1LTJC

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
b'YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 88
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ltjC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ltjC02
1M1JB 3H32B 1W2EA 2HODA 3GHGA 1FZGB 2HODC 3GHGC 2Q9IB 2FFDA 1JY3N 1FZBB 1RF1A 1FZFA 1N86B 2HLOA 2FFDC 2J1GA 1RF1C 1FZFC 1JY2P 2HLOC 3HUSA 1FZEA 1FZAA 2A45I 3HUSC 1FZEC 3E1IB 1FZAC 2OYHA 1LWUB 4M7FA 1RF0B 2OYHC 4ZFGA 1FIBA 2J0YA 2Z4EB 2J2PA 2XNXA 1RE4A 2A45G 1Z3SA 2A45H 2J61A 2XNXC 2HPCA 3BVHB 2H43B 1RE4C 4JZCA 2J3GA 2HPCC 3FIBA 1FZCA 1FIDA 2J60A 4R9JA 1JY2N 2HODB 1LTJA 1FZCC 3GHGB 1FZDA 2J3FA 2JHKF 1RE3A 2J61B 2HPCB 2FFDB 2JHHC 1LT9A 1RE3C 1RF1B 1FZFB 2HLOB 4EPUA 1LT9C 1M1JA 3H32A 3HUSB 1FZEB 1FZAB 1M1JC 1FZGA 3H32C 2J3UA 2OYIA 1JY3O 2OYHB 4JYOX 1FZGC 2OYIC 1FZBA 1N73A 1N86A 1FICA 1FZBC 2J5ZA 1JC9A 1N73C 2XNXB 1RE4B 1LTJC 1N86C 1Z3UA 2J64A 2D39A 2JHMF 2OYIB 2J3OA 2GY7A 3E1IA 1FZCB 1LWUA 2J3FD 1JY3P 4NYTA 1N73B 1RF0A 3E1IC 4R9TA 1LTJB 1LWUC 2Z4EA 1RF0C 4M7HA 2WNPF 1RE3B 2Z4EC 2Q9IA 2J0GA 2JHIF 2FIBA 3BVHA 2H43A 1LT9B 2Q9IC 1T3UA 2J0HA 3BVHC 2H43C 1JY2O 2JHLF
chains in the Genus database with same CATH superfamily
4H44B 2Q5UA 1AVOA 2KI7B 2P58A 4H13D 1IJDB 2AXTE 2L5GB 1QVGO 5AW6B 3GHGC 1PPJE 1NU1G 1USDA 3ITKA 1RF1A 1N7SA 1N86B 2AEMA 1Q86Q 5AVUB 1URQB 1KB9D 1L4AC 3U1CA 1FZAC 2ZT9B 1L0LE 2KP8A 3H1JG 2WPVB 4M7FA 5GTHH 1JEKA 1T2KC 1S1CX 1FOSF 1GU4A 2HYNA 4OGQC 1NAYA 2OTLP 2H43B 3RBZA 1PV3A 3A7OA 2XU6A 1SQQK 3MZWB 1X0TA 3MHVA 1N7SD 1ZR4A 1QEXA 1GD2E 4K35A 1L2PA 3VP9A 2J58A 1S4XA 1SP4A 3F5HA 2J3UA 3HRNA 1BDCA 2OYIC 4H13C 3MP7B 3SSUA 2N1TA 2D39A 1ZOYC 5KAFH 1VF5D 2N9YB 1YBKA 1RF0A 3SWFA 1X22A 1JCDA 2R5BA 3H1LJ 5KLVK 5KAIH 1PP9G 3EQ2A 3OA7A 2Q9IC 3JC22 1S5LE 3R2PA 4WY4A 3B5NA 3TGUE 2Y9YA 1KMIZ 4UB8H 3CC2P 2J5UA 3HE4B 1AV1A 2J1GA 2BASA 2N1TD 2L91A 1RF1C 1GL2A 2Y0CA 1QVFO 2K37A 4N78D 3BCCE 2KXPB 5APYA 2E5YA 2P10A 3A0HE 2E74B 2J61A 2KOGA 2HPCA 2O3JA 4WY4D 2HFED 2P67A 3B5ND 1KYOE 1FZCA 3CCMP 3CX5I 2FYZA 1VF5C 1GW4A 2KS1A 3H1HJ 3H1LD 2CK3H 2J59M 2JWDA 1FS0E 4I6MC 1KQFB 3Q3DA 1PL5A 1PZQA 1HWTC 2OYOA 3D6ZA 5AW0B 3USSA 3CC7P 2JHMF 2I8DA 2OARA 1PGOA 1JMBA 1YJWP 2JR8A 2Z4EA 2R44A 1RF0C 1RQVA 4IL6E 1LTTC 2BCCE 2E75B 1MFZA 2GUSA 3OJAB 3AEDC 3AEGC 1NTKE 4WY4C 3VN0A 3B5NC 4R4LA 3RL0g 3CD6P 1NKZB 3KXDA 1DH3A 2AEJA 1JCCA 3H1LG 3HUSA 1IK7A 3H1HD 1GL2C 1MUUA 3V2QA 1VQ8P 2XZRA 4WWIA 4U3FJ 1VPCA 3TNUA 3H6PA 4PD4E 2J0YA 1LGHB 2NPSA 2J3GA 2HPCC 3FIBA 2DW3A 3H1KJ 1S5LX 1KQGB 2FY8A 3CXHH 1FZCC 3JCUH 1EXIA 1VQMP 1M56D 1BCCJ 2WT7A 4XA4A 4EPUA 1BGYE 1P84H 1FZEB 5GTIH 2N9BA 1YJ9P 5BU8B 4KT0J 1NTZJ 2XKMA 2NPSD 2C0WA 1N86A 5C39A 3L74J 3AE5C 4ZKUA 5KKZC 1VQOP 1URQA 4HJGH 2QJKB 4EOTA 2H8PD 3H1HG 2CPBA 4GIFA 3PHLA 3BASA 2QJYC 2O1JA 2RN0A 1HF9A 4R9TA 1LTJB 2QJPB 2BEQD 2PAJA 5AVZB 5B66H 2Z4EC 2GUVA 2IX7C 1ZN5A 4HH2A 2H43A 2FYUG 4H44D 5DJUB 2LR2A 1SQVD 1NU1E 2O01J 3L73G 1ZRTE 3KYQA 3QH9A 1OVUA 3ABVC 5AVYB 3H1KD 2FYNC 3TYYA 1Q2NA 2A06D 4Z1MH 1SQQE 1URQD 3NTNA 4PV1C 2WWWA 1J1EB 2ZT9D 5E79E 1BCCD 3HUSC 4MN4C 5TJHA 4IOIH 3MUDA 1H8AA 1J2JB 5KLIB 1K8AQ 2ZYAA 1YYCA 1A02F 3R4YA 4BRYB 1J1DC 1SQPJ 3AEAC 1NTZD 3BRTB 4IL6X 2NPSC 1IK9A 3L74D 1YTZI 1JY2N 3M91A 2QA4P 5AVVB 3D6YA 1S9KE 4PJ0E 2C9LY 3V4WA 1ZLLA 2IZ1A 4L76A 1SQVG 1EZVE 4R4MA 3G3ZA 2IDBA 3VMZA 2D2CB 3KZIE 1YQ3C 2KNCB 5CCHA 4NPDA 3H1KG 1KB9E 3FXDA 3HE4A 3L4FA 1SS1A 1N86C 2Z5IA 1JUNA 4L75A 3IAOA 1URQC 2YXQB 4KHXA 2RMZA 2ZT9C 4UB6E 2QM7A 3L75E 2WNPF 1LTGC 5AVQB 1AFOA 1YHQP 2H43C 1JY2O 2YO3A 4AYCA 1ZR2A 3H32B 1SLQA 1DEEG 5CCHD 1M90Q 1FJPA 1FZBB 1NU1J 1DD4A 1NTZK 2JO1A 3FGAD 2R32A 1RH5B 1E5WA 1LWUB 3H1JJ 1NH4A 1K9MQ 2E74D 3MUDC 1OVRA 1IZNB 3CXHI 2XNDH 4LGDE 4A7PA 2XV5A 4IFMA 2HODB 1NVOA 3Q5RA 1P84I 1EXJA 3LW5H 2SPZA 1NTKK 2V4HA 1BSHA 3WMM0 5EFWB 1KN7A 5KJ7A 4N78E 5CCHC 1L0NJ 2ZXEB 2XNXB 2LKMA 2ITAA 4ASWA 3VP8A 1SQPK 2WPRA 1W2BO 2OTJP 3GF7A 3MIWA 4CPGA 1N73B 2QRXA 3WUUA 2AXTH 2E75D 3H1JD 4DCKA 1PP9J 2YIUB 1LT9B 2E74C 2W27A 2MKVA 2B87B 3H25A 3M9QA 5KJ7D 1IO4A 3H1LE 4W7ZA 1JY3N 1FZEA 2PP6A 1VL2A 4K3AA 4WB4A 1JMMA 3CWBG 1HH0A 2J2PA 4OWFA 1M7LA 1Y47A 3M9BA 5AVWB 2A45H 4L73A 2FXPA 4RESB 1L0ND 1LTJA 5CMZA 1NTMJ 3WUTA 2H88C 2QM8A 1GU5A 2YNYA 2W90A 3VTPC 2KZJA 1NU1K 3M06A 4ZKPA 3VMXA 3P8CD 1FC2C 2E75C 1KORA 1PP9D 3WU2E 2WSFH 1HGZA 3KQGA 4BXLA 1JY3O 2OYHB 2Q1KA 1FDIA 1ZMEC 3H1HE 5KJ7C 2J5ZA 1EC5A 3L72G 4JBZA 2WSCJ 3L36A 1SQBG 4N3YB 2R5DA 3AEFC 5AVSB 1LT1A 1S5LH 3NFQA 3IN6A 2NZ2A 3Q2YA 2QVAA 4BRYA 3KPEA 1L0NG 3TF5A 2KLVA 1SQXE 5AW7B 3RL0B 2M3EA 3AE4C 2C0XA 4C46A 5APWA 5APXA 1OXZA 3I56P 3AEBC 2OGUA 1NTMD 3PP5A 2RH0A 3A0HH 3WUVA 1VQ7P 1FZEC 2KNCA 1KYOH 4JQ0D 1U7MA 2QG4A 1NYHA 1BDDA 1HUCA 1LP1B 3BVHB 2WSEH 4U3FE 1N7SC 1JTHA 1R5LA 5AW3B 2E5TA 2QJPC 3NXSA 1KFNA 2IBZI 2FFDB 3UIAA 1EDJA 1IFPA 3NMDA 3H1KE 2A06E 2D2CD 3H32A 4RJTA 5AVTB 2Z5HA 3RK2B 3I55P 3H1IG 3U59A 1FZBA 5H2FE 1BCCE 4I2LC 1NTMG 4C7NA 1AQ5A 2QE7H 1ZP0C 1JM0A 4IL6H 3CCVP 2J3OA 2H89C 1LWUA 3G6EP 1NTZE 2G8YA 3L74E 2B89A 2OQQA 5KLIC 1FJKA 1KILB 2FYUJ 3G9RA 1VQLP 3L73J 1QL1A 2IYOA 2HODA 2E43A 2N1TC 3N4XA 3LIDA 4JYBA 4PD4H 1JY2P 2IYPA 3L70G 2PRRA 2WSSH 1FE6A 2A45I 1A02J 1X9VA 3CX5D 1WMKA 2D2CC 2XNXA 3BRVB 3CPWO 2KK7A 1Y9BA 4D6TJ 2M5AB 1VQ4P 3P8MC 4OGQB 2J3FA 4HYTB 1BE3J 5AW1B 1SQPE 4ZNCA 3HE5B 1LT9A 2JJLA 2KSJA 2OTKE 2WVRA 1SQVJ 2B87A 3PJSK 2FYUD 3H32C 2MJZA 3L73D 1CW5A 2HR3A 3AE7C 2ZJSE 1FZBC 2M0BA 1X8YA 2OYIB 2GY7A 1ZV8A 2AEFA 2J3FD 1SQXG 1HJ0A 3EWKA 1AVYA 1LWUC 4HB1A 4Y99C 2V7QH 1GW3A 1PPJG 2M3BA 1AJYA 3PTZA 5B5EE 2J0HA 3O8ZA 3MGNA 1M1JB 2E76B 5E79H 2HODC 1MFTA 4D6TD 2Q9IB 1L0LG 5TISE 1R5SA 1T8ZA 5CCGA 1FU1A 1KYOI 1QX8A 2QSIA 1BE3D 2ZVOB 3CCLP 3QWOC 2I1KA 5CJ4A 4H0LB 2OYHA 4ZMDA 2K3RA 1U57A 2A45G 2XNXC 1XTCC 5AVRB 3SWYA 1FOSE 3H1JE 1VDFA 1IFJA 1T6AA 3HD7B 4NPEA 3Q5PA 2JEEA 3RK3B 5CCGD 3KZIH 3CCUP 2JHHC 2W6JH 1KB9H 2YIUC 4DZOA 1LT9C 3HTKB 2JWAA 1NHLA 3RBXA 4D6TG 3T97B 4BWNA 2R3SA 1H0TB 1BE3G 3CCQP 1EDLA 1FAVA 2KB7P 1JY3P 3AECC 1L0NE 4H44C 1RE3B 1LP1A 3CCRP 3BVHA 2GM4A 1K73Q 3RL0D 1W2EA 4PD4I 1SQVK 1OVVA 2KSEA 3BCCG 3P8CE 1MKMA 1PP9E 2FFDA 1RHZB 5AW9B 2KZIA 1GTWA 5CCGC 3D70A 1Z56A 3P32A 4RKUJ 1Q7YQ 3V2RA 3CMAP 1MV8A 3MD0A 4XE5B 3E1IB 3CWBJ 1KD1Q 3B8EB 2OYHC 1N8RQ 1T3JA 1GL2B 1KFMA 2CPSA 3TSIA 4EDFA 1NOHA 2W8ZA 3A0BE 4YXDC 5CBNA 1PGQA 1AQTA 4QMAA 2J61B 4OH8B 2HPCB 1KILA 5DJTB 1FZFB 2POHA 3GF3A 1USEA 1XTGB 1OW7A 3RK2D 2YMKA 1NTME 4WBAA 2KLUA 2W83C 1NWQA 1M57D 1FICA 3L72J 3IF4A 1SQBJ 1BGYD 1DX7A 1KILD 1DEBA 3CWBD 2WZ7A 2WQYC 1T3UA 3BVHC 2M5AA 4IFDK 4Y28J 1CZQA 4ASVA 2KIKA 1GK4A 1IFMA 3CXHD 3HE5A 3AE3C 1R8EA 2FFDC 1JOCA 1CSBA 2FXOA 5KLVJ 2WMMA 5AW2B 1E79H 4YPCA 3CL3D 1P84D 3KDPB 4PV1B 3RK2C 1KQSO 2ZFCA 3EFGA 2P7JA 1KZUB 1EZVI 1HBWA 3L35A 4B86A 2WPSA 3L72D 3II6A 4R9JA 1BGYG 1KB9I 4GOFA 3WU2H 2BEZF 1SQBD 2YKQA 1GMJA 4OVNF 2IPPA 2Q6QA 1UIIA 3AE8C 1KILC 2K9YA 2KUBA 3KHUA 3G71P 1M1JA 1OWAA 5APVA 1SFCB 1Y8AA 3H1IJ 1BSNA 3N7NA 1UIXA 2IZ0A 3L71D 1YQ4C 1JC9A 4YXWH 1RE4B 3CX5E 1S9KD 1Z3UA 2WPQA 1NKNA 4L74A 3K5BA 4KJMA 3AE6C 1VQKP 1EZVD 2H7HA 5KLVD 1IC2A 5APSA 4I7ZB 2E76D 3TK1A 1LTBC 1SQQG 2Y9ZA 1QGKB 1ZXGA 1VQNP 3HD7A 1FZGB 1QLED 5BU5A 2ZVNB 2NRGA 2I1JA 1HGVA 2FYUE 4WVZA 1FBMA 3L75D 3L73E 5M1BA 1KV4A 3L70J 3HTKA 4H0LD 3CC4P 1SQBK 3T97A 1W5CE 3L71G 1H0TA 3H1ID 4JF7A 1OW8A 1NJIQ 1OZHA 2R3CA 5GTHE 3HD7D 1FIDA 2JP3A 1L0NK 3RK3D 1EZVG 5KLVG 1N7LA 3W68A 1HTLC 1H89A 2JHKF 1RE3A 1YJNP 3LW5J 4RO0A 4TLFA 4TT3H 1M8OB 2O01N 5H2FH 4YTPC 2HLOB 2K9JB 4D6TE 2UWJE 5L8RJ 1M1JC 2E76C 3CCSP 1BE3E 2QJKC 3F89A 1VQ6P 1LTJC 1SQVE 3O6QB 3L75G 3C1LA 5KTBA 4IFFA 3E1IA 3SFEC 5APTA 1SQXJ 3L70D 1WT6A 4H0LC 3CMEP 3V2PA 3S4RA 4U7JA 4W80A 4M7HA 5AW8B 1N2DC 3PRJA 2ZYDA 1EDIA 5KAFE 4NPFX 2JHLF 2O01H 2P1JA 1JNMA 2K1AA 3M9HA 2ZAEB 5KAIE 1YI2P 1J1EC 1L0LJ 3HD7C 1GDTA 3RK3C 1FZFA 2K88A 2E42A 1NTMK 3V2NA 4UB8E 3C8VA 1AA0A 4AUWA 4EIJA 1GL2D 2IBZD 1Z3SA 1Q90D 1HVVA 3OW2O 1M1KQ 3GHGB 2VRSA 1LJ2A 3TDKA 2PGDA 1SQXD 1OX3A 3L37A 1PGJA 1RE3C 2HG5D 1G2CB 3A3YB 3GG2A 1OFCX 1L4AB 2WSFJ 1PPJD 1FZAB 1YIJP 3E7KA 1N73A 4GT1A 3MTUE 3U1AA 3JSVC 3S1KA 3GMAA 2FBWC 3P7KA 1L0LD 5APUA 4M3LA 5APQA 5B5EH 3ZDMA 4NYTA 3E1IC 3M0DA 1PIXA 2IBZG 5BVZA 3TGUJ 1YITP 1NO4A 2Q3EA 3AE9C 2IFNA 2FKWB 1NGMB 5TISH 1CI6B 1GK6A 2Y0EA 3D71A 3VMAA 3VYIA 4C7RA 3BCCJ 2M8RA 3FWLA 4H13B 3IR9A 3PLNA 4XFJA 1FZFC 3VMYA 1IFNA 1SFCA 2WTYA 4PV1D 4DT0A 1LNQA 1G1JA 1SQXK 1LTIC 1RE4A 2PFXA 1VQ5P 2LXCB 1PGPA 3M0AA 3GLMA 2WSEJ 1KILE 3CWBE 4EI2A 2J60A 2B88A 1IFDA 3PH0A 4GODA 1ZW0A 5CHXA 1L0LK 1RF1B 1N7SB 2AXCA 3RGUA 3TGUD 1H88A 1SFCD 3CXHE 3JCUE 1FZGA 4PJ0H 2XDJA 4HKZH 3IFMA 4U3FD 2FYUK 2JDIH 1GZLA 3BCCD 1FDMA 1P84E 1N73C 4O9BA 3LIEA 5GTIE 3G4SP 4JYCA 3CCJP 2BCCJ 3CI9A 4I1LA 2ZXXA 1S3JA 2FXMA 1OW6A 1S72P 1VQPP 1NTKJ 2W6BA 2YMYA 1VF5B 3L72E 1KYOD 1K04A 3M0DC 1S2EA 2JHIF 1SQBE 3V5BA 2YO2A 1QL2A 3CCEP 4UB6H 1OMIA 2QEXP 2RKLA 3S9OA 1Q82Q 5B66E 3AE2C 3E1RA 3GW6A 3B4SA 1Q81Q 4JPZB 2HLOA 2O1KA 2WITA 2K9JA 3TGUG 1SVFA 1X79B 4LLHA 1U7JA 3AE1C 1VQ9P 2N1TB 3L71E 1SFCC 1HJBA 4U3FG 3VOPA 1RF0B 4ZFGA 1FIBA 3A0BH 3O6QA 1KQLA 5KLVE 1RY3A 1RE4C 2YKOA 4JZCA 4W7YA 5CBOA 1NAFA 2KYVA 4WY4B 1BGYJ 2A06G 3B5NB 2BCCD 4LC1A 2W6AA 4I7ZC 1NTKD 1BCCG 3FXEA 3B71A 2Q3IA 4N6JA 3SFDC 3Q5SA 3OAKA 1JTHB 1FZGC 5AW5B 1EQ7A 3BATA 1NTZG 3I5CA 1LTSC 3L74G 3FWNA 4DJGA 1SQPD 2B9BA 2J64A 3A5TA 2WSCH 4PD4D 1FZCB 3H1IE 1OIPA 1D7MA 1WRGA 2Q7CA 4C7NB 3RL0C 2QIWA 2V7QJ 5AVXB 2YXRB 3V6IA 2J0GA 3RK3E 2KS1B 3A2AA 1SQQJ 4Y99B 3FX0A 1DD3A 2GA1A 3GHGA 2BCCG 3V4QA 5KKZB 1MZ9A 1G2CA 1NTKG 1L4AA 2HLOC 1TU3F 3W67A 4GDOA 1FZAA 2C9NY 2QJYB 4GKGA 3CLQA 1RQUA 1PFIA 4GOEA 3EFFK 2YKPA 2JKVA 2Z4EB 3L71J 2Y0DA 3L70E 2G3AA 3SWKA 1SQPG 1KC8Q 1KTMA 5CJ0A 1FZDA 2FYNB 1NU1D 1ZRTD 1CI6A 1L4AD 5K5GB 1YTZT 3AEEC 1K05A 4DOJA 1JO5A 3HUSB 3CX5H 1T2KD 5AW4B 2OYIA 3C9IA 1SQQD 4EYYQ 4JYOX 4OGQD 3TNUB 1J1DB 1LTAC 1DIPA 3L75J 1EDKA 2NPSB 2IBZE 1IFIA 2ZYGA 2LXBA 2IFMA 2Q9IA 2P2UA 1G1IA 2FIBA 1JB0J 1FDOA 2WT7B 3Q1MA 4AQRD
chains in the Genus database with same CATH topology
2YO3A 1M1JB 2Q5UA 4AYCA 1ZR2A 3H32B 1SLQA 2O01H 2P1JA 1JNMA 1IJDB 5CCHD 3M9HA 2L5GB 5AW6B 2HODC 1J1EC 3GHGC 2Q9IB 3HD7C 1GDTA 1FJPA 1FZBB 3RK3C 1T8ZA 1N7SA 1FZFA 1RF1A 1N86B 5CCGA 1FU1A 1NTZK 5AVUB 2E42A 1NTMK 1URQB 3V2NA 1L4AC 2R32A 2I1KA 5CJ4A 3U1CA 1FZAC 2OYHA 1E5WA 1LWUB 4AUWA 2KP8A 1NH4A 4EIJA 4M7FA 1GL2D 1T2KC 1FOSF 1GU4A 2A45G 1Z3SA 2HYNA 4LGDE 2XNXC 1XTCC 5AVRB 2H43B 3SWYA 1HVVA 1FOSE 2XV5A 3A7OA 4IFMA 2XU6A 1VDFA 1SQQK 1IFJA 2HODB 3GHGB 2VRSA 3HD7B 2JEEA 1N7SD 3RK3B 1ZR4A 5CCGD 1GD2E 3L37A 2JHHC 1RE3C 3LW5H 2HG5D 1G2CB 3A3YB 4DZOA 3VP9A 1LT9C 2J58A 1L4AB 1NTKK 3HTKB 1SP4A 1FZAB 3WMM0 2J3UA 1NHLA 3HRNA 2OYIC 5KJ7A 4N78E 1N73A 4GT1A 3MTUE 3U1AA 5CCHC 2ZXEB 2XNXB 2LKMA 3P7KA 5APUA 2N1TA 4M3LA 2D39A 3VP8A 1SQPK 1FAVA 5APQA 2WPRA 2KB7P 3MIWA 1JY3P 3SWFA 4NYTA 1N73B 1RF0A 3E1IC 1JCDA 3M0DA 2R5BA 5BVZA 5KLVK 1NO4A 1RE3B 2IFNA 2FKWB 3BVHA 2GM4A 1CI6B 1GK6A 1LT9B 3EQ2A 2W27A 3OA7A 3RL0D 2Q9IC 3R2PA 4WY4A 1W2EA 3VYIA 3B5NA 3M9QA 1SQVK 5KJ7D 4C7RA 1IO4A 4W7ZA 2M8RA 3P8CE 2FFDA 1JY3N 5AW9B 3IR9A 3HE4B 2J1GA 2BASA 2N1TD 1RF1C 1GL2A 1FZFC 1GTWA 5CCGC 3VMYA 1Z56A 3P32A 1FZEA 3V2RA 1IFNA 1MV8A 4N78D 1SFCA 2PP6A 3MD0A 2WTYA 4WB4A 4XE5B 1JMMA 5APYA 3E1IB 1HH0A 3B8EB 2OYHC 1G1JA 1SQXK 1T3JA 1LTIC 2J2PA 1GL2B 1M7LA 1RE4A 3M9BA 5AVWB 2A45H 2J61A 2KOGA 2HPCA 3M0AA 1KFMA 4RESB 4WY4D 2HFED 2P67A 3B5ND 2CPSA 3TSIA 1FZCA 2J60A 1NOHA 1LTJA 5CMZA 1IFDA 2QM8A 2FYZA 1GU5A 2J61B 4OH8B 2YNYA 2HPCB 5CHXA 1KILA 1GW4A 3VTPC 1L0LK 1RF1B 1N7SB 1FZFB 1NU1K 3M06A 2POHA 4ZKPA 3VMXA 1H88A 3P8CD 1SFCD 2J59M 1XTGB 4I6MC 2WSFH 3RK2D 1FZGA 4WBAA 1HGZA 3KQGA 2XDJA 1JY3O 3IFMA 2FYUK 2OYHB 1HWTC 1NWQA 1GZLA 1FICA 5KJ7C 5AW0B 1FDMA 2J5ZA 1N73C 4O9BA 3LIEA 4JYCA 3L36A 2JHMF 4N3YB 2R5DA 2OARA 3CI9A 4I1LA 5AVSB 2FXMA 3NFQA 1DX7A 2W6BA 2Z4EA 2YMYA 1KILD 1RF0C 1DEBA 2WZ7A 3M0DC 2JHIF 1LTTC 3KPEA 1MFZA 1T3UA 2GUSA 3V5BA 3BVHC 3OJAB 2KLVA 2YO2A 1QL2A 4IFDK 5AW7B 3RL0B 1CZQA 2C0XA 4C46A 4WY4C 5APWA 5APXA 1GK4A 3B5NC 1OXZA 3VN0A 1IFMA 3HE5A 1NKZB 2HLOA 2FFDC 1DH3A 2O1KA 1JOCA 1JCCA 2WITA 3PP5A 1CSBA 1SVFA 1X79B 4LLHA 3HUSA 2N1TB 5AW2B 1GL2C 1MUUA 3V2QA 1FZEC 2XZRA 3CL3D 1SFCC 1HJBA 3VOPA 1RF0B 3KDPB 1VPCA 3RK2C 3TNUA 3H6PA 4ZFGA 1FIBA 2J0YA 2ZFCA 1LGHB 3EFGA 1KQLA 1HUCA 2NPSA 2P7JA 1KZUB 1RY3A 1HBWA 3L35A 1RE4C 2YKOA 4JZCA 3BVHB 4W7YA 2WSEH 4B86A 2J3GA 2HPCC 1NAFA 2WPSA 3FIBA 2KYVA 4WY4B 1N7SC 3II6A 4R9JA 3B5NB 1FZCC 4LC1A 2YKQA 1JTHA 5AW3B 3NXSA 1KFNA 2IPPA 2W6AA 2FFDB 3UIAA 2WT7A 1KILC 4XA4A 4EPUA 3NMDA 1M1JA 2Q3IA 3H32A 1OWAA 5APVA 4N6JA 1FZEB 3OAKA 1JTHB 2N9BA 1SFCB 5BU8B 5AVTB 2Z5HA 3RK2B 1FZGC 3N7NA 5AW5B 3U59A 1FZBA 1EQ7A 3BATA 4I2LC 2XKMA 2NPSD 2C0WA 1N86A 3I5CA 1LTSC 1JC9A 1AQ5A 4C7NA 4ZKUA 1RE4B 1S9KD 1Z3UA 1URQA 2WPQA 1NKNA 2J64A 3A5TA 2WSCH 4EOTA 2H8PD 2CPBA 2J3OA 4GIFA 3BASA 1FZCB 1LWUA 2O1JA 2H7HA 4R9TA 1LTJB 1WRGA 2Q7CA 1IC2A 5APSA 4C7NB 3RL0C 2PAJA 5AVZB 5AVXB 2Z4EC 2GUVA 2IX7C 2J0GA 1FJKA 1ZN5A 1KILB 4HH2A 2H43A 3A2AA 3TK1A 1LTBC 4Y99B 1QL1A 3KYQA 2HODA 3GHGA 2E43A 3HD7A 1FZGB 5BU5A 2N1TC 5AVYB 2I1JA 3TYYA 1HGVA 3N4XA 3V4QA 1FBMA 3LIDA 1MZ9A 1G2CA 4JYBA 1URQD 3NTNA 1JY2P 1L4AA 2WWWA 3HTKA 2HLOC 1J1EB 1FZAA 2C9NY 4GKGA 2A45I 3HUSC 3CLQA 1SQBK 1A02J 1X9VA 1PFIA 3MUDA 1H8AA 3T97A 1J2JB 2YKPA 2Z4EB 1YYCA 2XNXA 1A02F 1J1DC 4JF7A 3BRVB 3BRTB 2NPSC 1IK9A 2R3CA 3HD7D 1FIDA 1L0NK 1YTZI 1JY2N 3P8MC 3RK3D 5CJ0A 3M91A 1FZDA 2J3FA 1N7LA 5AVVB 1HTLC 1H89A 4HYTB 5AW1B 1RE3A 2JHKF 1S9KE 3HE5B 1CI6A 1LT9A 1L4AD 2C9LY 2JJLA 2HLOB 1YTZT 2KSJA 3V4WA 4DOJA 1ZLLA 1JO5A 3HUSB 1M1JC 3G3ZA 1T2KD 5AW4B 3H32C 2MJZA 3VMZA 3C9IA 2OYIA 4JYOX 5CCHA 1CW5A 3TNUB 3HE4A 1J1DB 1FZBC 1LTAC 3L4FA 1LTJC 1N86C 2NPSB 2Z5IA 1IFIA 1JUNA 1X8YA 2OYIB 2GY7A 5KTBA 1URQC 3E1IA 4IFFA 1ZV8A 5APTA 2J3FD 4KHXA 2IFMA 1WT6A 1LWUC 4Y99C 3V2PA 2QM7A 4W80A 4M7HA 5AW8B 2WNPF 1N2DC 1LTGC 5AVQB 1GW3A 2P2UA 2Q9IA 1G1IA 2FIBA 2M3BA 1AFOA 2WT7B 2J0HA 2H43C 3O8ZA 1JY2O 2JHLF 3MGNA 4AQRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J B;  3H32 B;  1W2E A;  2HOD A;  3GHG A;  1FZG B;  2HOD C;  3GHG C;  2Q9I B;  2FFD A;  1JY3 N;  1FZB B;  1RF1 A;  1FZF A;  1N86 B;  2HLO A;  2FFD C;  2J1G A;  1RF1 C;  1FZF C;  1JY2 P;  2HLO C;  3HUS A;  1FZE A;  1FZA A;  2A45 I;  3HUS C;  1FZE C;  3E1I B;  1FZA C;  2OYH A;  1LWU B;  4M7F A;  1RF0 B;  2OYH C;  4ZFG A;  1FIB A;  2J0Y A;  2Z4E B;  2J2P A;  2XNX A;  1RE4 A;  2A45 G;  1Z3S A;  2A45 H;  2J61 A;  2XNX C;  2HPC A;  3BVH B;  2H43 B;  1RE4 C;  4JZC A;  2J3G A;  2HPC C;  3FIB A;  1FZC A;  1FID A;  2J60 A;  4R9J A;  1JY2 N;  2HOD B;  1LTJ A;  1FZC C;  3GHG B;  1FZD A;  2J3F A;  2JHK F;  1RE3 A;  2J61 B;  2HPC B;  2FFD B;  2JHH C;  1LT9 A;  1RE3 C;  1RF1 B;  1FZF B;  2HLO B;  4EPU A;  1LT9 C;  1M1J A;  3H32 A;  3HUS B;  1FZE B;  1FZA B;  1M1J C;  1FZG A;  3H32 C;  2J3U A;  2OYI A;  1JY3 O;  2OYH B;  4JYO X;  1FZG C;  2OYI C;  1FZB A;  1N73 A;  1N86 A;  1FIC A;  1FZB C;  2J5Z A;  1JC9 A;  1N73 C;  2XNX B;  1RE4 B;  1LTJ C;  1N86 C;  1Z3U A;  2J64 A;  2D39 A;  2JHM F;  2OYI B;  2J3O A;  2GY7 A;  3E1I A;  1FZC B;  1LWU A;  2J3F D;  1JY3 P;  4NYT A;  1N73 B;  1RF0 A;  3E1I C;  4R9T A;  1LTJ B;  1LWU C;  2Z4E A;  1RF0 C;  4M7H A;  2WNP F;  1RE3 B;  2Z4E C;  2Q9I A;  2J0G A;  2JHI F;  2FIB A;  3BVH A;  2H43 A;  1LT9 B;  2Q9I C;  1T3U A;  2J0H A;  3BVH C;  2H43 C;  1JY2 O;  2JHL F; 
#chains in the Genus database with same CATH topology
 4H44 B;  2Q5U A;  1AVO A;  2KI7 B;  2P58 A;  4H13 D;  1IJD B;  2AXT E;  2L5G B;  1QVG O;  5AW6 B;  3GHG C;  1PPJ E;  1NU1 G;  1USD A;  3ITK A;  1RF1 A;  1N7S A;  1N86 B;  2AEM A;  1Q86 Q;  5AVU B;  1URQ B;  1KB9 D;  1L4A C;  3U1C A;  1FZA C;  2ZT9 B;  1L0L E;  2KP8 A;  3H1J G;  2WPV B;  4M7F A;  5GTH H;  1JEK A;  1T2K C;  1S1C X;  1FOS F;  1GU4 A;  2HYN A;  4OGQ C;  1NAY A;  2OTL P;  2H43 B;  3RBZ A;  1PV3 A;  3A7O A;  2XU6 A;  1SQQ K;  3MZW B;  1X0T A;  3MHV A;  1N7S D;  1ZR4 A;  1QEX A;  1GD2 E;  4K35 A;  1L2P A;  3VP9 A;  2J58 A;  1S4X A;  1SP4 A;  3F5H A;  2J3U A;  3HRN A;  1BDC A;  2OYI C;  4H13 C;  3MP7 B;  3SSU A;  2N1T A;  2D39 A;  1ZOY C;  5KAF H;  1VF5 D;  2N9Y B;  1YBK A;  1RF0 A;  3SWF A;  1X22 A;  1JCD A;  2R5B A;  3H1L J;  5KLV K;  5KAI H;  1PP9 G;  3EQ2 A;  3OA7 A;  2Q9I C;  3JC2 2;  1S5L E;  3R2P A;  4WY4 A;  3B5N A;  3TGU E;  2Y9Y A;  1KMI Z;  4UB8 H;  3CC2 P;  2J5U A;  3HE4 B;  1AV1 A;  2J1G A;  2BAS A;  2N1T D;  2L91 A;  1RF1 C;  1GL2 A;  2Y0C A;  1QVF O;  2K37 A;  4N78 D;  3BCC E;  2KXP B;  5APY A;  2E5Y A;  2P10 A;  3A0H E;  2E74 B;  2J61 A;  2KOG A;  2HPC A;  2O3J A;  4WY4 D;  2HFE D;  2P67 A;  3B5N D;  1KYO E;  1FZC A;  3CCM P;  3CX5 I;  2FYZ A;  1VF5 C;  1GW4 A;  2KS1 A;  3H1H J;  3H1L D;  2CK3 H;  2J59 M;  2JWD A;  1FS0 E;  4I6M C;  1KQF B;  3Q3D A;  1PL5 A;  1PZQ A;  1HWT C;  2OYO A;  3D6Z A;  5AW0 B;  3USS A;  3CC7 P;  2JHM F;  2I8D A;  2OAR A;  1PGO A;  1JMB A;  1YJW P;  2JR8 A;  2Z4E A;  2R44 A;  1RF0 C;  1RQV A;  4IL6 E;  1LTT C;  2BCC E;  2E75 B;  1MFZ A;  2GUS A;  3OJA B;  3AED C;  3AEG C;  1NTK E;  4WY4 C;  3VN0 A;  3B5N C;  4R4L A;  3RL0 g;  3CD6 P;  1NKZ B;  3KXD A;  1DH3 A;  2AEJ A;  1JCC A;  3H1L G;  3HUS A;  1IK7 A;  3H1H D;  1GL2 C;  1MUU A;  3V2Q A;  1VQ8 P;  2XZR A;  4WWI A;  4U3F J;  1VPC A;  3TNU A;  3H6P A;  4PD4 E;  2J0Y A;  1LGH B;  2NPS A;  2J3G A;  2HPC C;  3FIB A;  2DW3 A;  3H1K J;  1S5L X;  1KQG B;  2FY8 A;  3CXH H;  1FZC C;  3JCU H;  1EXI A;  1VQM P;  1M56 D;  1BCC J;  2WT7 A;  4XA4 A;  4EPU A;  1BGY E;  1P84 H;  1FZE B;  5GTI H;  2N9B A;  1YJ9 P;  5BU8 B;  4KT0 J;  1NTZ J;  2XKM A;  2NPS D;  2C0W A;  1N86 A;  5C39 A;  3L74 J;  3AE5 C;  4ZKU A;  5KKZ C;  1VQO P;  1URQ A;  4HJG H;  2QJK B;  4EOT A;  2H8P D;  3H1H G;  2CPB A;  4GIF A;  3PHL A;  3BAS A;  2QJY C;  2O1J A;  2RN0 A;  1HF9 A;  4R9T A;  1LTJ B;  2QJP B;  2BEQ D;  2PAJ A;  5AVZ B;  5B66 H;  2Z4E C;  2GUV A;  2IX7 C;  1ZN5 A;  4HH2 A;  2H43 A;  2FYU G;  4H44 D;  5DJU B;  2LR2 A;  1SQV D;  1NU1 E;  2O01 J;  3L73 G;  1ZRT E;  3KYQ A;  3QH9 A;  1OVU A;  3ABV C;  5AVY B;  3H1K D;  2FYN C;  3TYY A;  1Q2N A;  2A06 D;  4Z1M H;  1SQQ E;  1URQ D;  3NTN A;  4PV1 C;  2WWW A;  1J1E B;  2ZT9 D;  5E79 E;  1BCC D;  3HUS C;  4MN4 C;  5TJH A;  4IOI H;  3MUD A;  1H8A A;  1J2J B;  5KLI B;  1K8A Q;  2ZYA A;  1YYC A;  1A02 F;  3R4Y A;  4BRY B;  1J1D C;  1SQP J;  3AEA C;  1NTZ D;  3BRT B;  4IL6 X;  2NPS C;  1IK9 A;  3L74 D;  1YTZ I;  1JY2 N;  3M91 A;  2QA4 P;  5AVV B;  3D6Y A;  1S9K E;  4PJ0 E;  2C9L Y;  3V4W A;  1ZLL A;  2IZ1 A;  4L76 A;  1SQV G;  1EZV E;  4R4M A;  3G3Z A;  2IDB A;  3VMZ A;  2D2C B;  3KZI E;  1YQ3 C;  2KNC B;  5CCH A;  4NPD A;  3H1K G;  1KB9 E;  3FXD A;  3HE4 A;  3L4F A;  1SS1 A;  1N86 C;  2Z5I A;  1JUN A;  4L75 A;  3IAO A;  1URQ C;  2YXQ B;  4KHX A;  2RMZ A;  2ZT9 C;  4UB6 E;  2QM7 A;  3L75 E;  2WNP F;  1LTG C;  5AVQ B;  1AFO A;  1YHQ P;  2H43 C;  1JY2 O;  2YO3 A;  4AYC A;  1ZR2 A;  3H32 B;  1SLQ A;  1DEE G;  5CCH D;  1M90 Q;  1FJP A;  1FZB B;  1NU1 J;  1DD4 A;  1NTZ K;  2JO1 A;  3FGA D;  2R32 A;  1RH5 B;  1E5W A;  1LWU B;  3H1J J;  1NH4 A;  1K9M Q;  2E74 D;  3MUD C;  1OVR A;  1IZN B;  3CXH I;  2XND H;  4LGD E;  4A7P A;  2XV5 A;  4IFM A;  2HOD B;  1NVO A;  3Q5R A;  1P84 I;  1EXJ A;  3LW5 H;  2SPZ A;  1NTK K;  2V4H A;  1BSH A;  3WMM 0;  5EFW B;  1KN7 A;  5KJ7 A;  4N78 E;  5CCH C;  1L0N J;  2ZXE B;  2XNX B;  2LKM A;  2ITA A;  4ASW A;  3VP8 A;  1SQP K;  2WPR A;  1W2B O;  2OTJ P;  3GF7 A;  3MIW A;  4CPG A;  1N73 B;  2QRX A;  3WUU A;  2AXT H;  2E75 D;  3H1J D;  4DCK A;  1PP9 J;  2YIU B;  1LT9 B;  2E74 C;  2W27 A;  2MKV A;  2B87 B;  3H25 A;  3M9Q A;  5KJ7 D;  1IO4 A;  3H1L E;  4W7Z A;  1JY3 N;  1FZE A;  2PP6 A;  1VL2 A;  4K3A A;  4WB4 A;  1JMM A;  3CWB G;  1HH0 A;  2J2P A;  4OWF A;  1M7L A;  1Y47 A;  3M9B A;  5AVW B;  2A45 H;  4L73 A;  2FXP A;  4RES B;  1L0N D;  1LTJ A;  5CMZ A;  1NTM J;  3WUT A;  2H88 C;  2QM8 A;  1GU5 A;  2YNY A;  2W90 A;  3VTP C;  2KZJ A;  1NU1 K;  3M06 A;  4ZKP A;  3VMX A;  3P8C D;  1FC2 C;  2E75 C;  1KOR A;  1PP9 D;  3WU2 E;  2WSF H;  1HGZ A;  3KQG A;  4BXL A;  1JY3 O;  2OYH B;  2Q1K A;  1FDI A;  1ZME C;  3H1H E;  5KJ7 C;  2J5Z A;  1EC5 A;  3L72 G;  4JBZ A;  2WSC J;  3L36 A;  1SQB G;  4N3Y B;  2R5D A;  3AEF C;  5AVS B;  1LT1 A;  1S5L H;  3NFQ A;  3IN6 A;  2NZ2 A;  3Q2Y A;  2QVA A;  4BRY A;  3KPE A;  1L0N G;  3TF5 A;  2KLV A;  1SQX E;  5AW7 B;  3RL0 B;  2M3E A;  3AE4 C;  2C0X A;  4C46 A;  5APW A;  5APX A;  1OXZ A;  3I56 P;  3AEB C;  2OGU A;  1NTM D;  3PP5 A;  2RH0 A;  3A0H H;  3WUV A;  1VQ7 P;  1FZE C;  2KNC A;  1KYO H;  4JQ0 D;  1U7M A;  2QG4 A;  1NYH A;  1BDD A;  1HUC A;  1LP1 B;  3BVH B;  2WSE H;  4U3F E;  1N7S C;  1JTH A;  1R5L A;  5AW3 B;  2E5T A;  2QJP C;  3NXS A;  1KFN A;  2IBZ I;  2FFD B;  3UIA A;  1EDJ A;  1IFP A;  3NMD A;  3H1K E;  2A06 E;  2D2C D;  3H32 A;  4RJT A;  5AVT B;  2Z5H A;  3RK2 B;  3I55 P;  3H1I G;  3U59 A;  1FZB A;  5H2F E;  1BCC E;  4I2L C;  1NTM G;  4C7N A;  1AQ5 A;  2QE7 H;  1ZP0 C;  1JM0 A;  4IL6 H;  3CCV P;  2J3O A;  2H89 C;  1LWU A;  3G6E P;  1NTZ E;  2G8Y A;  3L74 E;  2B89 A;  2OQQ A;  5KLI C;  1FJK A;  1KIL B;  2FYU J;  3G9R A;  1VQL P;  3L73 J;  1QL1 A;  2IYO A;  2HOD A;  2E43 A;  2N1T C;  3N4X A;  3LID A;  4JYB A;  4PD4 H;  1JY2 P;  2IYP A;  3L70 G;  2PRR A;  2WSS H;  1FE6 A;  2A45 I;  1A02 J;  1X9V A;  3CX5 D;  1WMK A;  2D2C C;  2XNX A;  3BRV B;  3CPW O;  2KK7 A;  1Y9B A;  4D6T J;  2M5A B;  1VQ4 P;  3P8M C;  4OGQ B;  2J3F A;  4HYT B;  1BE3 J;  5AW1 B;  1SQP E;  4ZNC A;  3HE5 B;  1LT9 A;  2JJL A;  2KSJ A;  2OTK E;  2WVR A;  1SQV J;  2B87 A;  3PJS K;  2FYU D;  3H32 C;  2MJZ A;  3L73 D;  1CW5 A;  2HR3 A;  3AE7 C;  2ZJS E;  1FZB C;  2M0B A;  1X8Y A;  2OYI B;  2GY7 A;  1ZV8 A;  2AEF A;  2J3F D;  1SQX G;  1HJ0 A;  3EWK A;  1AVY A;  1LWU C;  4HB1 A;  4Y99 C;  2V7Q H;  1GW3 A;  1PPJ G;  2M3B A;  1AJY A;  3PTZ A;  5B5E E;  2J0H A;  3O8Z A;  3MGN A;  1M1J B;  2E76 B;  5E79 H;  2HOD C;  1MFT A;  4D6T D;  2Q9I B;  1L0L G;  5TIS E;  1R5S A;  1T8Z A;  5CCG A;  1FU1 A;  1KYO I;  1QX8 A;  2QSI A;  1BE3 D;  2ZVO B;  3CCL P;  3QWO C;  2I1K A;  5CJ4 A;  4H0L B;  2OYH A;  4ZMD A;  2K3R A;  1U57 A;  2A45 G;  2XNX C;  1XTC C;  5AVR B;  3SWY A;  1FOS E;  3H1J E;  1VDF A;  1IFJ A;  1T6A A;  3HD7 B;  4NPE A;  3Q5P A;  2JEE A;  3RK3 B;  5CCG D;  3KZI H;  3CCU P;  2JHH C;  2W6J H;  1KB9 H;  2YIU C;  4DZO A;  1LT9 C;  3HTK B;  2JWA A;  1NHL A;  3RBX A;  4D6T G;  3T97 B;  4BWN A;  2R3S A;  1H0T B;  1BE3 G;  3CCQ P;  1EDL A;  1FAV A;  2KB7 P;  1JY3 P;  3AEC C;  1L0N E;  4H44 C;  1RE3 B;  1LP1 A;  3CCR P;  3BVH A;  2GM4 A;  1K73 Q;  3RL0 D;  1W2E A;  4PD4 I;  1SQV K;  1OVV A;  2KSE A;  3BCC G;  3P8C E;  1MKM A;  1PP9 E;  2FFD A;  1RHZ B;  5AW9 B;  2KZI A;  1GTW A;  5CCG C;  3D70 A;  1Z56 A;  3P32 A;  4RKU J;  1Q7Y Q;  3V2R A;  3CMA P;  1MV8 A;  3MD0 A;  4XE5 B;  3E1I B;  3CWB J;  1KD1 Q;  3B8E B;  2OYH C;  1N8R Q;  1T3J A;  1GL2 B;  1KFM A;  2CPS A;  3TSI A;  4EDF A;  1NOH A;  2W8Z A;  3A0B E;  4YXD C;  5CBN A;  1PGQ A;  1AQT A;  4QMA A;  2J61 B;  4OH8 B;  2HPC B;  1KIL A;  5DJT B;  1FZF B;  2POH A;  3GF3 A;  1USE A;  1XTG B;  1OW7 A;  3RK2 D;  2YMK A;  1NTM E;  4WBA A;  2KLU A;  2W83 C;  1NWQ A;  1M57 D;  1FIC A;  3L72 J;  3IF4 A;  1SQB J;  1BGY D;  1DX7 A;  1KIL D;  1DEB A;  3CWB D;  2WZ7 A;  2WQY C;  1T3U A;  3BVH C;  2M5A A;  4IFD K;  4Y28 J;  1CZQ A;  4ASV A;  2KIK A;  1GK4 A;  1IFM A;  3CXH D;  3HE5 A;  3AE3 C;  1R8E A;  2FFD C;  1JOC A;  1CSB A;  2FXO A;  5KLV J;  2WMM A;  5AW2 B;  1E79 H;  4YPC A;  3CL3 D;  1P84 D;  3KDP B;  4PV1 B;  3RK2 C;  1KQS O;  2ZFC A;  3EFG A;  2P7J A;  1KZU B;  1EZV I;  1HBW A;  3L35 A;  4B86 A;  2WPS A;  3L72 D;  3II6 A;  4R9J A;  1BGY G;  1KB9 I;  4GOF A;  3WU2 H;  2BEZ F;  1SQB D;  2YKQ A;  1GMJ A;  4OVN F;  2IPP A;  2Q6Q A;  1UII A;  3AE8 C;  1KIL C;  2K9Y A;  2KUB A;  3KHU A;  3G71 P;  1M1J A;  1OWA A;  5APV A;  1SFC B;  1Y8A A;  3H1I J;  1BSN A;  3N7N A;  1UIX A;  2IZ0 A;  3L71 D;  1YQ4 C;  1JC9 A;  4YXW H;  1RE4 B;  3CX5 E;  1S9K D;  1Z3U A;  2WPQ A;  1NKN A;  4L74 A;  3K5B A;  4KJM A;  3AE6 C;  1VQK P;  1EZV D;  2H7H A;  5KLV D;  1IC2 A;  5APS A;  4I7Z B;  2E76 D;  3TK1 A;  1LTB C;  1SQQ G;  2Y9Z A;  1QGK B;  1ZXG A;  1VQN P;  3HD7 A;  1FZG B;  1QLE D;  5BU5 A;  2ZVN B;  2NRG A;  2I1J A;  1HGV A;  2FYU E;  4WVZ A;  1FBM A;  3L75 D;  3L73 E;  5M1B A;  1KV4 A;  3L70 J;  3HTK A;  4H0L D;  3CC4 P;  1SQB K;  3T97 A;  1W5C E;  3L71 G;  1H0T A;  3H1I D;  4JF7 A;  1OW8 A;  1NJI Q;  1OZH A;  2R3C A;  5GTH E;  3HD7 D;  1FID A;  2JP3 A;  1L0N K;  3RK3 D;  1EZV G;  5KLV G;  1N7L A;  3W68 A;  1HTL C;  1H89 A;  2JHK F;  1RE3 A;  1YJN P;  3LW5 J;  4RO0 A;  4TLF A;  4TT3 H;  1M8O B;  2O01 N;  5H2F H;  4YTP C;  2HLO B;  2K9J B;  4D6T E;  2UWJ E;  5L8R J;  1M1J C;  2E76 C;  3CCS P;  1BE3 E;  2QJK C;  3F89 A;  1VQ6 P;  1LTJ C;  1SQV E;  3O6Q B;  3L75 G;  3C1L A;  5KTB A;  4IFF A;  3E1I A;  3SFE C;  5APT A;  1SQX J;  3L70 D;  1WT6 A;  4H0L C;  3CME P;  3V2P A;  3S4R A;  4U7J A;  4W80 A;  4M7H A;  5AW8 B;  1N2D C;  3PRJ A;  2ZYD A;  1EDI A;  5KAF E;  4NPF X;  2JHL F;  2O01 H;  2P1J A;  1JNM A;  2K1A A;  3M9H A;  2ZAE B;  5KAI E;  1YI2 P;  1J1E C;  1L0L J;  3HD7 C;  1GDT A;  3RK3 C;  1FZF A;  2K88 A;  2E42 A;  1NTM K;  3V2N A;  4UB8 E;  3C8V A;  1AA0 A;  4AUW A;  4EIJ A;  1GL2 D;  2IBZ D;  1Z3S A;  1Q90 D;  1HVV A;  3OW2 O;  1M1K Q;  3GHG B;  2VRS A;  1LJ2 A;  3TDK A;  2PGD A;  1SQX D;  1OX3 A;  3L37 A;  1PGJ A;  1RE3 C;  2HG5 D;  1G2C B;  3A3Y B;  3GG2 A;  1OFC X;  1L4A B;  2WSF J;  1PPJ D;  1FZA B;  1YIJ P;  3E7K A;  1N73 A;  4GT1 A;  3MTU E;  3U1A A;  3JSV C;  3S1K A;  3GMA A;  2FBW C;  3P7K A;  1L0L D;  5APU A;  4M3L A;  5APQ A;  5B5E H;  3ZDM A;  4NYT A;  3E1I C;  3M0D A;  1PIX A;  2IBZ G;  5BVZ A;  3TGU J;  1YIT P;  1NO4 A;  2Q3E A;  3AE9 C;  2IFN A;  2FKW B;  1NGM B;  5TIS H;  1CI6 B;  1GK6 A;  2Y0E A;  3D71 A;  3VMA A;  3VYI A;  4C7R A;  3BCC J;  2M8R A;  3FWL A;  4H13 B;  3IR9 A;  3PLN A;  4XFJ A;  1FZF C;  3VMY A;  1IFN A;  1SFC A;  2WTY A;  4PV1 D;  4DT0 A;  1LNQ A;  1G1J A;  1SQX K;  1LTI C;  1RE4 A;  2PFX A;  1VQ5 P;  2LXC B;  1PGP A;  3M0A A;  3GLM A;  2WSE J;  1KIL E;  3CWB E;  4EI2 A;  2J60 A;  2B88 A;  1IFD A;  3PH0 A;  4GOD A;  1ZW0 A;  5CHX A;  1L0L K;  1RF1 B;  1N7S B;  2AXC A;  3RGU A;  3TGU D;  1H88 A;  1SFC D;  3CXH E;  3JCU E;  1FZG A;  4PJ0 H;  2XDJ A;  4HKZ H;  3IFM A;  4U3F D;  2FYU K;  2JDI H;  1GZL A;  3BCC D;  1FDM A;  1P84 E;  1N73 C;  4O9B A;  3LIE A;  5GTI E;  3G4S P;  4JYC A;  3CCJ P;  2BCC J;  3CI9 A;  4I1L A;  2ZXX A;  1S3J A;  2FXM A;  1OW6 A;  1S72 P;  1VQP P;  1NTK J;  2W6B A;  2YMY A;  1VF5 B;  3L72 E;  1KYO D;  1K04 A;  3M0D C;  1S2E A;  2JHI F;  1SQB E;  3V5B A;  2YO2 A;  1QL2 A;  3CCE P;  4UB6 H;  1OMI A;  2QEX P;  2RKL A;  3S9O A;  1Q82 Q;  5B66 E;  3AE2 C;  3E1R A;  3GW6 A;  3B4S A;  1Q81 Q;  4JPZ B;  2HLO A;  2O1K A;  2WIT A;  2K9J A;  3TGU G;  1SVF A;  1X79 B;  4LLH A;  1U7J A;  3AE1 C;  1VQ9 P;  2N1T B;  3L71 E;  1SFC C;  1HJB A;  4U3F G;  3VOP A;  1RF0 B;  4ZFG A;  1FIB A;  3A0B H;  3O6Q A;  1KQL A;  5KLV E;  1RY3 A;  1RE4 C;  2YKO A;  4JZC A;  4W7Y A;  5CBO A;  1NAF A;  2KYV A;  4WY4 B;  1BGY J;  2A06 G;  3B5N B;  2BCC D;  4LC1 A;  2W6A A;  4I7Z C;  1NTK D;  1BCC G;  3FXE A;  3B71 A;  2Q3I A;  4N6J A;  3SFD C;  3Q5S A;  3OAK A;  1JTH B;  1FZG C;  5AW5 B;  1EQ7 A;  3BAT A;  1NTZ G;  3I5C A;  1LTS C;  3L74 G;  3FWN A;  4DJG A;  1SQP D;  2B9B A;  2J64 A;  3A5T A;  2WSC H;  4PD4 D;  1FZC B;  3H1I E;  1OIP A;  1D7M A;  1WRG A;  2Q7C A;  4C7N B;  3RL0 C;  2QIW A;  2V7Q J;  5AVX B;  2YXR B;  3V6I A;  2J0G A;  3RK3 E;  2KS1 B;  3A2A A;  1SQQ J;  4Y99 B;  3FX0 A;  1DD3 A;  2GA1 A;  3GHG A;  2BCC G;  3V4Q A;  5KKZ B;  1MZ9 A;  1G2C A;  1NTK G;  1L4A A;  2HLO C;  1TU3 F;  3W67 A;  4GDO A;  1FZA A;  2C9N Y;  2QJY B;  4GKG A;  3CLQ A;  1RQU A;  1PFI A;  4GOE A;  3EFF K;  2YKP A;  2JKV A;  2Z4E B;  3L71 J;  2Y0D A;  3L70 E;  2G3A A;  3SWK A;  1SQP G;  1KC8 Q;  1KTM A;  5CJ0 A;  1FZD A;  2FYN B;  1NU1 D;  1ZRT D;  1CI6 A;  1L4A D;  5K5G B;  1YTZ T;  3AEE C;  1K05 A;  4DOJ A;  1JO5 A;  3HUS B;  3CX5 H;  1T2K D;  5AW4 B;  2OYI A;  3C9I A;  1SQQ D;  4EYY Q;  4JYO X;  4OGQ D;  3TNU B;  1J1D B;  1LTA C;  1DIP A;  3L75 J;  1EDK A;  2NPS B;  2IBZ E;  1IFI A;  2ZYG A;  2LXB A;  2IFM A;  2Q9I A;  2P2U A;  1G1I A;  2FIB A;  1JB0 J;  1FDO A;  2WT7 B;  3Q1M A;  4AQR D; 
#chains in the Genus database with same CATH homology
 2YO3 A;  1M1J B;  2Q5U A;  4AYC A;  1ZR2 A;  3H32 B;  1SLQ A;  2O01 H;  2P1J A;  1JNM A;  1IJD B;  5CCH D;  3M9H A;  2L5G B;  5AW6 B;  2HOD C;  1J1E C;  3GHG C;  2Q9I B;  3HD7 C;  1GDT A;  1FJP A;  1FZB B;  3RK3 C;  1T8Z A;  1N7S A;  1FZF A;  1RF1 A;  1N86 B;  5CCG A;  1FU1 A;  1NTZ K;  5AVU B;  2E42 A;  1NTM K;  1URQ B;  3V2N A;  1L4A C;  2R32 A;  2I1K A;  5CJ4 A;  3U1C A;  1FZA C;  2OYH A;  1E5W A;  1LWU B;  4AUW A;  2KP8 A;  1NH4 A;  4EIJ A;  4M7F A;  1GL2 D;  1T2K C;  1FOS F;  1GU4 A;  2A45 G;  1Z3S A;  2HYN A;  4LGD E;  2XNX C;  1XTC C;  5AVR B;  2H43 B;  3SWY A;  1HVV A;  1FOS E;  2XV5 A;  3A7O A;  4IFM A;  2XU6 A;  1VDF A;  1SQQ K;  1IFJ A;  2HOD B;  3GHG B;  2VRS A;  3HD7 B;  2JEE A;  1N7S D;  3RK3 B;  1ZR4 A;  5CCG D;  1GD2 E;  3L37 A;  2JHH C;  1RE3 C;  3LW5 H;  2HG5 D;  1G2C B;  3A3Y B;  4DZO A;  3VP9 A;  1LT9 C;  2J58 A;  1L4A B;  1NTK K;  3HTK B;  1SP4 A;  1FZA B;  3WMM 0;  2J3U A;  1NHL A;  3HRN A;  2OYI C;  5KJ7 A;  4N78 E;  1N73 A;  4GT1 A;  3MTU E;  3U1A A;  5CCH C;  2ZXE B;  2XNX B;  2LKM A;  3P7K A;  5APU A;  2N1T A;  4M3L A;  2D39 A;  3VP8 A;  1SQP K;  1FAV A;  5APQ A;  2WPR A;  2KB7 P;  3MIW A;  1JY3 P;  3SWF A;  4NYT A;  1N73 B;  1RF0 A;  3E1I C;  1JCD A;  3M0D A;  2R5B A;  5BVZ A;  5KLV K;  1NO4 A;  1RE3 B;  2IFN A;  2FKW B;  3BVH A;  2GM4 A;  1CI6 B;  1GK6 A;  1LT9 B;  3EQ2 A;  2W27 A;  3OA7 A;  3RL0 D;  2Q9I C;  3R2P A;  4WY4 A;  1W2E A;  3VYI A;  3B5N A;  3M9Q A;  1SQV K;  5KJ7 D;  4C7R A;  1IO4 A;  4W7Z A;  2M8R A;  3P8C E;  2FFD A;  1JY3 N;  5AW9 B;  3IR9 A;  3HE4 B;  2J1G A;  2BAS A;  2N1T D;  1RF1 C;  1GL2 A;  1FZF C;  1GTW A;  5CCG C;  3VMY A;  1Z56 A;  3P32 A;  1FZE A;  3V2R A;  1IFN A;  1MV8 A;  4N78 D;  1SFC A;  2PP6 A;  3MD0 A;  2WTY A;  4WB4 A;  4XE5 B;  1JMM A;  5APY A;  3E1I B;  1HH0 A;  3B8E B;  2OYH C;  1G1J A;  1SQX K;  1T3J A;  1LTI C;  2J2P A;  1GL2 B;  1M7L A;  1RE4 A;  3M9B A;  5AVW B;  2A45 H;  2J61 A;  2KOG A;  2HPC A;  3M0A A;  1KFM A;  4RES B;  4WY4 D;  2HFE D;  2P67 A;  3B5N D;  2CPS A;  3TSI A;  1FZC A;  2J60 A;  1NOH A;  1LTJ A;  5CMZ A;  1IFD A;  2QM8 A;  2FYZ A;  1GU5 A;  2J61 B;  4OH8 B;  2YNY A;  2HPC B;  5CHX A;  1KIL A;  1GW4 A;  3VTP C;  1L0L K;  1RF1 B;  1N7S B;  1FZF B;  1NU1 K;  3M06 A;  2POH A;  4ZKP A;  3VMX A;  1H88 A;  3P8C D;  1SFC D;  2J59 M;  1XTG B;  4I6M C;  2WSF H;  3RK2 D;  1FZG A;  4WBA A;  1HGZ A;  3KQG A;  2XDJ A;  1JY3 O;  3IFM A;  2FYU K;  2OYH B;  1HWT C;  1NWQ A;  1GZL A;  1FIC A;  5KJ7 C;  5AW0 B;  1FDM A;  2J5Z A;  1N73 C;  4O9B A;  3LIE A;  4JYC A;  3L36 A;  2JHM F;  4N3Y B;  2R5D A;  2OAR A;  3CI9 A;  4I1L A;  5AVS B;  2FXM A;  3NFQ A;  1DX7 A;  2W6B A;  2Z4E A;  2YMY A;  1KIL D;  1RF0 C;  1DEB A;  2WZ7 A;  3M0D C;  2JHI F;  1LTT C;  3KPE A;  1MFZ A;  1T3U A;  2GUS A;  3V5B A;  3BVH C;  3OJA B;  2KLV A;  2YO2 A;  1QL2 A;  4IFD K;  5AW7 B;  3RL0 B;  1CZQ A;  2C0X A;  4C46 A;  4WY4 C;  5APW A;  5APX A;  1GK4 A;  3B5N C;  1OXZ A;  3VN0 A;  1IFM A;  3HE5 A;  1NKZ B;  2HLO A;  2FFD C;  1DH3 A;  2O1K A;  1JOC A;  1JCC A;  2WIT A;  3PP5 A;  1CSB A;  1SVF A;  1X79 B;  4LLH A;  3HUS A;  2N1T B;  5AW2 B;  1GL2 C;  1MUU A;  3V2Q A;  1FZE C;  2XZR A;  3CL3 D;  1SFC C;  1HJB A;  3VOP A;  1RF0 B;  3KDP B;  1VPC A;  3RK2 C;  3TNU A;  3H6P A;  4ZFG A;  1FIB A;  2J0Y A;  2ZFC A;  1LGH B;  3EFG A;  1KQL A;  1HUC A;  2NPS A;  2P7J A;  1KZU B;  1RY3 A;  1HBW A;  3L35 A;  1RE4 C;  2YKO A;  4JZC A;  3BVH B;  4W7Y A;  2WSE H;  4B86 A;  2J3G A;  2HPC C;  1NAF A;  2WPS A;  3FIB A;  2KYV A;  4WY4 B;  1N7S C;  3II6 A;  4R9J A;  3B5N B;  1FZC C;  4LC1 A;  2YKQ A;  1JTH A;  5AW3 B;  3NXS A;  1KFN A;  2IPP A;  2W6A A;  2FFD B;  3UIA A;  2WT7 A;  1KIL C;  4XA4 A;  4EPU A;  3NMD A;  1M1J A;  2Q3I A;  3H32 A;  1OWA A;  5APV A;  4N6J A;  1FZE B;  3OAK A;  1JTH B;  2N9B A;  1SFC B;  5BU8 B;  5AVT B;  2Z5H A;  3RK2 B;  1FZG C;  3N7N A;  5AW5 B;  3U59 A;  1FZB A;  1EQ7 A;  3BAT A;  4I2L C;  2XKM A;  2NPS D;  2C0W A;  1N86 A;  3I5C A;  1LTS C;  1JC9 A;  1AQ5 A;  4C7N A;  4ZKU A;  1RE4 B;  1S9K D;  1Z3U A;  1URQ A;  2WPQ A;  1NKN A;  2J64 A;  3A5T A;  2WSC H;  4EOT A;  2H8P D;  2CPB A;  2J3O A;  4GIF A;  3BAS A;  1FZC B;  1LWU A;  2O1J A;  2H7H A;  4R9T A;  1LTJ B;  1WRG A;  2Q7C A;  1IC2 A;  5APS A;  4C7N B;  3RL0 C;  2PAJ A;  5AVZ B;  5AVX B;  2Z4E C;  2GUV A;  2IX7 C;  2J0G A;  1FJK A;  1ZN5 A;  1KIL B;  4HH2 A;  2H43 A;  3A2A A;  3TK1 A;  1LTB C;  4Y99 B;  1QL1 A;  3KYQ A;  2HOD A;  3GHG A;  2E43 A;  3HD7 A;  1FZG B;  5BU5 A;  2N1T C;  5AVY B;  2I1J A;  3TYY A;  1HGV A;  3N4X A;  3V4Q A;  1FBM A;  3LID A;  1MZ9 A;  1G2C A;  4JYB A;  1URQ D;  3NTN A;  1JY2 P;  1L4A A;  2WWW A;  3HTK A;  2HLO C;  1J1E B;  1FZA A;  2C9N Y;  4GKG A;  2A45 I;  3HUS C;  3CLQ A;  1SQB K;  1A02 J;  1X9V A;  1PFI A;  3MUD A;  1H8A A;  3T97 A;  1J2J B;  2YKP A;  2Z4E B;  1YYC A;  2XNX A;  1A02 F;  1J1D C;  4JF7 A;  3BRV B;  3BRT B;  2NPS C;  1IK9 A;  2R3C A;  3HD7 D;  1FID A;  1L0N K;  1YTZ I;  1JY2 N;  3P8M C;  3RK3 D;  5CJ0 A;  3M91 A;  1FZD A;  2J3F A;  1N7L A;  5AVV B;  1HTL C;  1H89 A;  4HYT B;  5AW1 B;  1RE3 A;  2JHK F;  1S9K E;  3HE5 B;  1CI6 A;  1LT9 A;  1L4A D;  2C9L Y;  2JJL A;  2HLO B;  1YTZ T;  2KSJ A;  3V4W A;  4DOJ A;  1ZLL A;  1JO5 A;  3HUS B;  1M1J C;  3G3Z A;  1T2K D;  5AW4 B;  3H32 C;  2MJZ A;  3VMZ A;  3C9I A;  2OYI A;  4JYO X;  5CCH A;  1CW5 A;  3TNU B;  3HE4 A;  1J1D B;  1FZB C;  1LTA C;  3L4F A;  1LTJ C;  1N86 C;  2NPS B;  2Z5I A;  1IFI A;  1JUN A;  1X8Y A;  2OYI B;  2GY7 A;  5KTB A;  1URQ C;  3E1I A;  4IFF A;  1ZV8 A;  5APT A;  2J3F D;  4KHX A;  2IFM A;  1WT6 A;  1LWU C;  4Y99 C;  3V2P A;  2QM7 A;  4W80 A;  4M7H A;  5AW8 B;  2WNP F;  1N2D C;  1LTG C;  5AVQ B;  1GW3 A;  2P2U A;  2Q9I A;  1G1I A;  2FIB A;  2M3B A;  1AFO A;  2WT7 B;  2J0H A;  2H43 C;  3O8Z A;  1JY2 O;  2JHL F;  3MGN A;  4AQR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...