1LTJC

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 88
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ltjC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ltjC02
1FZBA 2XNXA 4JZCA 2J3GA 1T3UA 1Z3SA 1FICA 2HLOB 2JHLF 4M7FA 4JYOX 2Z4EC 1FZGC 2HLOA 2HPCB 1FZCB 4EPUA 1FZEC 2HPCA 2HODB 3H32A 1N86B 1RF0C 1FZCA 1JY3P 1FIDA 1N86A 2HODA 1RE3B 2J2PA 1M1JB 2J0YA 2J3FD 3E1IC 1RE3A 1RE4A 2FIBA 2A45I 1M1JA 3BVHB 1LT9B 1LWUB 3HUSC 2FFDA 1JY3N 3BVHA 1LT9A 1JC9A 4ZFGA 1FZFB 1LTJC 1FZFA 3FIBA 2J5ZA 1FZDA 1JY2O 2J1GA 2Q9IC 2J3UA 1FZBC 2Z4EB 1FZGB 2H43C 1W2EA 2GY7A 3GHGC 2Z4EA 1FZGA 1FZEB 1RF1C 1RF0B 2J0HA 1FZEA 2D39A 2J61B 1N73C 4M7HA 3E1IB 2J61A 1FZAC 2JHIF 3H32C 1LWUA 2J64A 2HODC 3HUSB 2JHKF 1RE4C 1M1JC 2A45H 1LTJB 2OYIC 2FFDC 1LTJA 1Z3UA 2OYHC 1JY3O 2J0GA 1JY2N 2XNXC 2Q9IB 2WNPF 1FIBA 2Q9IA 1FZBB 2JHMF 2H43B 2HLOC 1RF0A 3GHGB 2JHHC 1RF1B 2H43A 2J3OA 2HPCC 3GHGA 1FZCC 3E1IA 1RF1A 2J3FA 1N86C 4R9TA 1N73B 2A45G 1JY2P 1FZAB 1RE3C 3H32B 1N73A 2J60A 3HUSA 1FZAA 4NYTA 1RE4B 3BVHC 1LT9C 1LWUC 2OYIB 2FFDB 1FZFC 2OYHB 2OYIA 4R9JA 2XNXB 2OYHA
chains in the Genus database with same CATH superfamily
1SQVJ 3H6PA 1VQ8P 1U7JA 3CWBD 2KB7P 4M7FA 2QJPB 1FC2C 1P84E 3E1RA 3I56P 2YNYA 4PD4D 2ZT9D 2QJKB 4N6JA 1OVUA 3TDKA 5AW6B 3CCEP 1KQFB 3TGUJ 2FFDA 1QGKB 3H1JG 1IK7A 2IBZI 3OA7A 1JTHA 3L75D 2XDJA 1JY2O 1PGJA 2WSEH 2D2CB 3FXDA 3S4RA 3EFGA 1RF1C 3L70E 2WPVB 1R8EA 3QH9A 3LW5J 1LP1B 3L36A 3A7OA 1HTLC 1LP1A 1SS1A 1SQQD 4A7PA 2O1KA 3NXSA 1SQBE 1M1JC 2WVRA 4HH2A 3L70G 4DOJA 1FJPA 2WWWA 1L0NE 2RN0A 1SQBG 2HPCC 4EI2A 3U1AA 3QWOC 1LTTC 4I2LC 4H0LD 1Z56A 2OYHB 1SQXD 2H8PD 5KLIC 4DJGA 2OYHA 3B5ND 1XTCC 4YTPC 1ZV8A 2CPBA 4JYOX 1KILB 2A06E 3RL0C 3L74G 2PAJA 4D6TE 1KILA 1L4AB 1NU1J 3GMAA 1L4AA 2KNCB 1MFTA 3MTUE 5AW5B 3H1KE 1WMKA 2KNCA 3VMYA 2LKMA 1SQVD 3CCUP 1YJNP 4R4LA 5CJ4A 3P7KA 1FS0E 2Y9ZA 5K5GB 1KD1Q 2FY8A 3S1KA 2WPSA 3L71J 2JHIF 2FBWC 3CWBE 3D6YA 1GDTA 3FGAD 1HGZA 1RE4C 4PD4H 2KYVA 1IFPA 2ZT9B 5BU8B 3CWBG 1VQMP 3L75E 2R3CA 4W7ZA 3USSA 2ITAA 2W8ZA 1JMMA 1X0TA 1JO5A 5AVWB 1NTMJ 2IZ1A 2LR2A 1W5CE 1K05A 3L75G 2CPSA 1FZBA 3GW6A 1SQQE 1GU5A 3V5BA 2OTKE 2QA4P 2Z4EC 3A5TA 4WY4D 1IK9A 1RE3B 1RE3A 3BCCE 1EZVD 2PRRA 1JMBA 1SQQG 2Y9YA 2FYNB 3LIEA 3AE7C 3SWKA 4B86A 1G1JA 2AEJA 4L75A 1FZDA 2IPPA 4N78D 3PJSK 1BGYD 3AEAC 4BRYB 4IFFA 4BRYA 2IBZE 1CSBA 2GY7A 3K5BA 3CC2P 1Q2NA 4H44D 1N73C 1KYOI 3E1IB 3BASA 4H0LB 3H32C 1OMIA 4L73A 1KQSO 2QJYC 3JSVC 3B5NB 3AE3C 3WUUA 3B5NA 1H88A 1SQXG 2W90A 1T3JA 1YI2P 1KB9D 2J5UA 3RL0g 4R4MA 1QVGO 3L71D 1TU3F 1T8ZA 2QJPC 3I55P 4JBZA 3MP7B 2BCCE 5AW8B 2QJKC 3G9RA 2KSJA 1X79B 1N7LA 5H2FH 2OYOA 5H2FE 1VQ4P 2ZYAA 4RJTA 3AE6C 1SQVG 1N8RQ 1WT6A 1GTWA 3L73E 3L70J 3CD6P 3P32A 1PPJD 4HYTB 2D2CC 1FICA 2HLOB 2RMZA 4NPDA 2HLOA 3RBXA 4JPZB 5AVVB 1SQBJ 5GTIH 1T2KC 2N1TD 4ZMDA 3F89A 4NPFX 1M1JB 1NTMD 4RKUJ 3MGNA 1M1JA 3H1HE 1L0NJ 1UIXA 4IL6H 3FIBA 4IL6E 3V2PA 1X9VA 1YIJP 2J5ZA 2QM7A 1BE3E 3VMAA 3KZIE 2L5GB 4HKZH 2P7JA 1FZGB 1R5SA 5APTA 1ZW0A 5AVSB 1FZGA 1K04A 2B9BA 3HE4A 3O6QA 5KLVK 1NAYA 3V4WA 2J61B 3CLQA 4M7HA 5TISE 2J61A 4GOEA 1VQKP 4GT1A 1JB0J 2M5AB 3VP8A 3TF5A 2M5AA 1VQ5P 3GLMA 2KXPB 2OYHC 4D6TJ 2XZRA 4WY4B 1J1EB 1USDA 1LGHB 1IFJA 4XE5B 4WY4A 3KDPB 2VRSA 3H1KJ 5AVUB 2MKVA 2NRGA 2Q3EA 1Q90D 1FDIA 2J3OA 1KILC 1SQPK 1SFCD 1IFDA 1L4AC 2Q5UA 1BGYE 5APYA 2ZAEB 1P84D 1G2CA 1EZVG 1FE6A 4EOTA 1OWAA 4R9JA 3CCSP 5EFWB 4L76A 2JEEA 1BGYG 1IO4A 4H44B 3CWBJ 3RK2D 2ZXXA 1M90Q 1FZCB 1T2KD 1FZCA 4YPCA 1KB9H 2XKMA 1GL2D 2YKOA 1RE4A 2A45I 1H8AA 1FDMA 1YTZT 1PGPA 1QX8A 1LWUB 4AUWA 3U1CA 2K3RA 1GMJA 2E5YA 2Q7CA 2P58A 3L75J 2ZT9C 2CK3H 2Y0EA 3L71G 3P8CE 3CCMP 2I1KA 3CXHI 3M9QA 2J0HA 3KPEA 4ZKPA 1YITP 5CBNA 4RESB 2H88C 2R3SA 2QEXP 1L0ND 1SQQJ 4ASVA 3FWNA 1KYOH 1YTZI 1KYOE 1Y9BA 3PHLA 3TSIA 5KLVE 2N1TB 1PPJG 3KHUA 3L4FA 3BCCJ 2N1TA 3WUVA 2C0XA 1VQOP 1RE3C 4UB8E 2IFMA 2Y0DA 2IDBA 2A06D 4D6TD 5AW4B 5APXA 4MN4C 1RHZB 2FYNC 4KJMA 4EYYQ 4K35A 2WZ7A 1M1KQ 2POHA 3H1KD 3CX5I 5KAIE 1SQPE 1KMIZ 5APUA 1S5LX 1SP4A 1S2EA 1JEKA 3H32A 2C9LY 3VMZA 2QM8A 5DJUB 3E1IC 1XTGB 4H0LC 2P1JA 1HBWA 2QIWA 1SVFA 2K1AA 2RH0A 1PP9E 5AW1B 3A0BH 4ZFGA 3A0BE 3B5NC 1IZNB 2PP6A 3JC22 1K8AQ 1P84H 4Y99B 2JO1A 2BCCJ 3BRVB 1ZR4A 1SFCB 3PLNA 1VDFA 5AVXB 1SFCA 1KQGB 4CPGA 2K9JB 4IFDK 3II6A 2K9JA 3WUTA 3L72E 3D71A 3L73J 3H25A 2HODC 1Y8AA 3B8EB 1CZQA 3AE4C 2R5BA 5KAFH 2OTLP 2QSIA 5KAFE 4YXDC 3R4YA 1HJ0A 3RK2B 2QE7H 3MUDA 2Q9IB 2AEFA 1Y47A 2Q9IA 2G8YA 2B87B 4KT0J 2HLOC 2B87A 3RBZA 2M8RA 1GL2B 5KKZB 3H1HJ 1GL2A 1NOHA 3KYQA 4W7YA 5AW0B 2E5TA 2FKWB 2LXCB 4PJ0H 1BE3J 2KP8A 1VQ6P 4PJ0E 3HTKB 2KLVA 2HR3A 3HTKA 2P10A 1S3JA 3BCCD 3VOPA 3HE5B 1YQ3C 2YXQB 1FZGC 1HH0A 1NTZK 2Q6QA 2V7QH 5APQA 3HD7D 2IBZD 1L0NG 2SPZA 1YQ4C 2YIUB 3KXDA 3EWKA 4WY4C 1J1EC 1BGYJ 3Q2YA 5M1BA 4Y28J 2MJZA 1VL2A 1DEEG 4HB1A 2W6JH 2A06G 4D6TG 2BCCD 3CXHE 4DZOA 1HVVA 3CCRP 1LTGC 3H1KG 3CCLP 1QLED 2JHMF 5GTHH 5GTHE 4H44C 2M3BA 3L73D 4OVNF 1E79H 1FZCC 4Z1MH 4XA4A 4R9TA 2N9BA 3VMXA 2Q3IA 5E79H 4C7NB 5E79E 3D70A 1DD3A 1LWUC 4C7NA 4PV1D 4LLHA 3ZDMA 1AFOA 2OGUA 3N4XA 4ASWA 3H1HD 3FWLA 3AE8C 1LJ2A 1FDOA 2V4HA 1JNMA 3EQ2A 4IOIH 1N86B 1BE3D 3BRTB 3CX5H 1N86A 3CX5E 1U57A 1L0LK 1X8YA 1EDKA 5KLVJ 1OZHA 1JC9A 3WMM0 4EDFA 1NGMB 1NTZE 3VYIA 5AVQB 2N1TC 1RQUA 3S9OA 3HUSB 1SQPJ 3F5HA 5B66H 5B66E 5CJ0A 2JWAA 1KFNA 3WU2H 2J58A 3WU2E 3BCCG 1ZR2A 1Q7YQ 2FYUK 3FXEA 5CMZA 3HD7B 4I1LA 2Y0CA 1EDIA 3HD7A 3E1IA 1PP9J 2J60A 5TJHA 2GA1A 1LTSC 4NYTA 2IBZG 3IFMA 2KZJA 5AW7B 3AE5C 2JP3A 3G3ZA 2QG4A 5APWA 4Y99C 3L72J 1SFCC 3TK1A 1S9KE 1NU1K 3VP9A 2HODB 1PGOA 1JY3P 1FIDA 2HODA 3V4QA 1Q86Q 4LGDE 1OVVA 1MFZA 2IYOA 3P8CD 1LT9B 1N2DC 3V2NA 1BSNA 1LT9A 3AEBC 3FX0A 3A2AA 2BCCG 3T97B 3EFFK 3U59A 1GZLA 3G71P 3T97A 3MHVA 3MUDC 3RK2C 2Q9IC 2J3UA 2BASA 2E42A 1PGQA 3PTZA 1Q81Q 1KYOD 1AA0A 3H1LE 5AVYB 1KTMA 1GL2C 1L0LE 3L73G 5KKZC 2WSFH 1AQ5A 5KLVD 1HGVA 1MV8A 1HWTC 3NMDA 4W80A 4PV1B 2JDIH 4TT3H 1EDJA 3KZIH 3R2PA 2FXPA 2WITA 2V7QJ 3Q5PA 3H1HG 1NTKK 1ZRTE 3M06A 5TISH 3B4SA 3ITKA 1S5LH 3V2RA 1S5LE 1SQPD 1BE3G 5CHXA 4OH8B 2XV5A 4L74A 2FYUE 4NPEA 1NAFA 5BVZA 2HYNA 1NVOA 2YIUC 1PP9D 2YO2A 2R44A 1JM0A 3AEEC 1YHQP 1MKMA 5AVTB 1KQLA 1QVFO 1M56D 3BVHB 5B5EH 4JQ0D 5B5EE 3C1LA 3BVHA 2E75D 3L72D 3GF3A 1NU1E 4WB4A 4U7JA 2HFED 4XFJA 1KZUB 3A3YB 1AJYA 3SSUA 1CI6B 2N9YB 1HUCA 1CI6A 3BATA 1MUUA 2KUBA 1SLQA 2YMKA 1LWUA 1LTIC 3CCQP 2J64A 2JKVA 3G6EP 1JCDA 4K3AA 2KZIA 1K73Q 3GG2A 4GIFA 5BU5A 4N3YB 1UIIA 3CMAP 1ZMEC 1WRGA 3ABVC 2NZ2A 1PL5A 4RO0A 2WPQA 1N86C 3C9IA 4DT0A 4BWNA 1DIPA 4YXWH 1JY2P 1Q82Q 3L35A 1PIXA 2NPSD 2KOGA 4I7ZB 1NTZJ 3CPWO 1KV4A 1NTKE 1QEXA 2ZXEB 3Q1MA 1PV3A 1GU4A 2KIKA 4H13D 2J3GA 3NFQA 1T3UA 1SQBK 2WPRA 2WSSH 4UB8H 4BXLA 1S72P 2G3AA 1QL2A 1VF5B 4OWFA 1OW7A 1J1DB 2GUVA 5KLVG 2I1JA 1NTKG 4U3FD 1FU1A 1USEA 3M9HA 4PD4I 3CC7P 3HUSC 4GKGA 1YJWP 5KAIH 4ZNCA 2ZVNB 2H7HA 2OTJP 3VN0A 1NO4A 3Q5RA 4GODA 3AEGC 3MZWB 3L37A 3CXHD 3VTPC 2W27A 2E76B 3M91A 3HD7C 2P2UA 2Q1KA 2XU6A 1RF0B 2GM4A 3M9BA 1SQPG 1OW6A 1NKNA 1RY3A 3M0DC 1Z3UA 5KJ7C 1BDDA 2WNPF 1AVYA 1PP9G 2YKQA 2H43B 2H43A 3H1JE 3IAOA 2KK7A 2KSEA 1AV1A 1FZAB 5CCHD 2E75B 1FZAA 3IN6A 1URQC 5APVA 1LT9C 2FFDB 3CX5D 3L72G 3H1LJ 2HG5D 2XNXB 1L0LJ 1JTHB 1LTBC 1DH3A 2XNXA 4JZCA 2WSFJ 1Z3SA 3IF4A 2JHLF 3O8ZA 4EPUA 4IFMA 3SWYA 1NTZD 1BDCA 2FIBA 4PV1C 2O01J 2OARA 3H1ID 1H89A 3CL3D 2ZVOB 1FZFB 3C8VA 3AEFC 1FZFA 2B88A 1FOSE 4OGQD 3HE5A 3A0HH 3CCJP 1JUNA 3A0HE 1AVOA 1S4XA 5DJTB 2E43A 1PFIA 1W2EA 1U7MA 1FZEB 1MZ9A 5C39A 1FZEA 2NPSB 3V6IA 2XNDH 2K37A 2FYUJ 1T6AA 3MD0A 2NPSA 1OX3A 2WQYC 1SQQK 5CCGC 3GF7A 4ZKUA 2PGDA 1EXIA 2WMMA 2A45H 1NH4A 3G4SP 3CMEP 4H13B 1S1CX 1BCCD 1IFMA 3L74E 3RK3D 2E74D 5KJ7D 1N7SD 4U3FE 1JY2N 2KI7B 2UWJE 1KILE 2ZJSE 3GHGB 3CC4P 4WWIA 3GHGA 3SFEC 2YKPA 2H89C 2A45G 1LNQA 3CXHH 1S9KD 1URQD 4U3FG 3BVHC 3AE2C 1VQ9P 3SWFA 2O01N 1SQXK 3B71A 4JYCA 2JJLA 1DD4A 3M0AA 2I8DA 1KFMA 1OFCX 1ZN5A 3D6ZA 4JYBA 5AVRB 1FJKA 1EQ7A 2J0YA 3TGUD 3H1LD 4O9BA 1L0LD 1EDLA 1SQVK 1EZVI 4C46A 1M7LA 1CW5A 4PD4E 2J1GA 3AECC 2YXRB 5CBOA 2OQQA 3SFDC 2JWDA 5CCHA 1IJDB 1RQVA 4QMAA 1NTKJ 1ZRTD 5CCGD 1AQTA 3MIWA 4I7ZC 3JCUH 1LTJB 5AW9B 3JCUE 3I5CA 1LTJA 1DEBA 2R5DA 1A02F 1A02J 1J2JB 3H1IE 2DW3A 1FZBB 2FYUD 3W67A 2Z5IA 1KB9I 1VF5C 2K9YA 1M57D 3RL0D 1J1DC 1NTZG 3HUSA 1OW8A 3H1IG 4OGQB 2W6BA 3RGUA 1IC2A 2OYIB 2OYIA 1KC8Q 2YMYA 4HJGH 2ZYDA 1OXZA 2E76C 1BSHA 1BCCE 1NU1D 3RK3E 1RF0C 2AXTH 2AXTE 2IYPA 2J2PA 4UB6H 1SQXE 4UB6E 1GW4A 1NWQA 3RK3B 2E74B 3M0DA 1NYHA 1N7SB 1NHLA 5KJ7A 1N7SA 3AEDC 1BCCG 3AE9C 3H1JJ 5AVZB 5AW2B 2C0WA 1OVRA 2WSCH 1R5LA 2IX7C 1LT1A 2H43C 4LC1A 2AEMA 2W6AA 1URQB 1URQA 1GK6A 1SQVE 5KTBA 2ZYGA 1FZAC 1HJBA 2FXOA 2E75C 4WBAA 1VQPP 1IFNA 1X22A 5APSA 2FFDC 1RH5B 1EC5A 2WSEJ 4GOFA 2J0GA 2XNXC 2M3EA 3TGUE 1QL1A 4DCKA 2FYZA 1NKZB 1DX7A 2LXBA 1NTKD 2JHHC 1RF1B 1H0TB 1RF1A 1VF5D 3OW2O 1H0TA 1FOSF 5GTIE 3TGUG 3H1LG 3OAKA 2O01H 1JCCA 1L0LG 3LW5H 3CCVP 4GDOA 1P84I 1YBKA 1FZFC 3NTNA 2QVAA 3PP5A 3PH0A 2E76D 3Q3DA 2ZFCA 5AW3B 3E7KA 2HPCB 2KS1B 1FZEC 2HPCA 2KS1A 4C7RA 5CCGA 3P8MC 2BEQD 1NTMK 2NPSC 3HE4B 3O6QB 2JR8A 2J3FD 3L74J 2QRXA 4I6MC 2IZ0A 4U3FJ 3LIDA 4H13C 1VQNP 3OJAB 1VQ7P 5KLIB 1YJ9P 1W2BO 1EZVE 2FYUG 3RL0B 3GHGC 4WVZA 1VPCA 1ZOYC 3TYYA 4EIJA 2RKLA 2R32A 3KQGA 3H1JD 4N78E 2JHKF 2GUSA 1G2CB 1LTAC 2FXMA 4TLFA 3IR9A 1JY3O 3V2QA 4JF7A 5L8RJ 1FIBA 4M3LA 2D2CD 1NU1G 1GW3A 1FBMA 3HRNA 3AE1C 1RE4B 1KB9E 1ZP0C 1OIPA 3L71E 3L70D 1YYCA 2O3JA 2WT7B 2O1JA 2WT7A 1SQBD 2J59M 1L2PA 5CCHC 2AXCA 1GD2E 1ZLLA 1PZQA 1JOCA 1KORA 2PFXA 3H1IJ 1JY3N 1PPJE 1LTJC 1EXJA 1E5WA 1IFIA 2M0BA 1NTME 1FZBC 1GK4A 2Z4EB 3L74D 3N7NA 4KHXA 3TNUB 2Z4EA 3TNUA 1G1IA 2D39A 3W68A 4AYCA 1L0NK 1KILD 1L4AD 1VQLP 4IL6X 1D7MA 1K9MQ 4OGQC 1NTMG 2OYIC 2L91A 1BCCJ 2K88A 2B89A 2BEZF 2Z5HA 2C9NY 1NJIQ 3UIAA 1KN7A 2P67A 1SQXJ 2KLUA 1RF0A 1HF9A 3Q5SA 2J3FA 1N73B 3H32B 1N73A 2WTYA 2YO3A 2IFNA 1ZXGA 3PRJA 3RK3C 4AQRD 2E74C 1FAVA 1M8OB 2WSCJ 3CI9A 1N7SC 2QJYB 2W83C
chains in the Genus database with same CATH topology
5APWA 4Y99C 3H6PA 3M0AA 2JEEA 1IO4A 2KB7P 1KFMA 1SFCC 4M7FA 3TK1A 1S9KE 1NU1K 1ZN5A 3RK2D 1FZCB 4JYBA 2YNYA 3VP9A 5AVRB 1T2KD 2HODB 1FZCA 1JY3P 1FIDA 1FJKA 2HODA 4N6JA 1EQ7A 2XKMA 3V4QA 1GL2D 2YKOA 5AW6B 2J0YA 1RE4A 4LGDE 1MFZA 2A45I 1H8AA 1FDMA 1YTZT 3P8CD 1LT9B 1LWUB 4O9BA 2FFDA 1N2DC 3V2NA 4AUWA 1SQVK 3U1CA 1LT9A 3A2AA 3OA7A 1JTHA 3U59A 1GZLA 3T97A 4C46A 2Q7CA 1M7LA 2XDJA 1CW5A 1JY2O 2WSEH 2J1GA 3RK2C 2Q9IC 2J3UA 2BASA 2E42A 3EFGA 5AVYB 3P8CE 2I1KA 1GL2C 1RF1C 3M9QA 2J0HA 5CCHA 3KPEA 2WSFH 1AQ5A 1IJDB 1HGVA 1MV8A 1HWTC 3NMDA 4ZKPA 3L36A 4W80A 5CCGD 4RESB 3A7OA 1HTLC 3MIWA 2O1KA 3NXSA 1M1JC 1LTJB 5AW9B 3I5CA 1LTJA 1YTZI 4HH2A 1DEBA 2R5DA 4DOJA 1A02F 1FJPA 1A02J 1J2JB 2WWWA 3TSIA 3R2PA 2WITA 1FZBB 2N1TB 1NTKK 3M06A 3L4FA 2N1TA 2Z5IA 2HPCC 3V2RA 2C0XA 3RL0D 1RE3C 5CHXA 1J1DC 3U1AA 3HUSA 4OH8B 2IFMA 2XV5A 1LTTC 4I2LC 5AW4B 5APXA 2W6BA 1IC2A 1Z56A 2OYIB 2WZ7A 2POHA 2OYHB 2OYIA 1NAFA 2H8PD 2YMYA 5BVZA 2OYHA 2HYNA 3B5ND 1XTCC 2YO2A 5APUA 1OXZA 1ZV8A 2CPBA 1SP4A 4JYOX 1KILB 3RL0C 2PAJA 5AVTB 1KILA 1L4AB 3H32A 1RF0C 2C9LY 3VMZA 2QM8A 1KQLA 1L4AA 3MTUE 2J2PA 5AW5B 3E1IC 1XTGB 3VMYA 1GW4A 2LKMA 2P1JA 3BVHB 1NWQA 3RK3B 1HBWA 3M0DA 1SVFA 3BVHA 1N7SB 1NHLA 5AW1B 4ZFGA 5KJ7A 1N7SA 3B5NC 2PP6A 4WB4A 5AVZB 5AW2B 4Y99B 5CJ4A 2C0WA 2HFED 3BRVB 2WSCH 3P7KA 1ZR4A 1SFCB 1VDFA 5AVXB 1KZUB 1SFCA 2IX7C 3A3YB 2H43C 1CI6B 4LC1A 4IFDK 1HUCA 2W6AA 1URQB 3II6A 1CI6A 3BATA 2WPSA 1URQA 1GK6A 5KTBA 1MUUA 1SLQA 1FZAC 2JHIF 1LWUA 1LTIC 1HJBA 2J64A 1GDTA 2HODC 3B8EB 1HGZA 4WBAA 1CZQA 1JCDA 1RE4C 1IFNA 4GIFA 5APSA 5BU5A 4N3YB 2KYVA 2R5BA 2FFDC 2J0GA 2XNXC 3RK2B 3MUDA 2Q9IB 1WRGA 1QL1A 2Q9IA 2FYZA 5BU8B 1NKZB 1DX7A 2HLOC 2M8RA 1GL2B 1RF1B 2JHHC 2WPQA 1GL2A 1NOHA 3KYQA 4W7YA 1RF1A 2R3CA 5AW0B 1N86C 3C9IA 1JY2P 4W7ZA 2FKWB 3L35A 1FOSF 2NPSD 1JMMA 2KP8A 2KOGA 2O01H 3OAKA 3HTKB 1JCCA 1JO5A 2KLVA 3LW5H 5AVWB 3HTKA 1FZFC 2ZXEB 1GU4A 2CPSA 1FZBA 3NTNA 3VOPA 1GU5A 2J3GA 3PP5A 3HE5B 3NFQA 1T3UA 1SQBK 3V5BA 2WPRA 2Z4EC 2ZFCA 5AW3B 3A5TA 1HH0A 4WY4D 2HPCB 1FZGC 1QL2A 1FZEC 2HPCA 1IK9A 4C7RA 1NTZK 5CCGA 3P8MC 1NTMK 2NPSC 3HE4B 1RE3B 1J1DB 5APQA 3HD7D 2GUVA 2I1JA 2J3FD 1RE3A 1FU1A 4I6MC 3M9HA 3HUSC 4GKGA 3LIEA 4B86A 3LIDA 2H7HA 3OJAB 3VN0A 1G1JA 1NO4A 1FZDA 2IPPA 4N78D 4WY4C 1J1EC 3L37A 3VTPC 2W27A 4IFFA 1CSBA 3M91A 3RL0B 2GY7A 3GHGC 3HD7C 2P2UA 2XU6A 2MJZA 1RF0B 1VPCA 2GM4A 1N73C 3M9BA 3E1IB 3BASA 3TYYA 4EIJA 3H32C 2R32A 3KQGA 4N78E 2JHKF 2GUSA 1G2CB 1LTAC 1NKNA 2FXMA 4DZOA 1RY3A 3M0DC 3B5NB 1Z3UA 1HVVA 3IR9A 1JY3O 3B5NA 1H88A 3V2QA 1LTGC 4JF7A 5KJ7C 1T3JA 2WNPF 1FIBA 2YKQA 2JHMF 2H43B 4M3LA 1T8ZA 2M3BA 2H43A 1FZCC 4XA4A 5AW8B 4R9TA 2N9BA 3VMXA 1FZAB 2Q3IA 2KSJA 5CCHD 1GW3A 1FBMA 3HRNA 1FZAA 1X79B 1N7LA 1URQC 5APVA 4C7NB 1RE4B 1LT9C 1LWUC 4C7NA 4LLHA 2FFDB 2HG5D 1AFOA 1WT6A 1GTWA 2XNXB 1YYCA 1JTHB 3P32A 1LTBC 3N4XA 1DH3A 2XNXA 4JZCA 2WT7B 4HYTB 1Z3SA 2O1JA 1FICA 2WT7A 2HLOB 2JHLF 2HLOA 2J59M 5AVVB 3O8ZA 4EPUA 4IFMA 3SWYA 5CCHC 3EQ2A 1JNMA 1N86B 1T2KC 2N1TD 3BRTB 1GD2E 1ZLLA 1N86A 1M1JB 1JOCA 2FIBA 3MGNA 2OARA 1M1JA 1L0LK 1X8YA 1JY3N 1H89A 3CL3D 1JC9A 3WMM0 1FZFB 1LTJC 1E5WA 1FZFA 3FIBA 1FOSE 3V2PA 1X9VA 2J5ZA 3HE5A 1IFIA 2QM7A 1JUNA 2L5GB 3VYIA 5AVQB 2E43A 1FZBC 2N1TC 1GK4A 2Z4EB 2P7JA 1FZGB 1PFIA 1W2EA 3N7NA 5APTA 5AVSB 4KHXA 3TNUB 2Z4EA 1FZGA 1FZEB 1MZ9A 3HE4A 5KLVK 3TNUA 1FZEA 1G1IA 3V4WA 2NPSB 2D39A 2J61B 3CLQA 4M7HA 3MD0A 4AYCA 2J61A 2NPSA 1L0NK 1KILD 1SQQK 5CCGC 4GT1A 1L4AD 4ZKUA 3HUSB 2A45H 1NH4A 3VP8A 1IFMA 2OYIC 5CJ0A 3RK3D 1KFNA 2OYHC 2XZRA 1N7SD 2J58A 1JY2N 5KJ7D 1ZR2A 4WY4B 2Z5HA 2C9NY 1J1EB 1LGHB 3UIAA 1IFJA 2FYUK 4XE5B 2P67A 3KDPB 4WY4A 5CMZA 2VRSA 5AVUB 1RF0A 3GHGB 3HD7B 4I1LA 2J3OA 1KILC 1SQPK 3GHGA 3HD7A 1SFCD 2YKPA 3E1IA 2J3FA 1IFDA 1L4AC 1N73B 2A45G 2Q5UA 3H32B 1N73A 2J60A 5APYA 2WTYA 1LTSC 1S9KD 1URQD 2YO3A 4NYTA 2IFNA 1G2CA 3IFMA 3BVHC 3RK3C 4AQRD 5AW7B 1FAVA 3CI9A 3SWFA 4EOTA 1N7SC 1SQXK 3G3ZA 4JYCA 1OWAA 2JJLA 4R9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZB A;  2XNX A;  4JZC A;  2J3G A;  1T3U A;  1Z3S A;  1FIC A;  2HLO B;  2JHL F;  4M7F A;  4JYO X;  2Z4E C;  1FZG C;  2HLO A;  2HPC B;  1FZC B;  4EPU A;  1FZE C;  2HPC A;  2HOD B;  3H32 A;  1N86 B;  1RF0 C;  1FZC A;  1JY3 P;  1FID A;  1N86 A;  2HOD A;  1RE3 B;  2J2P A;  1M1J B;  2J0Y A;  2J3F D;  3E1I C;  1RE3 A;  1RE4 A;  2FIB A;  2A45 I;  1M1J A;  3BVH B;  1LT9 B;  1LWU B;  3HUS C;  2FFD A;  1JY3 N;  3BVH A;  1LT9 A;  1JC9 A;  4ZFG A;  1FZF B;  1LTJ C;  1FZF A;  3FIB A;  2J5Z A;  1FZD A;  1JY2 O;  2J1G A;  2Q9I C;  2J3U A;  1FZB C;  2Z4E B;  1FZG B;  2H43 C;  1W2E A;  2GY7 A;  3GHG C;  2Z4E A;  1FZG A;  1FZE B;  1RF1 C;  1RF0 B;  2J0H A;  1FZE A;  2D39 A;  2J61 B;  1N73 C;  4M7H A;  3E1I B;  2J61 A;  1FZA C;  2JHI F;  3H32 C;  1LWU A;  2J64 A;  2HOD C;  3HUS B;  2JHK F;  1RE4 C;  1M1J C;  2A45 H;  1LTJ B;  2OYI C;  2FFD C;  1LTJ A;  1Z3U A;  2OYH C;  1JY3 O;  2J0G A;  1JY2 N;  2XNX C;  2Q9I B;  2WNP F;  1FIB A;  2Q9I A;  1FZB B;  2JHM F;  2H43 B;  2HLO C;  1RF0 A;  3GHG B;  2JHH C;  1RF1 B;  2H43 A;  2J3O A;  2HPC C;  3GHG A;  1FZC C;  3E1I A;  1RF1 A;  2J3F A;  1N86 C;  4R9T A;  1N73 B;  2A45 G;  1JY2 P;  1FZA B;  1RE3 C;  3H32 B;  1N73 A;  2J60 A;  3HUS A;  1FZA A;  4NYT A;  1RE4 B;  3BVH C;  1LT9 C;  1LWU C;  2OYI B;  2FFD B;  1FZF C;  2OYH B;  2OYI A;  4R9J A;  2XNX B;  2OYH A; 
#chains in the Genus database with same CATH topology
 1SQV J;  3H6P A;  1VQ8 P;  1U7J A;  3CWB D;  2KB7 P;  4M7F A;  2QJP B;  1FC2 C;  1P84 E;  3E1R A;  3I56 P;  2YNY A;  4PD4 D;  2ZT9 D;  2QJK B;  4N6J A;  1OVU A;  3TDK A;  5AW6 B;  3CCE P;  1KQF B;  3TGU J;  2FFD A;  1QGK B;  3H1J G;  1IK7 A;  2IBZ I;  3OA7 A;  1JTH A;  3L75 D;  2XDJ A;  1JY2 O;  1PGJ A;  2WSE H;  2D2C B;  3FXD A;  3S4R A;  3EFG A;  1RF1 C;  3L70 E;  2WPV B;  1R8E A;  3QH9 A;  3LW5 J;  1LP1 B;  3L36 A;  3A7O A;  1HTL C;  1LP1 A;  1SS1 A;  1SQQ D;  4A7P A;  2O1K A;  3NXS A;  1SQB E;  1M1J C;  2WVR A;  4HH2 A;  3L70 G;  4DOJ A;  1FJP A;  2WWW A;  1L0N E;  2RN0 A;  1SQB G;  2HPC C;  4EI2 A;  3U1A A;  3QWO C;  1LTT C;  4I2L C;  4H0L D;  1Z56 A;  2OYH B;  1SQX D;  2H8P D;  5KLI C;  4DJG A;  2OYH A;  3B5N D;  1XTC C;  4YTP C;  1ZV8 A;  2CPB A;  4JYO X;  1KIL B;  2A06 E;  3RL0 C;  3L74 G;  2PAJ A;  4D6T E;  1KIL A;  1L4A B;  1NU1 J;  3GMA A;  1L4A A;  2KNC B;  1MFT A;  3MTU E;  5AW5 B;  3H1K E;  1WMK A;  2KNC A;  3VMY A;  2LKM A;  1SQV D;  3CCU P;  1YJN P;  4R4L A;  5CJ4 A;  3P7K A;  1FS0 E;  2Y9Z A;  5K5G B;  1KD1 Q;  2FY8 A;  3S1K A;  2WPS A;  3L71 J;  2JHI F;  2FBW C;  3CWB E;  3D6Y A;  1GDT A;  3FGA D;  1HGZ A;  1RE4 C;  4PD4 H;  2KYV A;  1IFP A;  2ZT9 B;  5BU8 B;  3CWB G;  1VQM P;  3L75 E;  2R3C A;  4W7Z A;  3USS A;  2ITA A;  2W8Z A;  1JMM A;  1X0T A;  1JO5 A;  5AVW B;  1NTM J;  2IZ1 A;  2LR2 A;  1W5C E;  1K05 A;  3L75 G;  2CPS A;  1FZB A;  3GW6 A;  1SQQ E;  1GU5 A;  3V5B A;  2OTK E;  2QA4 P;  2Z4E C;  3A5T A;  4WY4 D;  1IK9 A;  1RE3 B;  1RE3 A;  3BCC E;  1EZV D;  2PRR A;  1JMB A;  1SQQ G;  2Y9Y A;  2FYN B;  3LIE A;  3AE7 C;  3SWK A;  4B86 A;  1G1J A;  2AEJ A;  4L75 A;  1FZD A;  2IPP A;  4N78 D;  3PJS K;  1BGY D;  3AEA C;  4BRY B;  4IFF A;  4BRY A;  2IBZ E;  1CSB A;  2GY7 A;  3K5B A;  3CC2 P;  1Q2N A;  4H44 D;  1N73 C;  1KYO I;  3E1I B;  3BAS A;  4H0L B;  3H32 C;  1OMI A;  4L73 A;  1KQS O;  2QJY C;  3JSV C;  3B5N B;  3AE3 C;  3WUU A;  3B5N A;  1H88 A;  1SQX G;  2W90 A;  1T3J A;  1YI2 P;  1KB9 D;  2J5U A;  3RL0 g;  4R4M A;  1QVG O;  3L71 D;  1TU3 F;  1T8Z A;  2QJP C;  3I55 P;  4JBZ A;  3MP7 B;  2BCC E;  5AW8 B;  2QJK C;  3G9R A;  2KSJ A;  1X79 B;  1N7L A;  5H2F H;  2OYO A;  5H2F E;  1VQ4 P;  2ZYA A;  4RJT A;  3AE6 C;  1SQV G;  1N8R Q;  1WT6 A;  1GTW A;  3L73 E;  3L70 J;  3CD6 P;  3P32 A;  1PPJ D;  4HYT B;  2D2C C;  1FIC A;  2HLO B;  2RMZ A;  4NPD A;  2HLO A;  3RBX A;  4JPZ B;  5AVV B;  1SQB J;  5GTI H;  1T2K C;  2N1T D;  4ZMD A;  3F89 A;  4NPF X;  1M1J B;  1NTM D;  4RKU J;  3MGN A;  1M1J A;  3H1H E;  1L0N J;  1UIX A;  4IL6 H;  3FIB A;  4IL6 E;  3V2P A;  1X9V A;  1YIJ P;  2J5Z A;  2QM7 A;  1BE3 E;  3VMA A;  3KZI E;  2L5G B;  4HKZ H;  2P7J A;  1FZG B;  1R5S A;  5APT A;  1ZW0 A;  5AVS B;  1FZG A;  1K04 A;  2B9B A;  3HE4 A;  3O6Q A;  5KLV K;  1NAY A;  3V4W A;  2J61 B;  3CLQ A;  4M7H A;  5TIS E;  2J61 A;  4GOE A;  1VQK P;  4GT1 A;  1JB0 J;  2M5A B;  3VP8 A;  3TF5 A;  2M5A A;  1VQ5 P;  3GLM A;  2KXP B;  2OYH C;  4D6T J;  2XZR A;  4WY4 B;  1J1E B;  1USD A;  1LGH B;  1IFJ A;  4XE5 B;  4WY4 A;  3KDP B;  2VRS A;  3H1K J;  5AVU B;  2MKV A;  2NRG A;  2Q3E A;  1Q90 D;  1FDI A;  2J3O A;  1KIL C;  1SQP K;  1SFC D;  1IFD A;  1L4A C;  2Q5U A;  1BGY E;  5APY A;  2ZAE B;  1P84 D;  1G2C A;  1EZV G;  1FE6 A;  4EOT A;  1OWA A;  4R9J A;  3CCS P;  5EFW B;  4L76 A;  2JEE A;  1BGY G;  1IO4 A;  4H44 B;  3CWB J;  3RK2 D;  2ZXX A;  1M90 Q;  1FZC B;  1T2K D;  1FZC A;  4YPC A;  1KB9 H;  2XKM A;  1GL2 D;  2YKO A;  1RE4 A;  2A45 I;  1H8A A;  1FDM A;  1YTZ T;  1PGP A;  1QX8 A;  1LWU B;  4AUW A;  3U1C A;  2K3R A;  1GMJ A;  2E5Y A;  2Q7C A;  2P58 A;  3L75 J;  2ZT9 C;  2CK3 H;  2Y0E A;  3L71 G;  3P8C E;  3CCM P;  2I1K A;  3CXH I;  3M9Q A;  2J0H A;  3KPE A;  4ZKP A;  1YIT P;  5CBN A;  4RES B;  2H88 C;  2R3S A;  2QEX P;  1L0N D;  1SQQ J;  4ASV A;  3FWN A;  1KYO H;  1YTZ I;  1KYO E;  1Y9B A;  3PHL A;  3TSI A;  5KLV E;  2N1T B;  1PPJ G;  3KHU A;  3L4F A;  3BCC J;  2N1T A;  3WUV A;  2C0X A;  1VQO P;  1RE3 C;  4UB8 E;  2IFM A;  2Y0D A;  2IDB A;  2A06 D;  4D6T D;  5AW4 B;  5APX A;  4MN4 C;  1RHZ B;  2FYN C;  4KJM A;  4EYY Q;  4K35 A;  2WZ7 A;  1M1K Q;  2POH A;  3H1K D;  3CX5 I;  5KAI E;  1SQP E;  1KMI Z;  5APU A;  1S5L X;  1SP4 A;  1S2E A;  1JEK A;  3H32 A;  2C9L Y;  3VMZ A;  2QM8 A;  5DJU B;  3E1I C;  1XTG B;  4H0L C;  2P1J A;  1HBW A;  2QIW A;  1SVF A;  2K1A A;  2RH0 A;  1PP9 E;  5AW1 B;  3A0B H;  4ZFG A;  3A0B E;  3B5N C;  1IZN B;  2PP6 A;  3JC2 2;  1K8A Q;  1P84 H;  4Y99 B;  2JO1 A;  2BCC J;  3BRV B;  1ZR4 A;  1SFC B;  3PLN A;  1VDF A;  5AVX B;  1SFC A;  1KQG B;  4CPG A;  2K9J B;  4IFD K;  3II6 A;  2K9J A;  3WUT A;  3L72 E;  3D71 A;  3L73 J;  3H25 A;  2HOD C;  1Y8A A;  3B8E B;  1CZQ A;  3AE4 C;  2R5B A;  5KAF H;  2OTL P;  2QSI A;  5KAF E;  4YXD C;  3R4Y A;  1HJ0 A;  3RK2 B;  2QE7 H;  3MUD A;  2Q9I B;  2AEF A;  1Y47 A;  2Q9I A;  2G8Y A;  2B87 B;  4KT0 J;  2HLO C;  2B87 A;  3RBZ A;  2M8R A;  1GL2 B;  5KKZ B;  3H1H J;  1GL2 A;  1NOH A;  3KYQ A;  4W7Y A;  5AW0 B;  2E5T A;  2FKW B;  2LXC B;  4PJ0 H;  1BE3 J;  2KP8 A;  1VQ6 P;  4PJ0 E;  3HTK B;  2KLV A;  2HR3 A;  3HTK A;  2P10 A;  1S3J A;  3BCC D;  3VOP A;  3HE5 B;  1YQ3 C;  2YXQ B;  1FZG C;  1HH0 A;  1NTZ K;  2Q6Q A;  2V7Q H;  5APQ A;  3HD7 D;  2IBZ D;  1L0N G;  2SPZ A;  1YQ4 C;  2YIU B;  3KXD A;  3EWK A;  4WY4 C;  1J1E C;  1BGY J;  3Q2Y A;  5M1B A;  4Y28 J;  2MJZ A;  1VL2 A;  1DEE G;  4HB1 A;  2W6J H;  2A06 G;  4D6T G;  2BCC D;  3CXH E;  4DZO A;  1HVV A;  3CCR P;  1LTG C;  3H1K G;  3CCL P;  1QLE D;  2JHM F;  5GTH H;  5GTH E;  4H44 C;  2M3B A;  3L73 D;  4OVN F;  1E79 H;  1FZC C;  4Z1M H;  4XA4 A;  4R9T A;  2N9B A;  3VMX A;  2Q3I A;  5E79 H;  4C7N B;  5E79 E;  3D70 A;  1DD3 A;  1LWU C;  4C7N A;  4PV1 D;  4LLH A;  3ZDM A;  1AFO A;  2OGU A;  3N4X A;  4ASW A;  3H1H D;  3FWL A;  3AE8 C;  1LJ2 A;  1FDO A;  2V4H A;  1JNM A;  3EQ2 A;  4IOI H;  1N86 B;  1BE3 D;  3BRT B;  3CX5 H;  1N86 A;  3CX5 E;  1U57 A;  1L0L K;  1X8Y A;  1EDK A;  5KLV J;  1OZH A;  1JC9 A;  3WMM 0;  4EDF A;  1NGM B;  1NTZ E;  3VYI A;  5AVQ B;  2N1T C;  1RQU A;  3S9O A;  3HUS B;  1SQP J;  3F5H A;  5B66 H;  5B66 E;  5CJ0 A;  2JWA A;  1KFN A;  3WU2 H;  2J58 A;  3WU2 E;  3BCC G;  1ZR2 A;  1Q7Y Q;  2FYU K;  3FXE A;  5CMZ A;  3HD7 B;  4I1L A;  2Y0C A;  1EDI A;  3HD7 A;  3E1I A;  1PP9 J;  2J60 A;  5TJH A;  2GA1 A;  1LTS C;  4NYT A;  2IBZ G;  3IFM A;  2KZJ A;  5AW7 B;  3AE5 C;  2JP3 A;  3G3Z A;  2QG4 A;  5APW A;  4Y99 C;  3L72 J;  1SFC C;  3TK1 A;  1S9K E;  1NU1 K;  3VP9 A;  2HOD B;  1PGO A;  1JY3 P;  1FID A;  2HOD A;  3V4Q A;  1Q86 Q;  4LGD E;  1OVV A;  1MFZ A;  2IYO A;  3P8C D;  1LT9 B;  1N2D C;  3V2N A;  1BSN A;  1LT9 A;  3AEB C;  3FX0 A;  3A2A A;  2BCC G;  3T97 B;  3EFF K;  3U59 A;  1GZL A;  3G71 P;  3T97 A;  3MHV A;  3MUD C;  3RK2 C;  2Q9I C;  2J3U A;  2BAS A;  2E42 A;  1PGQ A;  3PTZ A;  1Q81 Q;  1KYO D;  1AA0 A;  3H1L E;  5AVY B;  1KTM A;  1GL2 C;  1L0L E;  3L73 G;  5KKZ C;  2WSF H;  1AQ5 A;  5KLV D;  1HGV A;  1MV8 A;  1HWT C;  3NMD A;  4W80 A;  4PV1 B;  2JDI H;  4TT3 H;  1EDJ A;  3KZI H;  3R2P A;  2FXP A;  2WIT A;  2V7Q J;  3Q5P A;  3H1H G;  1NTK K;  1ZRT E;  3M06 A;  5TIS H;  3B4S A;  3ITK A;  1S5L H;  3V2R A;  1S5L E;  1SQP D;  1BE3 G;  5CHX A;  4OH8 B;  2XV5 A;  4L74 A;  2FYU E;  4NPE A;  1NAF A;  5BVZ A;  2HYN A;  1NVO A;  2YIU C;  1PP9 D;  2YO2 A;  2R44 A;  1JM0 A;  3AEE C;  1YHQ P;  1MKM A;  5AVT B;  1KQL A;  1QVF O;  1M56 D;  3BVH B;  5B5E H;  4JQ0 D;  5B5E E;  3C1L A;  3BVH A;  2E75 D;  3L72 D;  3GF3 A;  1NU1 E;  4WB4 A;  4U7J A;  2HFE D;  4XFJ A;  1KZU B;  3A3Y B;  1AJY A;  3SSU A;  1CI6 B;  2N9Y B;  1HUC A;  1CI6 A;  3BAT A;  1MUU A;  2KUB A;  1SLQ A;  2YMK A;  1LWU A;  1LTI C;  3CCQ P;  2J64 A;  2JKV A;  3G6E P;  1JCD A;  4K3A A;  2KZI A;  1K73 Q;  3GG2 A;  4GIF A;  5BU5 A;  4N3Y B;  1UII A;  3CMA P;  1ZME C;  1WRG A;  3ABV C;  2NZ2 A;  1PL5 A;  4RO0 A;  2WPQ A;  1N86 C;  3C9I A;  4DT0 A;  4BWN A;  1DIP A;  4YXW H;  1JY2 P;  1Q82 Q;  3L35 A;  1PIX A;  2NPS D;  2KOG A;  4I7Z B;  1NTZ J;  3CPW O;  1KV4 A;  1NTK E;  1QEX A;  2ZXE B;  3Q1M A;  1PV3 A;  1GU4 A;  2KIK A;  4H13 D;  2J3G A;  3NFQ A;  1T3U A;  1SQB K;  2WPR A;  2WSS H;  4UB8 H;  4BXL A;  1S72 P;  2G3A A;  1QL2 A;  1VF5 B;  4OWF A;  1OW7 A;  1J1D B;  2GUV A;  5KLV G;  2I1J A;  1NTK G;  4U3F D;  1FU1 A;  1USE A;  3M9H A;  4PD4 I;  3CC7 P;  3HUS C;  4GKG A;  1YJW P;  5KAI H;  4ZNC A;  2ZVN B;  2H7H A;  2OTJ P;  3VN0 A;  1NO4 A;  3Q5R A;  4GOD A;  3AEG C;  3MZW B;  3L37 A;  3CXH D;  3VTP C;  2W27 A;  2E76 B;  3M91 A;  3HD7 C;  2P2U A;  2Q1K A;  2XU6 A;  1RF0 B;  2GM4 A;  3M9B A;  1SQP G;  1OW6 A;  1NKN A;  1RY3 A;  3M0D C;  1Z3U A;  5KJ7 C;  1BDD A;  2WNP F;  1AVY A;  1PP9 G;  2YKQ A;  2H43 B;  2H43 A;  3H1J E;  3IAO A;  2KK7 A;  2KSE A;  1AV1 A;  1FZA B;  5CCH D;  2E75 B;  1FZA A;  3IN6 A;  1URQ C;  5APV A;  1LT9 C;  2FFD B;  3CX5 D;  3L72 G;  3H1L J;  2HG5 D;  2XNX B;  1L0L J;  1JTH B;  1LTB C;  1DH3 A;  2XNX A;  4JZC A;  2WSF J;  1Z3S A;  3IF4 A;  2JHL F;  3O8Z A;  4EPU A;  4IFM A;  3SWY A;  1NTZ D;  1BDC A;  2FIB A;  4PV1 C;  2O01 J;  2OAR A;  3H1I D;  1H89 A;  3CL3 D;  2ZVO B;  1FZF B;  3C8V A;  3AEF C;  1FZF A;  2B88 A;  1FOS E;  4OGQ D;  3HE5 A;  3A0H H;  3CCJ P;  1JUN A;  3A0H E;  1AVO A;  1S4X A;  5DJT B;  2E43 A;  1PFI A;  1W2E A;  1U7M A;  1FZE B;  1MZ9 A;  5C39 A;  1FZE A;  2NPS B;  3V6I A;  2XND H;  2K37 A;  2FYU J;  1T6A A;  3MD0 A;  2NPS A;  1OX3 A;  2WQY C;  1SQQ K;  5CCG C;  3GF7 A;  4ZKU A;  2PGD A;  1EXI A;  2WMM A;  2A45 H;  1NH4 A;  3G4S P;  3CME P;  4H13 B;  1S1C X;  1BCC D;  1IFM A;  3L74 E;  3RK3 D;  2E74 D;  5KJ7 D;  1N7S D;  4U3F E;  1JY2 N;  2KI7 B;  2UWJ E;  1KIL E;  2ZJS E;  3GHG B;  3CC4 P;  4WWI A;  3GHG A;  3SFE C;  2YKP A;  2H89 C;  2A45 G;  1LNQ A;  3CXH H;  1S9K D;  1URQ D;  4U3F G;  3BVH C;  3AE2 C;  1VQ9 P;  3SWF A;  2O01 N;  1SQX K;  3B71 A;  4JYC A;  2JJL A;  1DD4 A;  3M0A A;  2I8D A;  1KFM A;  1OFC X;  1ZN5 A;  3D6Z A;  4JYB A;  5AVR B;  1FJK A;  1EQ7 A;  2J0Y A;  3TGU D;  3H1L D;  4O9B A;  1L0L D;  1EDL A;  1SQV K;  1EZV I;  4C46 A;  1M7L A;  1CW5 A;  4PD4 E;  2J1G A;  3AEC C;  2YXR B;  5CBO A;  2OQQ A;  3SFD C;  2JWD A;  5CCH A;  1IJD B;  1RQV A;  4QMA A;  1NTK J;  1ZRT D;  5CCG D;  1AQT A;  3MIW A;  4I7Z C;  3JCU H;  1LTJ B;  5AW9 B;  3JCU E;  3I5C A;  1LTJ A;  1DEB A;  2R5D A;  1A02 F;  1A02 J;  1J2J B;  3H1I E;  2DW3 A;  1FZB B;  2FYU D;  3W67 A;  2Z5I A;  1KB9 I;  1VF5 C;  2K9Y A;  1M57 D;  3RL0 D;  1J1D C;  1NTZ G;  3HUS A;  1OW8 A;  3H1I G;  4OGQ B;  2W6B A;  3RGU A;  1IC2 A;  2OYI B;  2OYI A;  1KC8 Q;  2YMY A;  4HJG H;  2ZYD A;  1OXZ A;  2E76 C;  1BSH A;  1BCC E;  1NU1 D;  3RK3 E;  1RF0 C;  2AXT H;  2AXT E;  2IYP A;  2J2P A;  4UB6 H;  1SQX E;  4UB6 E;  1GW4 A;  1NWQ A;  3RK3 B;  2E74 B;  3M0D A;  1NYH A;  1N7S B;  1NHL A;  5KJ7 A;  1N7S A;  3AED C;  1BCC G;  3AE9 C;  3H1J J;  5AVZ B;  5AW2 B;  2C0W A;  1OVR A;  2WSC H;  1R5L A;  2IX7 C;  1LT1 A;  2H43 C;  4LC1 A;  2AEM A;  2W6A A;  1URQ B;  1URQ A;  1GK6 A;  1SQV E;  5KTB A;  2ZYG A;  1FZA C;  1HJB A;  2FXO A;  2E75 C;  4WBA A;  1VQP P;  1IFN A;  1X22 A;  5APS A;  2FFD C;  1RH5 B;  1EC5 A;  2WSE J;  4GOF A;  2J0G A;  2XNX C;  2M3E A;  3TGU E;  1QL1 A;  4DCK A;  2FYZ A;  1NKZ B;  1DX7 A;  2LXB A;  1NTK D;  2JHH C;  1RF1 B;  1H0T B;  1RF1 A;  1VF5 D;  3OW2 O;  1H0T A;  1FOS F;  5GTI E;  3TGU G;  3H1L G;  3OAK A;  2O01 H;  1JCC A;  1L0L G;  3LW5 H;  3CCV P;  4GDO A;  1P84 I;  1YBK A;  1FZF C;  3NTN A;  2QVA A;  3PP5 A;  3PH0 A;  2E76 D;  3Q3D A;  2ZFC A;  5AW3 B;  3E7K A;  2HPC B;  2KS1 B;  1FZE C;  2HPC A;  2KS1 A;  4C7R A;  5CCG A;  3P8M C;  2BEQ D;  1NTM K;  2NPS C;  3HE4 B;  3O6Q B;  2JR8 A;  2J3F D;  3L74 J;  2QRX A;  4I6M C;  2IZ0 A;  4U3F J;  3LID A;  4H13 C;  1VQN P;  3OJA B;  1VQ7 P;  5KLI B;  1YJ9 P;  1W2B O;  1EZV E;  2FYU G;  3RL0 B;  3GHG C;  4WVZ A;  1VPC A;  1ZOY C;  3TYY A;  4EIJ A;  2RKL A;  2R32 A;  3KQG A;  3H1J D;  4N78 E;  2JHK F;  2GUS A;  1G2C B;  1LTA C;  2FXM A;  4TLF A;  3IR9 A;  1JY3 O;  3V2Q A;  4JF7 A;  5L8R J;  1FIB A;  4M3L A;  2D2C D;  1NU1 G;  1GW3 A;  1FBM A;  3HRN A;  3AE1 C;  1RE4 B;  1KB9 E;  1ZP0 C;  1OIP A;  3L71 E;  3L70 D;  1YYC A;  2O3J A;  2WT7 B;  2O1J A;  2WT7 A;  1SQB D;  2J59 M;  1L2P A;  5CCH C;  2AXC A;  1GD2 E;  1ZLL A;  1PZQ A;  1JOC A;  1KOR A;  2PFX A;  3H1I J;  1JY3 N;  1PPJ E;  1LTJ C;  1EXJ A;  1E5W A;  1IFI A;  2M0B A;  1NTM E;  1FZB C;  1GK4 A;  2Z4E B;  3L74 D;  3N7N A;  4KHX A;  3TNU B;  2Z4E A;  3TNU A;  1G1I A;  2D39 A;  3W68 A;  4AYC A;  1L0N K;  1KIL D;  1L4A D;  1VQL P;  4IL6 X;  1D7M A;  1K9M Q;  4OGQ C;  1NTM G;  2OYI C;  2L91 A;  1BCC J;  2K88 A;  2B89 A;  2BEZ F;  2Z5H A;  2C9N Y;  1NJI Q;  3UIA A;  1KN7 A;  2P67 A;  1SQX J;  2KLU A;  1RF0 A;  1HF9 A;  3Q5S A;  2J3F A;  1N73 B;  3H32 B;  1N73 A;  2WTY A;  2YO3 A;  2IFN A;  1ZXG A;  3PRJ A;  3RK3 C;  4AQR D;  2E74 C;  1FAV A;  1M8O B;  2WSC J;  3CI9 A;  1N7S C;  2QJY B;  2W83 C; 
#chains in the Genus database with same CATH homology
 5APW A;  4Y99 C;  3H6P A;  3M0A A;  2JEE A;  1IO4 A;  2KB7 P;  1KFM A;  1SFC C;  4M7F A;  3TK1 A;  1S9K E;  1NU1 K;  1ZN5 A;  3RK2 D;  1FZC B;  4JYB A;  2YNY A;  3VP9 A;  5AVR B;  1T2K D;  2HOD B;  1FZC A;  1JY3 P;  1FID A;  1FJK A;  2HOD A;  4N6J A;  1EQ7 A;  2XKM A;  3V4Q A;  1GL2 D;  2YKO A;  5AW6 B;  2J0Y A;  1RE4 A;  4LGD E;  1MFZ A;  2A45 I;  1H8A A;  1FDM A;  1YTZ T;  3P8C D;  1LT9 B;  1LWU B;  4O9B A;  2FFD A;  1N2D C;  3V2N A;  4AUW A;  1SQV K;  3U1C A;  1LT9 A;  3A2A A;  3OA7 A;  1JTH A;  3U59 A;  1GZL A;  3T97 A;  4C46 A;  2Q7C A;  1M7L A;  2XDJ A;  1CW5 A;  1JY2 O;  2WSE H;  2J1G A;  3RK2 C;  2Q9I C;  2J3U A;  2BAS A;  2E42 A;  3EFG A;  5AVY B;  3P8C E;  2I1K A;  1GL2 C;  1RF1 C;  3M9Q A;  2J0H A;  5CCH A;  3KPE A;  2WSF H;  1AQ5 A;  1IJD B;  1HGV A;  1MV8 A;  1HWT C;  3NMD A;  4ZKP A;  3L36 A;  4W80 A;  5CCG D;  4RES B;  3A7O A;  1HTL C;  3MIW A;  2O1K A;  3NXS A;  1M1J C;  1LTJ B;  5AW9 B;  3I5C A;  1LTJ A;  1YTZ I;  4HH2 A;  1DEB A;  2R5D A;  4DOJ A;  1A02 F;  1FJP A;  1A02 J;  1J2J B;  2WWW A;  3TSI A;  3R2P A;  2WIT A;  1FZB B;  2N1T B;  1NTK K;  3M06 A;  3L4F A;  2N1T A;  2Z5I A;  2HPC C;  3V2R A;  2C0X A;  3RL0 D;  1RE3 C;  5CHX A;  1J1D C;  3U1A A;  3HUS A;  4OH8 B;  2IFM A;  2XV5 A;  1LTT C;  4I2L C;  5AW4 B;  5APX A;  2W6B A;  1IC2 A;  1Z56 A;  2OYI B;  2WZ7 A;  2POH A;  2OYH B;  2OYI A;  1NAF A;  2H8P D;  2YMY A;  5BVZ A;  2OYH A;  2HYN A;  3B5N D;  1XTC C;  2YO2 A;  5APU A;  1OXZ A;  1ZV8 A;  2CPB A;  1SP4 A;  4JYO X;  1KIL B;  3RL0 C;  2PAJ A;  5AVT B;  1KIL A;  1L4A B;  3H32 A;  1RF0 C;  2C9L Y;  3VMZ A;  2QM8 A;  1KQL A;  1L4A A;  3MTU E;  2J2P A;  5AW5 B;  3E1I C;  1XTG B;  3VMY A;  1GW4 A;  2LKM A;  2P1J A;  3BVH B;  1NWQ A;  3RK3 B;  1HBW A;  3M0D A;  1SVF A;  3BVH A;  1N7S B;  1NHL A;  5AW1 B;  4ZFG A;  5KJ7 A;  1N7S A;  3B5N C;  2PP6 A;  4WB4 A;  5AVZ B;  5AW2 B;  4Y99 B;  5CJ4 A;  2C0W A;  2HFE D;  3BRV B;  2WSC H;  3P7K A;  1ZR4 A;  1SFC B;  1VDF A;  5AVX B;  1KZU B;  1SFC A;  2IX7 C;  3A3Y B;  2H43 C;  1CI6 B;  4LC1 A;  4IFD K;  1HUC A;  2W6A A;  1URQ B;  3II6 A;  1CI6 A;  3BAT A;  2WPS A;  1URQ A;  1GK6 A;  5KTB A;  1MUU A;  1SLQ A;  1FZA C;  2JHI F;  1LWU A;  1LTI C;  1HJB A;  2J64 A;  1GDT A;  2HOD C;  3B8E B;  1HGZ A;  4WBA A;  1CZQ A;  1JCD A;  1RE4 C;  1IFN A;  4GIF A;  5APS A;  5BU5 A;  4N3Y B;  2KYV A;  2R5B A;  2FFD C;  2J0G A;  2XNX C;  3RK2 B;  3MUD A;  2Q9I B;  1WRG A;  1QL1 A;  2Q9I A;  2FYZ A;  5BU8 B;  1NKZ B;  1DX7 A;  2HLO C;  2M8R A;  1GL2 B;  1RF1 B;  2JHH C;  2WPQ A;  1GL2 A;  1NOH A;  3KYQ A;  4W7Y A;  1RF1 A;  2R3C A;  5AW0 B;  1N86 C;  3C9I A;  1JY2 P;  4W7Z A;  2FKW B;  3L35 A;  1FOS F;  2NPS D;  1JMM A;  2KP8 A;  2KOG A;  2O01 H;  3OAK A;  3HTK B;  1JCC A;  1JO5 A;  2KLV A;  3LW5 H;  5AVW B;  3HTK A;  1FZF C;  2ZXE B;  1GU4 A;  2CPS A;  1FZB A;  3NTN A;  3VOP A;  1GU5 A;  2J3G A;  3PP5 A;  3HE5 B;  3NFQ A;  1T3U A;  1SQB K;  3V5B A;  2WPR A;  2Z4E C;  2ZFC A;  5AW3 B;  3A5T A;  1HH0 A;  4WY4 D;  2HPC B;  1FZG C;  1QL2 A;  1FZE C;  2HPC A;  1IK9 A;  4C7R A;  1NTZ K;  5CCG A;  3P8M C;  1NTM K;  2NPS C;  3HE4 B;  1RE3 B;  1J1D B;  5APQ A;  3HD7 D;  2GUV A;  2I1J A;  2J3F D;  1RE3 A;  1FU1 A;  4I6M C;  3M9H A;  3HUS C;  4GKG A;  3LIE A;  4B86 A;  3LID A;  2H7H A;  3OJA B;  3VN0 A;  1G1J A;  1NO4 A;  1FZD A;  2IPP A;  4N78 D;  4WY4 C;  1J1E C;  3L37 A;  3VTP C;  2W27 A;  4IFF A;  1CSB A;  3M91 A;  3RL0 B;  2GY7 A;  3GHG C;  3HD7 C;  2P2U A;  2XU6 A;  2MJZ A;  1RF0 B;  1VPC A;  2GM4 A;  1N73 C;  3M9B A;  3E1I B;  3BAS A;  3TYY A;  4EIJ A;  3H32 C;  2R32 A;  3KQG A;  4N78 E;  2JHK F;  2GUS A;  1G2C B;  1LTA C;  1NKN A;  2FXM A;  4DZO A;  1RY3 A;  3M0D C;  3B5N B;  1Z3U A;  1HVV A;  3IR9 A;  1JY3 O;  3B5N A;  1H88 A;  3V2Q A;  1LTG C;  4JF7 A;  5KJ7 C;  1T3J A;  2WNP F;  1FIB A;  2YKQ A;  2JHM F;  2H43 B;  4M3L A;  1T8Z A;  2M3B A;  2H43 A;  1FZC C;  4XA4 A;  5AW8 B;  4R9T A;  2N9B A;  3VMX A;  1FZA B;  2Q3I A;  2KSJ A;  5CCH D;  1GW3 A;  1FBM A;  3HRN A;  1FZA A;  1X79 B;  1N7L A;  1URQ C;  5APV A;  4C7N B;  1RE4 B;  1LT9 C;  1LWU C;  4C7N A;  4LLH A;  2FFD B;  2HG5 D;  1AFO A;  1WT6 A;  1GTW A;  2XNX B;  1YYC A;  1JTH B;  3P32 A;  1LTB C;  3N4X A;  1DH3 A;  2XNX A;  4JZC A;  2WT7 B;  4HYT B;  1Z3S A;  2O1J A;  1FIC A;  2WT7 A;  2HLO B;  2JHL F;  2HLO A;  2J59 M;  5AVV B;  3O8Z A;  4EPU A;  4IFM A;  3SWY A;  5CCH C;  3EQ2 A;  1JNM A;  1N86 B;  1T2K C;  2N1T D;  3BRT B;  1GD2 E;  1ZLL A;  1N86 A;  1M1J B;  1JOC A;  2FIB A;  3MGN A;  2OAR A;  1M1J A;  1L0L K;  1X8Y A;  1JY3 N;  1H89 A;  3CL3 D;  1JC9 A;  3WMM 0;  1FZF B;  1LTJ C;  1E5W A;  1FZF A;  3FIB A;  1FOS E;  3V2P A;  1X9V A;  2J5Z A;  3HE5 A;  1IFI A;  2QM7 A;  1JUN A;  2L5G B;  3VYI A;  5AVQ B;  2E43 A;  1FZB C;  2N1T C;  1GK4 A;  2Z4E B;  2P7J A;  1FZG B;  1PFI A;  1W2E A;  3N7N A;  5APT A;  5AVS B;  4KHX A;  3TNU B;  2Z4E A;  1FZG A;  1FZE B;  1MZ9 A;  3HE4 A;  5KLV K;  3TNU A;  1FZE A;  1G1I A;  3V4W A;  2NPS B;  2D39 A;  2J61 B;  3CLQ A;  4M7H A;  3MD0 A;  4AYC A;  2J61 A;  2NPS A;  1L0N K;  1KIL D;  1SQQ K;  5CCG C;  4GT1 A;  1L4A D;  4ZKU A;  3HUS B;  2A45 H;  1NH4 A;  3VP8 A;  1IFM A;  2OYI C;  5CJ0 A;  3RK3 D;  1KFN A;  2OYH C;  2XZR A;  1N7S D;  2J58 A;  1JY2 N;  5KJ7 D;  1ZR2 A;  4WY4 B;  2Z5H A;  2C9N Y;  1J1E B;  1LGH B;  3UIA A;  1IFJ A;  2FYU K;  4XE5 B;  2P67 A;  3KDP B;  4WY4 A;  5CMZ A;  2VRS A;  5AVU B;  1RF0 A;  3GHG B;  3HD7 B;  4I1L A;  2J3O A;  1KIL C;  1SQP K;  3GHG A;  3HD7 A;  1SFC D;  2YKP A;  3E1I A;  2J3F A;  1IFD A;  1L4A C;  1N73 B;  2A45 G;  2Q5U A;  3H32 B;  1N73 A;  2J60 A;  5APY A;  2WTY A;  1LTS C;  1S9K D;  1URQ D;  2YO3 A;  4NYT A;  2IFN A;  1G2C A;  3IFM A;  3BVH C;  3RK3 C;  4AQR D;  5AW7 B;  1FAV A;  3CI9 A;  3SWF A;  4EOT A;  1N7S C;  1SQX K;  3G3Z A;  4JYC A;  1OWA A;  2JJL A;  4R9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...