1LTJC

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ltjC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ltjC02
1JY2N 1LTJC 3HUSA 2JHIF 2HPCC 1FZFB 2J5ZA 1M1JC 3H32B 2OYHC 1FZAC 1FZBA 1FZDA 1LWUA 1RF1C 3E1IA 1FZCC 2Z4EA 3BVHB 1FZEA 1Z3SA 2JHMF 1FZGB 2OYIC 2J0HA 2J3FA 2Q9IC 2HODA 3HUSC 2FFDB 2H43B 1FZBC 2J3GA 4JYOX 1Z3UA 1LWUC 2Z4EC 1FZEC 1N73B 2J61B 2J0YA 2J64A 2JHHC 1RF0A 2HODC 2A45G 2A45H 4EPUA 1JY3O 3FIBA 1T3UA 4R9TA 3GHGB 1JY2O 2J3UA 4M7FA 1RE3B 2XNXB 1LT9B 1RF0C 2HLOA 1N86A 2WNPF 1FIDA 1FZFA 2J2PA 3H32A 3E1IC 1RE4B 3BVHA 2J60A 4JZCA 2GY7A 2JHKF 1JC9A 1LTJB 2HPCB 2HLOC 1FZGA 1N86C 1M1JB 2OYHB 1W2EA 2A45I 1FZAB 1JY3P 1FZFC 2H43A 2FFDA 1RF1B 3H32C 1FZCB 1JY2P 1FIBA 3BVHC 2OYIB 2J3FD 2J61A 1N73A 2Q9IB 3HUSB 1FZGC 2JHLF 1FZBB 2J3OA 2FFDC 2H43C 1LWUB 2J1GA 2Z4EB 1FZEB 3GHGA 4ZFGA 1N73C 2HODB 1RE3A 2XNXA 1LT9A 2J0GA 1FICA 1N86B 3GHGC 1RE4A 1RF0B 2FIBA 1RE3C 4R9JA 4NYTA 2XNXC 1LT9C 1LTJA 2HPCA 1M1JA 1FZAA 2OYHA 2D39A 3E1IB 1RF1A 1FZCA 1JY3N 4M7HA 1RE4C 2HLOB 2OYIA 2Q9IA
chains in the Genus database with same CATH superfamily
3AE9C 5APQA 1FZBA 1BE3G 3B5NB 3RK3C 2IDBA 1VF5B 2GUSA 3D6YA 3N4XA 1LWUC 1BSHA 3A0HH 3H1JE 2Q7CA 2H7HA 3CWBE 2QEXP 3AEFC 2QM8A 2IX7C 4BXLA 2ZT9D 3EWKA 1FIDA 2JWAA 1BCCJ 3H1HE 5EFWB 1RE4B 4JZCA 2ZVOB 1HGZA 1SQBJ 2HLOC 1KQFB 1EDKA 2FYUK 1H89A 4DJGA 1QL2A 3BRTB 3A0HE 2ZYDA 1KMIZ 2KUBA 1YTZI 4I7ZC 2YMKA 3EQ2A 1EDLA 2O01J 2FYUE 5AVRB 1VQ8P 1VQNP 1MFZA 1G1JA 1J1EB 1Y47A 1RE4A 2AXCA 5BU5A 1Q2NA 2H8PD 1NAFA 1LJ2A 4RKUJ 1JY2N 4PJ0H 1M1JC 3H32B 4UB8H 3E1IA 2QE7H 3BVHB 2BCCJ 1Z3SA 1FS0E 1LTTC 4U3FG 1OIPA 2JKVA 1SQBG 4K3AA 3G4SP 2XDJA 1R5LA 1FZEC 2D2CC 2JHHC 3H1LG 5KLIB 1DH3A 2FYZA 3M0DC 4C7RA 2XNXB 3TF5A 3HE5B 3AE2C 5AW8B 3H32A 1KILC 2B87B 3M9BA 1HJ0A 1N7SC 2FXOA 3BVHA 3EFFK 1FC2C 1JC9A 2HPCB 5CHXA 1W5CE 5B66H 1RF1B 1YIJP 1DD4A 3H1IJ 4XFJA 3HD7C 1FZGC 2BCCE 2JEEA 2E5YA 4GT1A 3AE8C 3KXDA 3L75D 1SQQJ 3RK2C 2XNXA 1GL2D 3MD0A 3HE5A 2QRXA 1HVVA 2RKLA 1IFMA 5KKZC 2B87A 2NPSB 4N78E 2HPCA 1K04A 1SQPJ 3OJAB 1CI6B 1RF1A 4GKGA 2JHIF 4GIFA 1GW4A 3CC7P 3V2PA 3TK1A 3FWLA 1GDTA 5GTHE 1P84E 2OTLP 2M5AB 3MGNA 2B9BA 1GL2B 1FZBC 1Z3UA 1ZRTE 3CXHI 1USEA 5CJ4A 3H1KD 2NPSA 1SQXD 4HB1A 3CX5D 1PP9G 4IL6E 1Q90D 4OH8B 1LTAC 1LTSC 2XU6A 1JY2O 1SQQE 1CI6A 4H44C 2E75D 2IBZI 4H0LB 1M90Q 1QVFO 1GW3A 1SQVJ 1JOCA 3L36A 1JM0A 2KSEA 1NJIQ 1JEKA 5TISE 2KLUA 2CK3H 2M5AA 1SQPG 3AE3C 1GL2A 3PJSK 4R4MA 1DX7A 1GK6A 1VF5C 1G2CB 1D7MA 5AVXB 1PFIA 4NPEA 3L72J 2Q3IA 2DW3A 5GTIE 1AA0A 4BRYB 4AUWA 1SQVK 3BASA 2HG5D 5KJ7A 1OX3A 3P8CE 3L70D 5KLVD 4IFDK 3IAOA 1RE4C 3SSUA 1SQVE 2E42A 1L0NJ 1YITP 1G2CA 4Y99B 2WSEH 2WSFJ 3PLNA 3L75G 3R4YA 4BRYA 2PFXA 2A45G 1PGQA 3E1RA 5APWA 2WITA 3H25A 3L72E 1J1EC 2ZFCA 3CMEP 1NGMB 3V6IA 1NTKJ 2J58A 1S3JA 1CZQA 1WRGA 3CX5H 3AEAC 3Q3DA 2XNDH 3M0AA 1L0NK 2ZVNB 1JMMA 1X8YA 2JP3A 1TU3F 3TGUJ 2OYHB 1XTGB 4L73A 3H32C 2R44A 4I1LA 4LLHA 1Z56A 3BCCD 3BVHC 1L0NE 2D2CD 2Q9IB 3H1KG 1SQXG 1EZVG 2MKVA 2Z4EB 4EI2A 1PPJE 1FDMA 3TDKA 1KILD 5KLIC 3PHLA 5AW3B 1N7SD 2A06D 3MUDA 2XNXC 4IFMA 2NRGA 2OYHA 3D71A 1BE3D 3L74E 4YXDC 3HD7D 2Q9IA 2KYVA 1FZFB 2HPCC 1ZN5A 4D6TJ 1RF1C 2JO1A 2Z4EA 5KAFH 2JHMF 1S1CX 3RK2D 3CLQA 1URQB 3TGUG 3I55P 1GTWA 2K3RA 3HTKB 2WPQA 3GF7A 3CWBD 3V2RA 1VQ7P 2J0YA 3LIDA 2HFED 2QM7A 4R9TA 2QG4A 3H1HD 2NPSC 3HD7B 1L0LD 4ASWA 3C8VA 2L5GB 1FZFA 1VL2A 1X9VA 1URQA 2YMYA 3HTKA 2IFNA 2WSCJ 2R32A 1QLED 1YBKA 1T8ZA 1IJDB 3HUSB 2K9YA 4GOFA 3GMAA 3I5CA 4UB6E 4D6TG 3CPWO 1N8RQ 1GL2C 1BSNA 1K9MQ 4H44D 2YO3A 4EYYQ 4PD4D 1LP1B 3CCMP 1KC8Q 1FOSE 2PRRA 1IK9A 2YO2A 2H88C 3L4FA 2WSSH 4H0LC 2ZXXA 1OW8A 1BCCD 3F5HA 1T3JA 1AJYA 1IFJA 1YHQP 4JQ0D 2ITAA 4KT0J 1W2BO 1DEEG 1SQBD 3ITKA 1NTMK 3L73G 1PGOA 4PV1B 3HUSA 5KJ7C 2J5ZA 3P32A 2QIWA 1HH0A 3K5BA 3H1LD 2FFDB 1LP1A 1YI2P 2L91A 3AE1C 1N73B 5C39A 3VOPA 2A06G 4L75A 1H0TA 1KQSO 2B89A 3QWOC 2QJPB 3WU2H 2M8RA 2SPZA 2FYUJ 2LR2A 1EQ7A 2KB7P 3QH9A 1U7JA 3Q5PA 3H1JG 1W2EA 3O8ZA 2FFDA 3FX0A 2IPPA 1L2PA 3CWBG 4Y99C 2BCCD 3JCUE 2QJKB 3NTNA 1N73A 3CXHE 2IYPA 5CCGA 4YTPC 1A02J 3CX5I 1JB0J 4W7ZA 1Q7YQ 3H1HG 3KYQA 3JC22 3CCLP 1L0LG 1LTGC 3U1AA 2J0GA 3L71J 3SWKA 4N78D 2C9LY 2W8ZA 2IBZE 1KD1Q 1N7LA 1KFNA 4IFFA 1BDCA 4H13B 3E1IB 1QX8A 3WUUA 1YJWP 1L4AD 3MUDC 1LGHB 1HF9A 5AVQB 4AYCA 3CCRP 2RH0A 2FYUG 1NTZJ 2M3EA 2OYHC 2JR8A 1PGJA 2FXPA 4HH2A 2PGDA 3H1ID 4GODA 1KQLA 1J2JB 1AQ5A 5AVVB 1S4XA 2Q9IC 5DJTB 1JUNA 2G3AA 2O1KA 1PP9D 3NFQA 5AVSB 5AW7B 1NU1K 1ZW0A 2KZIA 4WVZA 2Z4EC 5K5GB 1SQQD 2Q3EA 1QVGO 3NXSA 3VMAA 1BCCG 1OXZA 1NU1E 1T3UA 4RESB 1E5WA 1IZNB 1L4AB 1LT9B 3L71E 4YXWH 2YKOA 1SQPD 1CSBA 3RBXA 2FBWC 3JSVC 1NTZK 2KP8A 2O01N 1FZAB 1FZFC 3WUVA 1VQ4P 1NTZE 1A02F 1URQC 5AW6B 1JMBA 3V2QA 1SFCB 4PJ0E 2NPSD 3KHUA 1L4AA 4UB8E 2OARA 1LT9A 2K37A 3V5BA 4YPCA 3V4WA 3CL3D 1MZ9A 2KZJA 4R9JA 1KYOD 4NYTA 3AE5C 3AEBC 2W6AA 1FZAA 3G9RA 1AV1A 2BCCG 3S1KA 2C9NY 2Y9ZA 4GOEA 1FU1A 4KHXA 4KJMA 3M91A 5KAIH 4JYCA 5AVWB 3Q5RA 1ZXGA 1SFCA 2ZAEB 3HUSC 3ABVC 1OW6A 4C7NB 3A3YB 2YXQB 2J61B 1Q86Q 4R4LA 5B66E 4H0LD 1NH4A 5H2FH 3UIAA 2Q1KA 2C0XA 1MFTA 2KS1B 1GK4A 5KJ7D 3SWYA 2O1JA 1U57A 5DJUB 1FDOA 3GW6A 3VMZA 2P58A 1SLQA 2WMMA 3VMXA 3H1IG 4L74A 2E76B 4PV1C 3CMAP 1EZVD 1GMJA 4C7NA 3M9HA 3S4RA 2J61A 1SQQG 2FFDC 3MP7B 1EDJA 5H2FE 1N73C 2KS1A 1HWTC 2J59M 2IZ0A 2Y9YA 5CCGC 2JJLA 3HRNA 4O9BA 3D6ZA 2QA4P 4LC1A 2QJPC 1NTKD 2WVRA 3TGUD 2WPVB 1M56D 4U7JA 1KYOH 3P7KA 2V7QH 4ASVA 2Y0DA 4A7PA 4HJGH 1KQGB 2QJKC 4RO0A 3OAKA 4PD4I 3H6PA 2J3GA 2WSEJ 1KTMA 1NWQA 1LT1A 4NPDA 2FXMA 2A45H 1RH5B 3CI9A 1N2DC 2YKQA 1SQVG 5CMZA 2WZ7A 3GHGB 1SS1A 1ZV8A 3CCSP 4H13C 3FXEA 3TYYA 3E1IC 2WPSA 5B5EH 1LTJB 1S2EA 3EFGA 4CPGA 3USSA 4D6TD 1PZQA 2QJYB 3SFDC 1OWAA 3L72G 3L74J 1AVOA 3BRVB 2POHA 1VDFA 1VQPP 3GHGA 4Y28J 3VYIA 2P10A 1NAYA 1UIXA 2R3CA 5CCHA 3B8EB 1FICA 3AE4C 3W68A 4IOIH 2V4HA 1L4AC 3L73D 4GDOA 1LT9C 1K8AQ 1LTJA 1KB9D 3VP9A 1L0NG 3CCJP 1CW5A 1SQXK 3AE6C 1URQD 1PPJG 1MV8A 5AVZB 1FZAC 3BATA 3G71P 1H8AA 2KLVA 1VPCA 4TT3H 2W6JH 3CX5E 1JO5A 1S9KD 1GU4A 2E5TA 4NPFX 4JYOX 2BEZF 5KLVJ 2I8DA 1SFCC 3PTZA 4I6MC 4JYBA 1NTKG 3IFMA 4DCKA 4WWIA 3RK3E 4EDFA 4W7YA 1HTLC 1BGYJ 3H1JD 3KZIH 3TSIA 3IF4A 4JPZB 3VP8A 1EXIA 3MTUE 3FWNA 3II6A 4AQRD 3CC4P 2CPSA 1FZCB 2XKMA 5KLVK 2JHLF 3KDPB 2I1KA 3TNUB 1KV4A 2E43A 2Q5UA 4ZFGA 3L70E 4OWFA 5KAFE 5KLVE 5APVA 3CD6P 2KIKA 1NTMJ 2C0WA 2VRSA 1RF0B 2FIBA 2P67A 2FYUD 4PV1D 2N9YB 1BGYE 1ZR2A 1FZCA 4M7HA 2HYNA 3P8MC 2GUVA 1JNMA 2ZYAA 2E76C 3LW5J 3M9QA 5CJ0A 1KB9H 2E74B 2P2UA 3R2PA 2ZJSE 3TNUA 3F89A 5AW4B 5CCGD 1OMIA 5APSA 1H0TB 2Z5IA 4N3YB 4DZOA 2J64A 2ZYGA 1VQOP 1RF0A 1KYOI 5E79H 3V2NA 3HE4B 2KSJA 1JTHB 2K9JB 2H89C 3O6QB 1NTME 3BCCE 1HJBA 1KORA 2A45I 2XZRA 4IL6X 1IFNA 3AEEC 1FIBA 3CC2P 1IC2A 2RMZA 2OYIB 4C46A 1KILE 3D70A 4JF7A 3RL0g 2Y0CA 2KI7B 2A06E 2YNYA 1DIPA 3PP5A 3HE4A 1J1DB 1JTHA 2K9JA 4XE5B 5AW1B 3O6QA 2ZXEB 1BE3E 1LTBC 2MJZA 4H13D 3WUTA 3GHGC 2YKPA 3RL0B 2LKMA 4DOJA 5CCHC 1EZVI 2N1TA 3OA7A 1NU1J 2OYIA 1N86B 1LTJC 3WU2E 3A0BH 3CCUP 1L0LK 2QJYC 3PH0A 1JCDA 1PL5A 1M1KQ 2IBZG 2J3FA 4PD4H 2BEQD 1L0LE 3FGAD 3B5NA 4U3FJ 1P84D 4B86A 2KXPB 1ZRTD 2AEMA 1RE3B 3C1LA 1MKMA 1VQKP 3RGUA 1VQLP 2J5UA 1N86A 1GU5A 3VN0A 3H1LJ 5APXA 3A0BE 2J60A 2NZ2A 2ZT9B 1JY3P 3AE7C 4WY4D 1NKZB 2IZ1A 4PD4E 1SFCD 2O01H 1NU1G 2AEFA 1IFDA 3L71G 1SQBK 4I2LC 3I56P 1NOHA 4WBAA 1BCCE 4ZKUA 1RE3A 5CBOA 5AW9B 4M3LA 1AFOA 1NVOA 4U3FE 1SQBE 4BWNA 1S5LX 2WQYC 1Y8AA 1NTZG 3IR9A 3AECC 1M8OB 5TJHA 4WY4B 4MN4C 4L76A 3H1LE 3KPEA 5KTBA 1RQVA 1T6AA 1RY3A 3V4QA 1Q82Q 1FZDA 5BVZA 3AEDC 1FZCC 1OZHA 5M1BA 1PGPA 2O3JA 3GG2A 3P8CD 5AVYB 1NYHA 1SQVD 1GD2E 1X0TA 1VQ5P 2M3BA 1E79H 3NMDA 1KB9I 3FIBA 3SWFA 4WY4A 3A2AA 2YIUB 1RF0C 2E76D 1PP9J 3GF3A 3N7NA 5GTHH 1PIXA 2J2PA 1P84H 5L8RJ 1X22A 3L72D 1IK7A 2E74C 4IL6H 1OVVA 1KN7A 3IN6A 1DD3A 2J3OA 1ZOYC 2M0BA 2J1GA 1YQ3C 4OGQD 2HODB 5KAIE 1L0ND 2Y0EA 3Q1MA 4ZKPA 2K1AA 2KNCB 5TISH 1YJNP 3G6EP 1PPJD 2PAJA 2CPBA 2YXRB 1SQQK 3H1IE 2KOGA 3A7OA 1PP9E 2IFMA 2Q6QA 3U1CA 3MHVA 2FYNB 5AW0B 1HUCA 1VQMP 5GTIH 1SQPK 2N1TC 3VTPC 5APUA 1LTIC 1ZP0C 1BDDA 2OYIC 4OGQB 3L74D 2HODA 2H43B 2LXCB 4WB4A 2V7QJ 3Q2YA 3RK3D 2KNCA 1J1DC 1EC5A 1SQPE 3L75J 1NKNA 3ZDMA 5CCHD 1YJ9P 4EIJA 1PV3A 3OW2O 1HGVA 2QSIA 4Z1MH 2J3UA 3B5NC 4M7FA 1OVUA 5APTA 2N9BA 1KFMA 1U7MA 1K05A 1NO4A 3RL0C 3L37A 2WNPF 2JDIH 3SFEC 1T2KC 2I1JA 1ZR4A 1FAVA 2OGUA 2E75B 1ZMEC 2GY7A 2JHKF 1N86C 2H43A 3RK3B 3KQGA 4EOTA 3LIEA 2OTJP 3B4SA 2AEJA 1LWUB 1RQUA 2R3SA 1KYOE 1KZUB 3H1KJ 2GA1A 1SQXJ 3T97B 3MIWA 1QEXA 2WTYA 2R5BA 1DEBA 3L75E 1BGYD 1M57D 1OFCX 1RE3C 1MUUA 1IFIA 1H88A 2FY8A 5CBNA 1SVFA 1S5LH 1SP4A 3WMM0 1JY3N 1RHZB 2WSFH 2HLOB 1AQTA 5AVUB 1LNQA 1K73Q 4OVNF 2ZT9C 1WMKA 3RBZA 2XV5A 1XTCC 1LWUA 2R5DA 3VMYA 1X79B 3AEGC 2JWDA 2J0HA 4I7ZB 3T97A 1AVYA 1YTZT 5B5EE 4DT0A 3B71A 1VQ9P 2G8YA 4QMAA 2WWWA 1USDA 2K88A 4EPUA 2HR3A 1JCCA 2AXTH 3Q5SA 1QGKB 1NTMD 3W67A 3H1KE 1EXJA 2GM4A 4TLFA 1Q81Q 1M7LA 1S5LE 1SQXE 3M06A 1EZVE 2HLOA 1GZLA 2WT7B 4K35A 1QL1A 3L70J 4WY4C 1FBMA 1M1JB 3L74G 1NTKK 2PP6A 1JY2P 2P7JA 1P84I 1ZLLA 1FZEB 1NHLA 1NTKE 2D2CB 2AXTE 3G3ZA 1R8EA 1FDIA 4ZNCA 3CXHD 3L35A 2WT7A 3TGUE 1YQ4C 2BASA 2W6BA 1IO4A 1FE6A 2YIUC 4RJTA 1M1JA 2E74D 1KILB 1WT6A 2KK7A 2P1JA 1N7SB 2RN0A 4UB6H 2IBZD 4N6JA 2OTKE 2WPRA 3A5TA 3L70G 4W80A 5KLVG 1FZEA 3BCCJ 3KZIE 3L73J 1Y9BA 1FZGB 5APYA 2OQQA 3CCEP 3S9OA 2Z5HA 3PRJA 3M0DA 1S72P 2B88A 3MZWB 3RK2B 3FXDA 1BGYG 2HODC 1JY3O 4XA4A 5KKZB 1G1IA 1KILA 3C9IA 1N7SA 4D6TE 1UIIA 3CCVP 1IFPA 2LXBA 2OYOA 4HKZH 2WSCH 1BE3J 2N1TD 2IYOA 5AW5B 1NU1D 1OVRA 3HD7A 1FZGA 1HBWA 2FYNC 2UWJE 1VQ6P 1YYCA 3L71D 2W27A 2J3FD 4LGDE 1R5SA 3H1JJ 4OGQC 1FZBB 3LW5H 2H43C 1FJPA 1FJKA 3L73E 3CWBJ 5AW2B 3B5ND 1NTMG 3BCCG 2FKWB 1KB9E 1VF5D 4U3FD 3RL0D 4HYTB 3E7KA 2QVAA 1NTZD 5BU8B 1T2KD 3U59A 5AVTB 4H44B 2N1TB 3H1HJ 3CCQP 2W90A 1L0LJ 2W83C 3JCUH 1FOSF 4ZMDA 1OW7A 2D39A 3CXHH 5E79E 4JBZA 1EDIA 1S9KE 3GLMA 2E75C
chains in the Genus database with same CATH topology
2KYVA 1RY3A 3V4QA 1ZN5A 3P7KA 2HPCC 1FZFB 5APQA 1FZBA 1FZDA 5BVZA 1RF1C 1FZCC 2Z4EA 3B5NB 3RK3C 2JHMF 3P8CD 3RK2D 3CLQA 1URQB 2GUSA 1GTWA 3OAKA 3HTKB 2WPQA 3H6PA 5AVYB 2J3GA 3N4XA 1LWUC 3V2RA 1GD2E 1NWQA 2J0YA 3LIDA 2Q7CA 2H7HA 2M3BA 2FXMA 3NMDA 2A45H 2HFED 3CI9A 2QM7A 1N2DC 2YKQA 5CMZA 3FIBA 4R9TA 2WZ7A 3GHGB 3SWFA 4WY4A 3A2AA 2NPSC 1ZV8A 2QM8A 2IX7C 3HD7B 1RF0C 3N7NA 2L5GB 1FIDA 1FZFA 2J2PA 3TYYA 3E1IC 1X9VA 2WPSA 1RE4B 4JZCA 1HGZA 1LTJB 3EFGA 2HLOC 1URQA 2YMYA 3HTKA 2IFNA 2R32A 2FYUK 1H89A 1T8ZA 1OWAA 1QL2A 1IJDB 3BRTB 3HUSB 2J3OA 3I5CA 3BRVB 1YTZI 1GL2C 2J1GA 2POHA 3EQ2A 1VDFA 2YO3A 3GHGA 5AVRB 3VYIA 2HODB 2R3CA 5CCHA 3B8EB 1FOSE 4ZKPA 1FICA 1IK9A 1MFZA 1G1JA 2YO2A 1J1EB 1RE4A 3L4FA 5BU5A 1L4AC 2PAJA 1LT9C 1LTJA 2H8PD 3VP9A 1NAFA 2CPBA 1T3JA 1SQQK 1IFJA 1CW5A 1SQXK 2KOGA 3A7OA 2IFMA 1URQD 1NTMK 3U1CA 1JY2N 1MV8A 3HUSA 5AVZB 5KJ7C 2J5ZA 1M1JC 3H32B 1FZAC 5AW0B 3BATA 1HUCA 3P32A 1H8AA 3E1IA 2KLVA 1VPCA 3BVHB 1SQPK 2N1TC 1Z3SA 3VTPC 5APUA 1LTTC 1JO5A 1LTIC 1HH0A 2OYIC 2HODA 2FFDB 2H43B 1S9KD 1GU4A 2XDJA 4JYOX 4WB4A 3RK3D 1FZEC 1N73B 1J1DC 1SFCC 4I6MC 3VOPA 2JHHC 4JYBA 1NKNA 5CCHD 3IFMA 4EIJA 1DH3A 4W7YA 2FYZA 1HGVA 3M0DC 4C7RA 2J3UA 4M7FA 3B5NC 1HTLC 5APTA 2N9BA 1KFMA 2M8RA 2XNXB 3HE5B 1NO4A 3RL0C 3L37A 2WNPF 1EQ7A 5AW8B 3TSIA 3H32A 2KB7P 1T2KC 1KILC 2I1JA 1ZR4A 3M9BA 1FAVA 3VP8A 1N7SC 3BVHA 2GY7A 2JHKF 1JC9A 2HPCB 3MTUE 1N86C 1W2EA 3II6A 5CHXA 4AQRD 3O8ZA 2H43A 2FFDA 2CPSA 1RF1B 1FZCB 2IPPA 2XKMA 3RK3B 4Y99C 3KQGA 3NTNA 1N73A 4EOTA 3LIEA 3HD7C 1FZGC 5KLVK 2JHLF 5CCGA 1A02J 1LWUB 3KDPB 2JEEA 2I1KA 3TNUB 4W7ZA 2E43A 2Q5UA 1KZUB 4GT1A 4ZFGA 3KYQA 3RK2C 2XNXA 1GL2D 3MD0A 3HE5A 3MIWA 1LTGC 3U1AA 2J0GA 1HVVA 5APVA 4N78D 2WTYA 2C9LY 1IFMA 2R5BA 1DEBA 2C0WA 1N7LA 2NPSB 1KFNA 2VRSA 1RF0B 4IFFA 2FIBA 1RE3C 1MUUA 1IFIA 2P67A 1H88A 4N78E 2HPCA 1SVFA 1SP4A 3OJAB 3WMM0 3E1IB 1CI6B 1RF1A 4GKGA 1ZR2A 1FZCA 1JY3N 4M7HA 1L4AD 2HYNA 3P8MC 2GUVA 1JNMA 1LGHB 2WSFH 5AVQB 4AYCA 2HLOB 5AVUB 2JHIF 3M9QA 5CJ0A 2OYHC 2XV5A 4GIFA 4HH2A 2P2UA 1XTCC 1GW4A 1LWUA 2R5DA 3VMYA 3R2PA 3V2PA 3TK1A 1X79B 3TNUA 1KQLA 1GDTA 1J2JB 1AQ5A 5AVVB 2J0HA 5AW4B 5CCGD 2Q9IC 1JUNA 3MGNA 2O1KA 3NFQA 5AVSB 1GL2B 5APSA 1FZBC 5AW7B 1NU1K 3T97A 1Z3UA 2Z5IA 1YTZT 2Z4EC 4N3YB 4DZOA 5CJ4A 2WWWA 2J64A 2NPSA 1RF0A 4EPUA 3NXSA 1JCCA 3V2NA 3HE4B 1LTAC 1LTSC 1OXZA 2KSJA 1T3UA 2XU6A 4OH8B 4RESB 1JY2O 2GM4A 1CI6A 1JTHB 1E5WA 1M7LA 1L4AB 3M06A 1LT9B 2HLOA 2YKOA 1GZLA 1GW3A 1CSBA 2WT7B 1QL1A 1JOCA 3L36A 4WY4C 1NTZK 1HJBA 2KP8A 1FBMA 1M1JB 1FZAB 2A45I 2XZRA 1FZFC 1GL2A 1NTKK 1IFNA 1DX7A 2PP6A 1JY2P 1FIBA 1IC2A 2OYIB 4C46A 1A02F 1GK6A 1URQC 5AW6B 1G2CB 4JF7A 2P7JA 2YNYA 5AVXB 3PP5A 3V2QA 1ZLLA 3HE4A 1FZEB 1NHLA 1J1DB 1SFCB 2NPSD 1JTHA 1PFIA 4XE5B 5AW1B 3G3ZA 1L4AA 2OARA 2Q3IA 1LT9A 2ZXEB 1LTBC 2MJZA 3V5BA 3L35A 2WT7A 3V4WA 4AUWA 3GHGC 2BASA 3CL3D 2YKPA 1MZ9A 1SQVK 2W6BA 1IO4A 3BASA 3RL0B 4NYTA 4R9JA 2LKMA 2HG5D 4DOJA 5KJ7A 5CCHC 2W6AA 1M1JA 1FZAA 1KILB 3P8CE 1WT6A 2P1JA 1N7SB 2N1TA 4IFDK 1RE4C 3OA7A 2C9NY 2OYIA 1N86B 1FU1A 1LTJC 2E42A 4KHXA 4N6JA 2WPRA 1G2CA 3A5TA 3M91A 4JYCA 1L0LK 4W80A 4Y99B 2WSEH 5AVWB 1JCDA 1FZEA 1SFCA 1FZGB 5APYA 2J3FA 3HUSC 2Z5HA 4C7NB 3A3YB 3M0DA 2J61B 3B5NA 3RK2B 1NH4A 2A45G 2HODC 1JY3O 4XA4A 5APWA 2WITA 3UIAA 1G1IA 4B86A 1KILA 3C9IA 2C0XA 1J1EC 2ZFCA 1N7SA 1RE3B 1GK4A 5KJ7D 3SWYA 2J58A 1N86A 1CZQA 2O1JA 3VN0A 1GU5A 1WRGA 3VMZA 3M0AA 2WSCH 2N1TD 1L0NK 5APXA 5AW5B 1SLQA 1JMMA 2J60A 3VMXA 1X8YA 3HD7A 1FZGA 1HBWA 2OYHB 1JY3P 1XTGB 1YYCA 4WY4D 3H32C 1NKZB 4I1LA 4C7NA 4LLHA 1SFCD 1Z56A 2W27A 3M9HA 2O01H 3BVHC 2J3FD 2J61A 2Q9IB 4LGDE 1IFDA 1FZBB 3LW5H 2FFDC 2H43C 1FJPA 1SQBK 2Z4EB 1FJKA 5AW2B 3B5ND 4I2LC 1NOHA 2FKWB 1N73C 4WBAA 1HWTC 2J59M 3RL0D 1RE3A 4ZKUA 5AW9B 4HYTB 5CCGC 5BU8B 4M3LA 1AFOA 1FDMA 1T2KD 1KILD 3U59A 5AVTB 2JJLA 3HRNA 4O9BA 5AW3B 1N7SD 2N1TB 4LC1A 3MUDA 2XNXC 4IFMA 1FOSF 3IR9A 2OYHA 2D39A 4WY4B 1S9KE 3HD7D 3KPEA 5KTBA 2Q9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 N;  1LTJ C;  3HUS A;  2JHI F;  2HPC C;  1FZF B;  2J5Z A;  1M1J C;  3H32 B;  2OYH C;  1FZA C;  1FZB A;  1FZD A;  1LWU A;  1RF1 C;  3E1I A;  1FZC C;  2Z4E A;  3BVH B;  1FZE A;  1Z3S A;  2JHM F;  1FZG B;  2OYI C;  2J0H A;  2J3F A;  2Q9I C;  2HOD A;  3HUS C;  2FFD B;  2H43 B;  1FZB C;  2J3G A;  4JYO X;  1Z3U A;  1LWU C;  2Z4E C;  1FZE C;  1N73 B;  2J61 B;  2J0Y A;  2J64 A;  2JHH C;  1RF0 A;  2HOD C;  2A45 G;  2A45 H;  4EPU A;  1JY3 O;  3FIB A;  1T3U A;  4R9T A;  3GHG B;  1JY2 O;  2J3U A;  4M7F A;  1RE3 B;  2XNX B;  1LT9 B;  1RF0 C;  2HLO A;  1N86 A;  2WNP F;  1FID A;  1FZF A;  2J2P A;  3H32 A;  3E1I C;  1RE4 B;  3BVH A;  2J60 A;  4JZC A;  2GY7 A;  2JHK F;  1JC9 A;  1LTJ B;  2HPC B;  2HLO C;  1FZG A;  1N86 C;  1M1J B;  2OYH B;  1W2E A;  2A45 I;  1FZA B;  1JY3 P;  1FZF C;  2H43 A;  2FFD A;  1RF1 B;  3H32 C;  1FZC B;  1JY2 P;  1FIB A;  3BVH C;  2OYI B;  2J3F D;  2J61 A;  1N73 A;  2Q9I B;  3HUS B;  1FZG C;  2JHL F;  1FZB B;  2J3O A;  2FFD C;  2H43 C;  1LWU B;  2J1G A;  2Z4E B;  1FZE B;  3GHG A;  4ZFG A;  1N73 C;  2HOD B;  1RE3 A;  2XNX A;  1LT9 A;  2J0G A;  1FIC A;  1N86 B;  3GHG C;  1RE4 A;  1RF0 B;  2FIB A;  1RE3 C;  4R9J A;  4NYT A;  2XNX C;  1LT9 C;  1LTJ A;  2HPC A;  1M1J A;  1FZA A;  2OYH A;  2D39 A;  3E1I B;  1RF1 A;  1FZC A;  1JY3 N;  4M7H A;  1RE4 C;  2HLO B;  2OYI A;  2Q9I A; 
#chains in the Genus database with same CATH topology
 3AE9 C;  5APQ A;  1FZB A;  1BE3 G;  3B5N B;  3RK3 C;  2IDB A;  1VF5 B;  2GUS A;  3D6Y A;  3N4X A;  1LWU C;  1BSH A;  3A0H H;  3H1J E;  2Q7C A;  2H7H A;  3CWB E;  2QEX P;  3AEF C;  2QM8 A;  2IX7 C;  4BXL A;  2ZT9 D;  3EWK A;  1FID A;  2JWA A;  1BCC J;  3H1H E;  5EFW B;  1RE4 B;  4JZC A;  2ZVO B;  1HGZ A;  1SQB J;  2HLO C;  1KQF B;  1EDK A;  2FYU K;  1H89 A;  4DJG A;  1QL2 A;  3BRT B;  3A0H E;  2ZYD A;  1KMI Z;  2KUB A;  1YTZ I;  4I7Z C;  2YMK A;  3EQ2 A;  1EDL A;  2O01 J;  2FYU E;  5AVR B;  1VQ8 P;  1VQN P;  1MFZ A;  1G1J A;  1J1E B;  1Y47 A;  1RE4 A;  2AXC A;  5BU5 A;  1Q2N A;  2H8P D;  1NAF A;  1LJ2 A;  4RKU J;  1JY2 N;  4PJ0 H;  1M1J C;  3H32 B;  4UB8 H;  3E1I A;  2QE7 H;  3BVH B;  2BCC J;  1Z3S A;  1FS0 E;  1LTT C;  4U3F G;  1OIP A;  2JKV A;  1SQB G;  4K3A A;  3G4S P;  2XDJ A;  1R5L A;  1FZE C;  2D2C C;  2JHH C;  3H1L G;  5KLI B;  1DH3 A;  2FYZ A;  3M0D C;  4C7R A;  2XNX B;  3TF5 A;  3HE5 B;  3AE2 C;  5AW8 B;  3H32 A;  1KIL C;  2B87 B;  3M9B A;  1HJ0 A;  1N7S C;  2FXO A;  3BVH A;  3EFF K;  1FC2 C;  1JC9 A;  2HPC B;  5CHX A;  1W5C E;  5B66 H;  1RF1 B;  1YIJ P;  1DD4 A;  3H1I J;  4XFJ A;  3HD7 C;  1FZG C;  2BCC E;  2JEE A;  2E5Y A;  4GT1 A;  3AE8 C;  3KXD A;  3L75 D;  1SQQ J;  3RK2 C;  2XNX A;  1GL2 D;  3MD0 A;  3HE5 A;  2QRX A;  1HVV A;  2RKL A;  1IFM A;  5KKZ C;  2B87 A;  2NPS B;  4N78 E;  2HPC A;  1K04 A;  1SQP J;  3OJA B;  1CI6 B;  1RF1 A;  4GKG A;  2JHI F;  4GIF A;  1GW4 A;  3CC7 P;  3V2P A;  3TK1 A;  3FWL A;  1GDT A;  5GTH E;  1P84 E;  2OTL P;  2M5A B;  3MGN A;  2B9B A;  1GL2 B;  1FZB C;  1Z3U A;  1ZRT E;  3CXH I;  1USE A;  5CJ4 A;  3H1K D;  2NPS A;  1SQX D;  4HB1 A;  3CX5 D;  1PP9 G;  4IL6 E;  1Q90 D;  4OH8 B;  1LTA C;  1LTS C;  2XU6 A;  1JY2 O;  1SQQ E;  1CI6 A;  4H44 C;  2E75 D;  2IBZ I;  4H0L B;  1M90 Q;  1QVF O;  1GW3 A;  1SQV J;  1JOC A;  3L36 A;  1JM0 A;  2KSE A;  1NJI Q;  1JEK A;  5TIS E;  2KLU A;  2CK3 H;  2M5A A;  1SQP G;  3AE3 C;  1GL2 A;  3PJS K;  4R4M A;  1DX7 A;  1GK6 A;  1VF5 C;  1G2C B;  1D7M A;  5AVX B;  1PFI A;  4NPE A;  3L72 J;  2Q3I A;  2DW3 A;  5GTI E;  1AA0 A;  4BRY B;  4AUW A;  1SQV K;  3BAS A;  2HG5 D;  5KJ7 A;  1OX3 A;  3P8C E;  3L70 D;  5KLV D;  4IFD K;  3IAO A;  1RE4 C;  3SSU A;  1SQV E;  2E42 A;  1L0N J;  1YIT P;  1G2C A;  4Y99 B;  2WSE H;  2WSF J;  3PLN A;  3L75 G;  3R4Y A;  4BRY A;  2PFX A;  2A45 G;  1PGQ A;  3E1R A;  5APW A;  2WIT A;  3H25 A;  3L72 E;  1J1E C;  2ZFC A;  3CME P;  1NGM B;  3V6I A;  1NTK J;  2J58 A;  1S3J A;  1CZQ A;  1WRG A;  3CX5 H;  3AEA C;  3Q3D A;  2XND H;  3M0A A;  1L0N K;  2ZVN B;  1JMM A;  1X8Y A;  2JP3 A;  1TU3 F;  3TGU J;  2OYH B;  1XTG B;  4L73 A;  3H32 C;  2R44 A;  4I1L A;  4LLH A;  1Z56 A;  3BCC D;  3BVH C;  1L0N E;  2D2C D;  2Q9I B;  3H1K G;  1SQX G;  1EZV G;  2MKV A;  2Z4E B;  4EI2 A;  1PPJ E;  1FDM A;  3TDK A;  1KIL D;  5KLI C;  3PHL A;  5AW3 B;  1N7S D;  2A06 D;  3MUD A;  2XNX C;  4IFM A;  2NRG A;  2OYH A;  3D71 A;  1BE3 D;  3L74 E;  4YXD C;  3HD7 D;  2Q9I A;  2KYV A;  1FZF B;  2HPC C;  1ZN5 A;  4D6T J;  1RF1 C;  2JO1 A;  2Z4E A;  5KAF H;  2JHM F;  1S1C X;  3RK2 D;  3CLQ A;  1URQ B;  3TGU G;  3I55 P;  1GTW A;  2K3R A;  3HTK B;  2WPQ A;  3GF7 A;  3CWB D;  3V2R A;  1VQ7 P;  2J0Y A;  3LID A;  2HFE D;  2QM7 A;  4R9T A;  2QG4 A;  3H1H D;  2NPS C;  3HD7 B;  1L0L D;  4ASW A;  3C8V A;  2L5G B;  1FZF A;  1VL2 A;  1X9V A;  1URQ A;  2YMY A;  3HTK A;  2IFN A;  2WSC J;  2R32 A;  1QLE D;  1YBK A;  1T8Z A;  1IJD B;  3HUS B;  2K9Y A;  4GOF A;  3GMA A;  3I5C A;  4UB6 E;  4D6T G;  3CPW O;  1N8R Q;  1GL2 C;  1BSN A;  1K9M Q;  4H44 D;  2YO3 A;  4EYY Q;  4PD4 D;  1LP1 B;  3CCM P;  1KC8 Q;  1FOS E;  2PRR A;  1IK9 A;  2YO2 A;  2H88 C;  3L4F A;  2WSS H;  4H0L C;  2ZXX A;  1OW8 A;  1BCC D;  3F5H A;  1T3J A;  1AJY A;  1IFJ A;  1YHQ P;  4JQ0 D;  2ITA A;  4KT0 J;  1W2B O;  1DEE G;  1SQB D;  3ITK A;  1NTM K;  3L73 G;  1PGO A;  4PV1 B;  3HUS A;  5KJ7 C;  2J5Z A;  3P32 A;  2QIW A;  1HH0 A;  3K5B A;  3H1L D;  2FFD B;  1LP1 A;  1YI2 P;  2L91 A;  3AE1 C;  1N73 B;  5C39 A;  3VOP A;  2A06 G;  4L75 A;  1H0T A;  1KQS O;  2B89 A;  3QWO C;  2QJP B;  3WU2 H;  2M8R A;  2SPZ A;  2FYU J;  2LR2 A;  1EQ7 A;  2KB7 P;  3QH9 A;  1U7J A;  3Q5P A;  3H1J G;  1W2E A;  3O8Z A;  2FFD A;  3FX0 A;  2IPP A;  1L2P A;  3CWB G;  4Y99 C;  2BCC D;  3JCU E;  2QJK B;  3NTN A;  1N73 A;  3CXH E;  2IYP A;  5CCG A;  4YTP C;  1A02 J;  3CX5 I;  1JB0 J;  4W7Z A;  1Q7Y Q;  3H1H G;  3KYQ A;  3JC2 2;  3CCL P;  1L0L G;  1LTG C;  3U1A A;  2J0G A;  3L71 J;  3SWK A;  4N78 D;  2C9L Y;  2W8Z A;  2IBZ E;  1KD1 Q;  1N7L A;  1KFN A;  4IFF A;  1BDC A;  4H13 B;  3E1I B;  1QX8 A;  3WUU A;  1YJW P;  1L4A D;  3MUD C;  1LGH B;  1HF9 A;  5AVQ B;  4AYC A;  3CCR P;  2RH0 A;  2FYU G;  1NTZ J;  2M3E A;  2OYH C;  2JR8 A;  1PGJ A;  2FXP A;  4HH2 A;  2PGD A;  3H1I D;  4GOD A;  1KQL A;  1J2J B;  1AQ5 A;  5AVV B;  1S4X A;  2Q9I C;  5DJT B;  1JUN A;  2G3A A;  2O1K A;  1PP9 D;  3NFQ A;  5AVS B;  5AW7 B;  1NU1 K;  1ZW0 A;  2KZI A;  4WVZ A;  2Z4E C;  5K5G B;  1SQQ D;  2Q3E A;  1QVG O;  3NXS A;  3VMA A;  1BCC G;  1OXZ A;  1NU1 E;  1T3U A;  4RES B;  1E5W A;  1IZN B;  1L4A B;  1LT9 B;  3L71 E;  4YXW H;  2YKO A;  1SQP D;  1CSB A;  3RBX A;  2FBW C;  3JSV C;  1NTZ K;  2KP8 A;  2O01 N;  1FZA B;  1FZF C;  3WUV A;  1VQ4 P;  1NTZ E;  1A02 F;  1URQ C;  5AW6 B;  1JMB A;  3V2Q A;  1SFC B;  4PJ0 E;  2NPS D;  3KHU A;  1L4A A;  4UB8 E;  2OAR A;  1LT9 A;  2K37 A;  3V5B A;  4YPC A;  3V4W A;  3CL3 D;  1MZ9 A;  2KZJ A;  4R9J A;  1KYO D;  4NYT A;  3AE5 C;  3AEB C;  2W6A A;  1FZA A;  3G9R A;  1AV1 A;  2BCC G;  3S1K A;  2C9N Y;  2Y9Z A;  4GOE A;  1FU1 A;  4KHX A;  4KJM A;  3M91 A;  5KAI H;  4JYC A;  5AVW B;  3Q5R A;  1ZXG A;  1SFC A;  2ZAE B;  3HUS C;  3ABV C;  1OW6 A;  4C7N B;  3A3Y B;  2YXQ B;  2J61 B;  1Q86 Q;  4R4L A;  5B66 E;  4H0L D;  1NH4 A;  5H2F H;  3UIA A;  2Q1K A;  2C0X A;  1MFT A;  2KS1 B;  1GK4 A;  5KJ7 D;  3SWY A;  2O1J A;  1U57 A;  5DJU B;  1FDO A;  3GW6 A;  3VMZ A;  2P58 A;  1SLQ A;  2WMM A;  3VMX A;  3H1I G;  4L74 A;  2E76 B;  4PV1 C;  3CMA P;  1EZV D;  1GMJ A;  4C7N A;  3M9H A;  3S4R A;  2J61 A;  1SQQ G;  2FFD C;  3MP7 B;  1EDJ A;  5H2F E;  1N73 C;  2KS1 A;  1HWT C;  2J59 M;  2IZ0 A;  2Y9Y A;  5CCG C;  2JJL A;  3HRN A;  4O9B A;  3D6Z A;  2QA4 P;  4LC1 A;  2QJP C;  1NTK D;  2WVR A;  3TGU D;  2WPV B;  1M56 D;  4U7J A;  1KYO H;  3P7K A;  2V7Q H;  4ASV A;  2Y0D A;  4A7P A;  4HJG H;  1KQG B;  2QJK C;  4RO0 A;  3OAK A;  4PD4 I;  3H6P A;  2J3G A;  2WSE J;  1KTM A;  1NWQ A;  1LT1 A;  4NPD A;  2FXM A;  2A45 H;  1RH5 B;  3CI9 A;  1N2D C;  2YKQ A;  1SQV G;  5CMZ A;  2WZ7 A;  3GHG B;  1SS1 A;  1ZV8 A;  3CCS P;  4H13 C;  3FXE A;  3TYY A;  3E1I C;  2WPS A;  5B5E H;  1LTJ B;  1S2E A;  3EFG A;  4CPG A;  3USS A;  4D6T D;  1PZQ A;  2QJY B;  3SFD C;  1OWA A;  3L72 G;  3L74 J;  1AVO A;  3BRV B;  2POH A;  1VDF A;  1VQP P;  3GHG A;  4Y28 J;  3VYI A;  2P10 A;  1NAY A;  1UIX A;  2R3C A;  5CCH A;  3B8E B;  1FIC A;  3AE4 C;  3W68 A;  4IOI H;  2V4H A;  1L4A C;  3L73 D;  4GDO A;  1LT9 C;  1K8A Q;  1LTJ A;  1KB9 D;  3VP9 A;  1L0N G;  3CCJ P;  1CW5 A;  1SQX K;  3AE6 C;  1URQ D;  1PPJ G;  1MV8 A;  5AVZ B;  1FZA C;  3BAT A;  3G71 P;  1H8A A;  2KLV A;  1VPC A;  4TT3 H;  2W6J H;  3CX5 E;  1JO5 A;  1S9K D;  1GU4 A;  2E5T A;  4NPF X;  4JYO X;  2BEZ F;  5KLV J;  2I8D A;  1SFC C;  3PTZ A;  4I6M C;  4JYB A;  1NTK G;  3IFM A;  4DCK A;  4WWI A;  3RK3 E;  4EDF A;  4W7Y A;  1HTL C;  1BGY J;  3H1J D;  3KZI H;  3TSI A;  3IF4 A;  4JPZ B;  3VP8 A;  1EXI A;  3MTU E;  3FWN A;  3II6 A;  4AQR D;  3CC4 P;  2CPS A;  1FZC B;  2XKM A;  5KLV K;  2JHL F;  3KDP B;  2I1K A;  3TNU B;  1KV4 A;  2E43 A;  2Q5U A;  4ZFG A;  3L70 E;  4OWF A;  5KAF E;  5KLV E;  5APV A;  3CD6 P;  2KIK A;  1NTM J;  2C0W A;  2VRS A;  1RF0 B;  2FIB A;  2P67 A;  2FYU D;  4PV1 D;  2N9Y B;  1BGY E;  1ZR2 A;  1FZC A;  4M7H A;  2HYN A;  3P8M C;  2GUV A;  1JNM A;  2ZYA A;  2E76 C;  3LW5 J;  3M9Q A;  5CJ0 A;  1KB9 H;  2E74 B;  2P2U A;  3R2P A;  2ZJS E;  3TNU A;  3F89 A;  5AW4 B;  5CCG D;  1OMI A;  5APS A;  1H0T B;  2Z5I A;  4N3Y B;  4DZO A;  2J64 A;  2ZYG A;  1VQO P;  1RF0 A;  1KYO I;  5E79 H;  3V2N A;  3HE4 B;  2KSJ A;  1JTH B;  2K9J B;  2H89 C;  3O6Q B;  1NTM E;  3BCC E;  1HJB A;  1KOR A;  2A45 I;  2XZR A;  4IL6 X;  1IFN A;  3AEE C;  1FIB A;  3CC2 P;  1IC2 A;  2RMZ A;  2OYI B;  4C46 A;  1KIL E;  3D70 A;  4JF7 A;  3RL0 g;  2Y0C A;  2KI7 B;  2A06 E;  2YNY A;  1DIP A;  3PP5 A;  3HE4 A;  1J1D B;  1JTH A;  2K9J A;  4XE5 B;  5AW1 B;  3O6Q A;  2ZXE B;  1BE3 E;  1LTB C;  2MJZ A;  4H13 D;  3WUT A;  3GHG C;  2YKP A;  3RL0 B;  2LKM A;  4DOJ A;  5CCH C;  1EZV I;  2N1T A;  3OA7 A;  1NU1 J;  2OYI A;  1N86 B;  1LTJ C;  3WU2 E;  3A0B H;  3CCU P;  1L0L K;  2QJY C;  3PH0 A;  1JCD A;  1PL5 A;  1M1K Q;  2IBZ G;  2J3F A;  4PD4 H;  2BEQ D;  1L0L E;  3FGA D;  3B5N A;  4U3F J;  1P84 D;  4B86 A;  2KXP B;  1ZRT D;  2AEM A;  1RE3 B;  3C1L A;  1MKM A;  1VQK P;  3RGU A;  1VQL P;  2J5U A;  1N86 A;  1GU5 A;  3VN0 A;  3H1L J;  5APX A;  3A0B E;  2J60 A;  2NZ2 A;  2ZT9 B;  1JY3 P;  3AE7 C;  4WY4 D;  1NKZ B;  2IZ1 A;  4PD4 E;  1SFC D;  2O01 H;  1NU1 G;  2AEF A;  1IFD A;  3L71 G;  1SQB K;  4I2L C;  3I56 P;  1NOH A;  4WBA A;  1BCC E;  4ZKU A;  1RE3 A;  5CBO A;  5AW9 B;  4M3L A;  1AFO A;  1NVO A;  4U3F E;  1SQB E;  4BWN A;  1S5L X;  2WQY C;  1Y8A A;  1NTZ G;  3IR9 A;  3AEC C;  1M8O B;  5TJH A;  4WY4 B;  4MN4 C;  4L76 A;  3H1L E;  3KPE A;  5KTB A;  1RQV A;  1T6A A;  1RY3 A;  3V4Q A;  1Q82 Q;  1FZD A;  5BVZ A;  3AED C;  1FZC C;  1OZH A;  5M1B A;  1PGP A;  2O3J A;  3GG2 A;  3P8C D;  5AVY B;  1NYH A;  1SQV D;  1GD2 E;  1X0T A;  1VQ5 P;  2M3B A;  1E79 H;  3NMD A;  1KB9 I;  3FIB A;  3SWF A;  4WY4 A;  3A2A A;  2YIU B;  1RF0 C;  2E76 D;  1PP9 J;  3GF3 A;  3N7N A;  5GTH H;  1PIX A;  2J2P A;  1P84 H;  5L8R J;  1X22 A;  3L72 D;  1IK7 A;  2E74 C;  4IL6 H;  1OVV A;  1KN7 A;  3IN6 A;  1DD3 A;  2J3O A;  1ZOY C;  2M0B A;  2J1G A;  1YQ3 C;  4OGQ D;  2HOD B;  5KAI E;  1L0N D;  2Y0E A;  3Q1M A;  4ZKP A;  2K1A A;  2KNC B;  5TIS H;  1YJN P;  3G6E P;  1PPJ D;  2PAJ A;  2CPB A;  2YXR B;  1SQQ K;  3H1I E;  2KOG A;  3A7O A;  1PP9 E;  2IFM A;  2Q6Q A;  3U1C A;  3MHV A;  2FYN B;  5AW0 B;  1HUC A;  1VQM P;  5GTI H;  1SQP K;  2N1T C;  3VTP C;  5APU A;  1LTI C;  1ZP0 C;  1BDD A;  2OYI C;  4OGQ B;  3L74 D;  2HOD A;  2H43 B;  2LXC B;  4WB4 A;  2V7Q J;  3Q2Y A;  3RK3 D;  2KNC A;  1J1D C;  1EC5 A;  1SQP E;  3L75 J;  1NKN A;  3ZDM A;  5CCH D;  1YJ9 P;  4EIJ A;  1PV3 A;  3OW2 O;  1HGV A;  2QSI A;  4Z1M H;  2J3U A;  3B5N C;  4M7F A;  1OVU A;  5APT A;  2N9B A;  1KFM A;  1U7M A;  1K05 A;  1NO4 A;  3RL0 C;  3L37 A;  2WNP F;  2JDI H;  3SFE C;  1T2K C;  2I1J A;  1ZR4 A;  1FAV A;  2OGU A;  2E75 B;  1ZME C;  2GY7 A;  2JHK F;  1N86 C;  2H43 A;  3RK3 B;  3KQG A;  4EOT A;  3LIE A;  2OTJ P;  3B4S A;  2AEJ A;  1LWU B;  1RQU A;  2R3S A;  1KYO E;  1KZU B;  3H1K J;  2GA1 A;  1SQX J;  3T97 B;  3MIW A;  1QEX A;  2WTY A;  2R5B A;  1DEB A;  3L75 E;  1BGY D;  1M57 D;  1OFC X;  1RE3 C;  1MUU A;  1IFI A;  1H88 A;  2FY8 A;  5CBN A;  1SVF A;  1S5L H;  1SP4 A;  3WMM 0;  1JY3 N;  1RHZ B;  2WSF H;  2HLO B;  1AQT A;  5AVU B;  1LNQ A;  1K73 Q;  4OVN F;  2ZT9 C;  1WMK A;  3RBZ A;  2XV5 A;  1XTC C;  1LWU A;  2R5D A;  3VMY A;  1X79 B;  3AEG C;  2JWD A;  2J0H A;  4I7Z B;  3T97 A;  1AVY A;  1YTZ T;  5B5E E;  4DT0 A;  3B71 A;  1VQ9 P;  2G8Y A;  4QMA A;  2WWW A;  1USD A;  2K88 A;  4EPU A;  2HR3 A;  1JCC A;  2AXT H;  3Q5S A;  1QGK B;  1NTM D;  3W67 A;  3H1K E;  1EXJ A;  2GM4 A;  4TLF A;  1Q81 Q;  1M7L A;  1S5L E;  1SQX E;  3M06 A;  1EZV E;  2HLO A;  1GZL A;  2WT7 B;  4K35 A;  1QL1 A;  3L70 J;  4WY4 C;  1FBM A;  1M1J B;  3L74 G;  1NTK K;  2PP6 A;  1JY2 P;  2P7J A;  1P84 I;  1ZLL A;  1FZE B;  1NHL A;  1NTK E;  2D2C B;  2AXT E;  3G3Z A;  1R8E A;  1FDI A;  4ZNC A;  3CXH D;  3L35 A;  2WT7 A;  3TGU E;  1YQ4 C;  2BAS A;  2W6B A;  1IO4 A;  1FE6 A;  2YIU C;  4RJT A;  1M1J A;  2E74 D;  1KIL B;  1WT6 A;  2KK7 A;  2P1J A;  1N7S B;  2RN0 A;  4UB6 H;  2IBZ D;  4N6J A;  2OTK E;  2WPR A;  3A5T A;  3L70 G;  4W80 A;  5KLV G;  1FZE A;  3BCC J;  3KZI E;  3L73 J;  1Y9B A;  1FZG B;  5APY A;  2OQQ A;  3CCE P;  3S9O A;  2Z5H A;  3PRJ A;  3M0D A;  1S72 P;  2B88 A;  3MZW B;  3RK2 B;  3FXD A;  1BGY G;  2HOD C;  1JY3 O;  4XA4 A;  5KKZ B;  1G1I A;  1KIL A;  3C9I A;  1N7S A;  4D6T E;  1UII A;  3CCV P;  1IFP A;  2LXB A;  2OYO A;  4HKZ H;  2WSC H;  1BE3 J;  2N1T D;  2IYO A;  5AW5 B;  1NU1 D;  1OVR A;  3HD7 A;  1FZG A;  1HBW A;  2FYN C;  2UWJ E;  1VQ6 P;  1YYC A;  3L71 D;  2W27 A;  2J3F D;  4LGD E;  1R5S A;  3H1J J;  4OGQ C;  1FZB B;  3LW5 H;  2H43 C;  1FJP A;  1FJK A;  3L73 E;  3CWB J;  5AW2 B;  3B5N D;  1NTM G;  3BCC G;  2FKW B;  1KB9 E;  1VF5 D;  4U3F D;  3RL0 D;  4HYT B;  3E7K A;  2QVA A;  1NTZ D;  5BU8 B;  1T2K D;  3U59 A;  5AVT B;  4H44 B;  2N1T B;  3H1H J;  3CCQ P;  2W90 A;  1L0L J;  2W83 C;  3JCU H;  1FOS F;  4ZMD A;  1OW7 A;  2D39 A;  3CXH H;  5E79 E;  4JBZ A;  1EDI A;  1S9K E;  3GLM A;  2E75 C; 
#chains in the Genus database with same CATH homology
 2KYV A;  1RY3 A;  3V4Q A;  1ZN5 A;  3P7K A;  2HPC C;  1FZF B;  5APQ A;  1FZB A;  1FZD A;  5BVZ A;  1RF1 C;  1FZC C;  2Z4E A;  3B5N B;  3RK3 C;  2JHM F;  3P8C D;  3RK2 D;  3CLQ A;  1URQ B;  2GUS A;  1GTW A;  3OAK A;  3HTK B;  2WPQ A;  3H6P A;  5AVY B;  2J3G A;  3N4X A;  1LWU C;  3V2R A;  1GD2 E;  1NWQ A;  2J0Y A;  3LID A;  2Q7C A;  2H7H A;  2M3B A;  2FXM A;  3NMD A;  2A45 H;  2HFE D;  3CI9 A;  2QM7 A;  1N2D C;  2YKQ A;  5CMZ A;  3FIB A;  4R9T A;  2WZ7 A;  3GHG B;  3SWF A;  4WY4 A;  3A2A A;  2NPS C;  1ZV8 A;  2QM8 A;  2IX7 C;  3HD7 B;  1RF0 C;  3N7N A;  2L5G B;  1FID A;  1FZF A;  2J2P A;  3TYY A;  3E1I C;  1X9V A;  2WPS A;  1RE4 B;  4JZC A;  1HGZ A;  1LTJ B;  3EFG A;  2HLO C;  1URQ A;  2YMY A;  3HTK A;  2IFN A;  2R32 A;  2FYU K;  1H89 A;  1T8Z A;  1OWA A;  1QL2 A;  1IJD B;  3BRT B;  3HUS B;  2J3O A;  3I5C A;  3BRV B;  1YTZ I;  1GL2 C;  2J1G A;  2POH A;  3EQ2 A;  1VDF A;  2YO3 A;  3GHG A;  5AVR B;  3VYI A;  2HOD B;  2R3C A;  5CCH A;  3B8E B;  1FOS E;  4ZKP A;  1FIC A;  1IK9 A;  1MFZ A;  1G1J A;  2YO2 A;  1J1E B;  1RE4 A;  3L4F A;  5BU5 A;  1L4A C;  2PAJ A;  1LT9 C;  1LTJ A;  2H8P D;  3VP9 A;  1NAF A;  2CPB A;  1T3J A;  1SQQ K;  1IFJ A;  1CW5 A;  1SQX K;  2KOG A;  3A7O A;  2IFM A;  1URQ D;  1NTM K;  3U1C A;  1JY2 N;  1MV8 A;  3HUS A;  5AVZ B;  5KJ7 C;  2J5Z A;  1M1J C;  3H32 B;  1FZA C;  5AW0 B;  3BAT A;  1HUC A;  3P32 A;  1H8A A;  3E1I A;  2KLV A;  1VPC A;  3BVH B;  1SQP K;  2N1T C;  1Z3S A;  3VTP C;  5APU A;  1LTT C;  1JO5 A;  1LTI C;  1HH0 A;  2OYI C;  2HOD A;  2FFD B;  2H43 B;  1S9K D;  1GU4 A;  2XDJ A;  4JYO X;  4WB4 A;  3RK3 D;  1FZE C;  1N73 B;  1J1D C;  1SFC C;  4I6M C;  3VOP A;  2JHH C;  4JYB A;  1NKN A;  5CCH D;  3IFM A;  4EIJ A;  1DH3 A;  4W7Y A;  2FYZ A;  1HGV A;  3M0D C;  4C7R A;  2J3U A;  4M7F A;  3B5N C;  1HTL C;  5APT A;  2N9B A;  1KFM A;  2M8R A;  2XNX B;  3HE5 B;  1NO4 A;  3RL0 C;  3L37 A;  2WNP F;  1EQ7 A;  5AW8 B;  3TSI A;  3H32 A;  2KB7 P;  1T2K C;  1KIL C;  2I1J A;  1ZR4 A;  3M9B A;  1FAV A;  3VP8 A;  1N7S C;  3BVH A;  2GY7 A;  2JHK F;  1JC9 A;  2HPC B;  3MTU E;  1N86 C;  1W2E A;  3II6 A;  5CHX A;  4AQR D;  3O8Z A;  2H43 A;  2FFD A;  2CPS A;  1RF1 B;  1FZC B;  2IPP A;  2XKM A;  3RK3 B;  4Y99 C;  3KQG A;  3NTN A;  1N73 A;  4EOT A;  3LIE A;  3HD7 C;  1FZG C;  5KLV K;  2JHL F;  5CCG A;  1A02 J;  1LWU B;  3KDP B;  2JEE A;  2I1K A;  3TNU B;  4W7Z A;  2E43 A;  2Q5U A;  1KZU B;  4GT1 A;  4ZFG A;  3KYQ A;  3RK2 C;  2XNX A;  1GL2 D;  3MD0 A;  3HE5 A;  3MIW A;  1LTG C;  3U1A A;  2J0G A;  1HVV A;  5APV A;  4N78 D;  2WTY A;  2C9L Y;  1IFM A;  2R5B A;  1DEB A;  2C0W A;  1N7L A;  2NPS B;  1KFN A;  2VRS A;  1RF0 B;  4IFF A;  2FIB A;  1RE3 C;  1MUU A;  1IFI A;  2P67 A;  1H88 A;  4N78 E;  2HPC A;  1SVF A;  1SP4 A;  3OJA B;  3WMM 0;  3E1I B;  1CI6 B;  1RF1 A;  4GKG A;  1ZR2 A;  1FZC A;  1JY3 N;  4M7H A;  1L4A D;  2HYN A;  3P8M C;  2GUV A;  1JNM A;  1LGH B;  2WSF H;  5AVQ B;  4AYC A;  2HLO B;  5AVU B;  2JHI F;  3M9Q A;  5CJ0 A;  2OYH C;  2XV5 A;  4GIF A;  4HH2 A;  2P2U A;  1XTC C;  1GW4 A;  1LWU A;  2R5D A;  3VMY A;  3R2P A;  3V2P A;  3TK1 A;  1X79 B;  3TNU A;  1KQL A;  1GDT A;  1J2J B;  1AQ5 A;  5AVV B;  2J0H A;  5AW4 B;  5CCG D;  2Q9I C;  1JUN A;  3MGN A;  2O1K A;  3NFQ A;  5AVS B;  1GL2 B;  5APS A;  1FZB C;  5AW7 B;  1NU1 K;  3T97 A;  1Z3U A;  2Z5I A;  1YTZ T;  2Z4E C;  4N3Y B;  4DZO A;  5CJ4 A;  2WWW A;  2J64 A;  2NPS A;  1RF0 A;  4EPU A;  3NXS A;  1JCC A;  3V2N A;  3HE4 B;  1LTA C;  1LTS C;  1OXZ A;  2KSJ A;  1T3U A;  2XU6 A;  4OH8 B;  4RES B;  1JY2 O;  2GM4 A;  1CI6 A;  1JTH B;  1E5W A;  1M7L A;  1L4A B;  3M06 A;  1LT9 B;  2HLO A;  2YKO A;  1GZL A;  1GW3 A;  1CSB A;  2WT7 B;  1QL1 A;  1JOC A;  3L36 A;  4WY4 C;  1NTZ K;  1HJB A;  2KP8 A;  1FBM A;  1M1J B;  1FZA B;  2A45 I;  2XZR A;  1FZF C;  1GL2 A;  1NTK K;  1IFN A;  1DX7 A;  2PP6 A;  1JY2 P;  1FIB A;  1IC2 A;  2OYI B;  4C46 A;  1A02 F;  1GK6 A;  1URQ C;  5AW6 B;  1G2C B;  4JF7 A;  2P7J A;  2YNY A;  5AVX B;  3PP5 A;  3V2Q A;  1ZLL A;  3HE4 A;  1FZE B;  1NHL A;  1J1D B;  1SFC B;  2NPS D;  1JTH A;  1PFI A;  4XE5 B;  5AW1 B;  3G3Z A;  1L4A A;  2OAR A;  2Q3I A;  1LT9 A;  2ZXE B;  1LTB C;  2MJZ A;  3V5B A;  3L35 A;  2WT7 A;  3V4W A;  4AUW A;  3GHG C;  2BAS A;  3CL3 D;  2YKP A;  1MZ9 A;  1SQV K;  2W6B A;  1IO4 A;  3BAS A;  3RL0 B;  4NYT A;  4R9J A;  2LKM A;  2HG5 D;  4DOJ A;  5KJ7 A;  5CCH C;  2W6A A;  1M1J A;  1FZA A;  1KIL B;  3P8C E;  1WT6 A;  2P1J A;  1N7S B;  2N1T A;  4IFD K;  1RE4 C;  3OA7 A;  2C9N Y;  2OYI A;  1N86 B;  1FU1 A;  1LTJ C;  2E42 A;  4KHX A;  4N6J A;  2WPR A;  1G2C A;  3A5T A;  3M91 A;  4JYC A;  1L0L K;  4W80 A;  4Y99 B;  2WSE H;  5AVW B;  1JCD A;  1FZE A;  1SFC A;  1FZG B;  5APY A;  2J3F A;  3HUS C;  2Z5H A;  4C7N B;  3A3Y B;  3M0D A;  2J61 B;  3B5N A;  3RK2 B;  1NH4 A;  2A45 G;  2HOD C;  1JY3 O;  4XA4 A;  5APW A;  2WIT A;  3UIA A;  1G1I A;  4B86 A;  1KIL A;  3C9I A;  2C0X A;  1J1E C;  2ZFC A;  1N7S A;  1RE3 B;  1GK4 A;  5KJ7 D;  3SWY A;  2J58 A;  1N86 A;  1CZQ A;  2O1J A;  3VN0 A;  1GU5 A;  1WRG A;  3VMZ A;  3M0A A;  2WSC H;  2N1T D;  1L0N K;  5APX A;  5AW5 B;  1SLQ A;  1JMM A;  2J60 A;  3VMX A;  1X8Y A;  3HD7 A;  1FZG A;  1HBW A;  2OYH B;  1JY3 P;  1XTG B;  1YYC A;  4WY4 D;  3H32 C;  1NKZ B;  4I1L A;  4C7N A;  4LLH A;  1SFC D;  1Z56 A;  2W27 A;  3M9H A;  2O01 H;  3BVH C;  2J3F D;  2J61 A;  2Q9I B;  4LGD E;  1IFD A;  1FZB B;  3LW5 H;  2FFD C;  2H43 C;  1FJP A;  1SQB K;  2Z4E B;  1FJK A;  5AW2 B;  3B5N D;  4I2L C;  1NOH A;  2FKW B;  1N73 C;  4WBA A;  1HWT C;  2J59 M;  3RL0 D;  1RE3 A;  4ZKU A;  5AW9 B;  4HYT B;  5CCG C;  5BU8 B;  4M3L A;  1AFO A;  1FDM A;  1T2K D;  1KIL D;  3U59 A;  5AVT B;  2JJL A;  3HRN A;  4O9B A;  5AW3 B;  1N7S D;  2N1T B;  4LC1 A;  3MUD A;  2XNX C;  4IFM A;  1FOS F;  3IR9 A;  2OYH A;  2D39 A;  4WY4 B;  1S9K E;  3HD7 D;  3KPE A;  5KTB A;  2Q9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...