK F;  4JYO X;  2H43 C;  2FFD B;  3FIB A;  1RE3 C;  1RF1 C;  3H32 B;  2JHL F;  1RE4 B;  1LWU B;  1FZC B;  1N73 B;  1LT9 B;  2FIB A;  2FFD C;  1FZD A;  4EPU A;  2J0H A;  2OYI B;  1RF0 B;  1RF1 B;  2WNP F;  2J61 A;  2J3G A;  1FZA B;  1FZG C;  1FZE C;  2J1G A;  1Z3U A;  2JHH C;  1FZF B;  2J3F D;  1RE4 C;  1LWU C;  2J0G A;  1FZB B;  3GHG C;  1FID A;  1N86 B;  2HPC B;  1RF0 C;  2J2P A;  2D39 A;  1LTJ B;  2J0Y A;  2XNX B;  1FZF C;  1JC9 A;  2HOD B;  2J60 A;  2HLO B;  4ZFG A;  1FIB A;  3BVH B;  1FZB C;  1N86 C;  3H32 C;  2Z4E B;  2H43 B;  1FZC C;  4M7F A;  2J5Z A;  1M1J B;  1Z3S A;  1RE3 B;  2JHM F;  2JHI F;  1N73 C;  1LTJ C;  1LT9 C;  2OYI C;  2XNX C;  4NYT A;  4R9J A; 
#chains in the Genus database with same CATH topology
 2HOD C;  1FZA C;  2HLO C;  1FIC A;  3E1I B;  2GY7 A;  2Z4E C;  2J3O A;  2OYH B;  2Q9I B;  2J61 B;  4R9T A;  1M1J C;  3HUS B;  2HPC C;  2J3U A;  2J64 A;  1FZG B;  1FZE B;  4JZC A;  3E1I C;  2J3F A;  3GHG B;  2OYH C;  4M7H A;  2Q9I C;  3HUS C;  3BVH C;  2JHK F;  4JYO X;  2H43 C;  2FFD B;  3FIB A;  1RE3 C;  1RF1 C;  3H32 B;  2JHL F;  1RE4 B;  1LWU B;  1FZC B;  1N73 B;  1LT9 B;  2FIB A;  2FFD C;  1FZD A;  4EPU A;  2J0H A;  2OYI B;  1RF0 B;  1RF1 B;  2WNP F;  2J61 A;  2J3G A;  1FZA B;  1FZG C;  1FZE C;  2J1G A;  1Z3U A;  2JHH C;  1FZF B;  2J3F D;  1RE4 C;  1LWU C;  2J0G A;  1FZB B;  3GHG C;  1FID A;  1N86 B;  2HPC B;  1RF0 C;  2J2P A;  2D39 A;  1LTJ B;  2J0Y A;  2XNX B;  1FZF C;  1JC9 A;  2HOD B;  2J60 A;  2HLO B;  4ZFG A;  1FIB A;  3BVH B;  1FZB C;  1N86 C;  3H32 C;  2Z4E B;  2H43 B;  1FZC C;  4M7F A;  2J5Z A;  1M1J B;  1Z3S A;  1RE3 B;  2JHM F;  2JHI F;  1N73 C;  1LTJ C;  1LT9 C;  2OYI C;  2XNX C;  4NYT A;  4R9J A; 
#chains in the Genus database with same CATH homology
 2HOD C;  1FZA C;  2HLO C;  1FIC A;  3E1I B;  2GY7 A;  2Z4E C;  2J3O A;  2OYH B;  2Q9I B;  2J61 B;  4R9T A;  1M1J C;  3HUS B;  2HPC C;  2J3U A;  2J64 A;  1FZG B;  1FZE B;  4JZC A;  3E1I C;  2J3F A;  2OYH C;  4M7H A;  2Q9I C;  3HUS C;  3BVH C;  2JHK F;  4JYO X;  2H43 C;  2FFD B;  3FIB A;  1RE3 C;  1RF1 C;  3H32 B;  2JHL F;  1RE4 B;  1LWU B;  1FZC B;  1N73 B;  1LT9 B;  2FIB A;  2FFD C;  1FZD A;  4EPU A;  2J0H A;  2OYI B;  1RF0 B;  1RF1 B;  2WNP F;  2J61 A;  2J3G A;  1FZA B;  1FZG C;  1FZE C;  2J1G A;  1Z3U A;  2JHH C;  1FZF B;  2J3F D;  1RE4 C;  1LWU C;  2J0G A;  1FZB B;  3GHG C;  1FID A;  1N86 B;  2HPC B;  1RF0 C;  2J2P A;  2D39 A;  1LTJ B;  2J0Y A;  2XNX B;  1FZF C;  1JC9 A;  2HOD B;  2J60 A;  2HLO B;  4ZFG A;  1FIB A;  3BVH B;  1FZB C;  1N86 C;  3H32 C;  2Z4E B;  2H43 B;  1FZC C;  4M7F A;  2J5Z A;  1M1J B;  1Z3S A;  1RE3 B;  2JHM F;  2JHI F;  1N73 C;  1LTJ C;  1LT9 C;  2OYI C;  2XNX C;  4NYT A;  4R9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...