1LTJC

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 88
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ltjC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ltjC02
1Z3UA 3GHGA 2FFDA 2HLOC 4JZCA 4M7FA 1JY3O 4R9TA 2J61A 1FZCC 1RF0A 2JHKF 3GHGC 1JC9A 1FZDA 2J60A 2XNXA 1FICA 2JHHC 1FZFB 2HPCC 1RE3B 1JY2P 2D39A 2H43C 3HUSB 1Z3SA 2J61B 2J2PA 3H32C 2HODA 2Z4EB 1N73A 1LTJA 1FZEB 2A45I 2GY7A 2J0YA 2JHMF 2J3OA 2FIBA 1JY3N 1LWUB 1LT9B 2OYIC 2J3FD 1FZAA 2FFDC 2HPCB 4ZFGA 2HLOA 2Q9IB 4R9JA 2J0HA 3E1IB 1FZCA 1FZAC 1FZGA 2OYIB 2HODB 4M7HA 2HPCA 2JHIF 3HUSA 2J3GA 1RF1C 1RE3A 1RE4C 2OYHA 2J3UA 3H32A 1LTJB 1M1JB 2H43B 2HODC 1T3UA 1RF1A 1FZBC 2Q9IA 1FIBA 1JY2N 1RE4A 3FIBA 2J0GA 1FZAB 2J64A 1LT9A 2OYIA 2FFDB 1FZBA 2A45H 2Q9IC 3GHGB 1FZCB 1LWUC 2J5ZA 2Z4EA 4NYTA 1LT9C 2HLOB 1RF0B 1M1JC 1FZEC 1FZGC 1N73C 1LWUA 4EPUA 1RF1B 3HUSC 3H32B 3E1IA 2J1GA 1N86B 2JHLF 1RF0C 2A45G 1RE3C 1JY2O 3BVHB 4JYOX 2XNXC 1FZFC 3BVHA 3E1IC 1N86A 1W2EA 2H43A 1FZFA 1FIDA 1FZBB 2XNXB 3BVHC 1JY3P 2OYHC 1N86C 1LTJC 1RE4B 2Z4EC 2J3FA 1FZGB 2WNPF 1M1JA 1FZEA 1N73B 2OYHB
chains in the Genus database with same CATH superfamily
3PHLA 1GL2D 4JZCA 2J61A 3PLNA 3L72J 1SQQE 4CPGA 2RKLA 1FZFB 1L0LE 2G3AA 1G2CA 2V7QH 2JDIH 2QRXA 3O6QA 3L75D 1QLED 3L74J 3WUTA 1H88A 2YNYA 4PD4D 3HE4A 2G8YA 2O1KA 2IYOA 2Q9IB 2E74D 2HPCA 1L2PA 2GA1A 3HUSA 2NPSD 1BCCG 1Q82Q 2FYZA 1ZRTE 3TGUJ 3CC2P 1EDIA 4HKZH 4L76A 1NH4A 1FZBA 3FXDA 1H89A 2JWAA 1KZUB 2HLOB 2WT7B 2NZ2A 1SQVK 1RF1B 1U7JA 2E76B 1N8RQ 3VMYA 1PPJD 1NO4A 1CZQA 1LGHB 1IK9A 1PP9D 1OW8A 2ZYGA 1FU1A 2P7JA 2E74C 1NTMJ 2IBZG 3CXHD 1JM0A 3P8MC 1FOSF 1X8YA 1R5LA 2OYHA 4JYCA 2XZRA 1Q90D 2CK3H 4U3FG 4R9TA 3TDKA 3TGUD 1JY2P 2WSCJ 3M91A 1SFCC 3SWYA 1KILC 2FYUE 3SFDC 3M0DA 2DW3A 3Q1MA 1OMIA 3IN6A 1P84D 1OVRA 1L4AB 1SQBK 3GMAA 1FZCA 3BRTB 3A2AA 2QG4A 3TK1A 1OW6A 3A0HH 1USDA 1HVVA 3CWBG 1LTJB 5BU8B 3F5HA 1LTAC 2Q9IA 1AFOA 1FIBA 5H2FH 1OVVA 1IFIA 2PFXA 2YXQB 2W27A 3CCQP 3KZIE 2D2CC 2W90A 1NTZG 5APWA 3HTKB 1SP4A 1L0LJ 1NVOA 1E5WA 2XU6A 1N7LA 2FYUG 2IFMA 2J1GA 1BCCJ 1HJBA 3VTPC 2QM7A 1L0NG 4D6TJ 3VOPA 2WSSH 1SQPJ 2H43A 3BCCG 2YKQA 1KN7A 1J2JB 1S72P 1KB9H 1BDCA 3NMDA 5CJ0A 1AQ5A 3IFMA 1YI2P 3G71P 3CMEP 3FWLA 3JCUE 2ZT9B 2K9YA 1AVOA 2IPPA 3EFFK 1EXIA 2ZJSE 4H44D 5AVUB 1VQ9P 1NTMG 2LR2A 4C7NB 1LTTC 1FJPA 1SVFA 2ZXEB 3LIDA 2OARA 2AXTE 2K1AA 5AVQB 4NPDA 3KDPB 1LT9B 2WPRA 1IJDB 1JEKA 4Z1MH 3L70E 1L4AC 4R9JA 3MGNA 1SQXK 1KMIZ 3AEFC 3C8VA 1KYOH 4UB6H 1BGYG 1URQD 3M0AA 3MUDA 1EZVI 4HJGH 2NPSB 2R5BA 2Q9IC 2Z5IA 3T97A 5AVZB 4RO0A 4WY4B 2B87B 4ZKUA 1NTME 1G1JA 1SQQG 5KAIH 2GUSA 2BEQD 2OTLP 4IL6X 5AW0B 4OGQC 2H8PD 3HD7A 3L70J 3PRJA 1PGPA 3S4RA 1JY3P 2R3CA 1KILA 1GMJA 1URQC 1YITP 3Q2YA 1VQPP 2QJKB 2IBZI 4IL6H 3CCLP 1BCCE 3VMZA 1FZDA 3H1KE 4Y99C 5M1BA 4D6TG 2WTYA 1RHZB 1BDDA 3H1JE 1SQPG 1FDMA 1YJNP 1OFCX 1RQUA 2ITAA 1NAYA 3VMXA 2VRSA 1GU5A 2M0BA 2WSEH 4U3FD 3AE7C 3L72G 1Y47A 2HODB 1ZW0A 3AE5C 2E76D 3L71G 4I7ZC 3RK3E 1FDIA 3A0BE 1RF1A 3KPEA 2WPQA 4EYYQ 2K37A 1SQBE 3SWFA 3L75J 2YIUC 3H1KJ 3IF4A 2OTJP 2KS1A 4JF7A 2QEXP 2BCCE 3CMAP 1QVGO 1NTMK 3D71A 3TYYA 1NTZE 3LW5H 1N86B 1RF0C 5AVRB 2AXTH 3BVHB 4OGQD 3A7OA 2H89C 4A7PA 1QX8A 2I1JA 1XTGB 1W2EA 5H2FE 2KI7B 3Q3DA 3BVHC 2AEJA 1RH5B 2JWDA 1KB9I 1S5LX 2O3JA 5AVWB 3H1HJ 3MZWB 5APQA 4PD4H 1PL5A 5CCHC 2JHKF 1JC9A 3CC4P 1JO5A 3D6ZA 1A02F 2L5GB 2QSIA 2ZT9D 2W8ZA 3B5NC 3EQ2A 1D7MA 2BCCG 2BEZF 2R5DA 2FIBA 1LWUB 1RQVA 3TGUE 1KQSO 2WT7A 3HE5A 3S9OA 2HLOA 1AJYA 5AVXB 2Y0EA 2W6AA 2Q5UA 3D6YA 1FZAC 1Q2NA 4IFDK 2JHIF 2J3GA 1ZN5A 2E76C 3GG2A 1KV4A 1KB9E 5AW9B 2JKVA 2QM8A 2CPBA 4YXDC 2WPVB 3FIBA 2WSEJ 1NAFA 1KQLA 4N78D 1NU1E 4GDOA 4GOFA 4L75A 3CX5H 1FBMA 3K5BA 3HUSC 4YPCA 1NKZB 4UB8E 3RK2C 4EI2A 1WRGA 3BRVB 2N9YB 1P84H 3WUVA 3L74G 5AW3B 3H1ID 4NPFX 1KYOI 2Z4EC 3L74E 2FYNC 1Y9BA 2PP6A 4H0LD 3LW5J 3L71D 2RN0A 2XNDH 3L72E 1T2KD 1HUCA 3V4QA 1L0NJ 2J60A 3B8EB 3BCCD 1VQOP 2O01J 2W83C 3B5ND 2ZXXA 5C39A 1BE3G 4ZNCA 2HODA 2XKMA 3VMAA 3V2RA 5KKZC 2WPSA 1FZAA 2FFDC 2I1KA 3H1HG 5AW8B 3PTZA 1NTKJ 4H13D 4H0LC 2PAJA 1S1CX 1ZV8A 1NTZD 1FAVA 1RE3A 1RE4C 1SQQD 2P67A 3CL3D 5KLVJ 1FZBC 2RMZA 2C9LY 1OXZA 1AA0A 2J64A 2OYIA 4GKGA 4LC1A 5AW1B 3CWBD 1MFTA 1FZCB 1ZMEC 1HF9A 1BE3E 1M1JC 1NTKD 1EZVD 1DD4A 1FJKA 1SQXD 1IFMA 2ZVOB 1GK6A 3USSA 1JCCA 3L36A 4Y99B 1JUNA 2W6JH 3H1JD 1GTWA 4KHXA 1FIDA 1M8OB 1J1EB 3BASA 3TNUA 3H1KD 5APUA 4WY4A 2QJPC 3Q5PA 3RL0B 3JSVC 1IFNA 2RH0A 1DEEG 2LXBA 5EFWB 2E75B 1HGVA 4PD4I 3AEEC 2R3SA 1Z3SA 2J61B 2LXCB 3CWBJ 2Z4EB 2POHA 3HRNA 1H8AA 2UWJE 1A02J 4IFMA 2J3FD 3EFGA 4WB4A 2J5UA 1OX3A 4K35A 3E1IB 2V7QJ 4IL6E 3ITKA 1HH0A 2QJKC 3OJAB 1BE3J 1X79B 1M1KQ 3RK3B 4BRYA 1RE4A 1AVYA 2AEFA 2FFDB 3AEDC 3L35A 4K3AA 3TF5A 4NYTA 3AEBC 1UIIA 3HTKA 1GD2E 1IC2A 4C7RA 1FZGC 1N73C 1QEXA 5AW5B 2OTKE 1EQ7A 2A45G 1RE3C 1SQVG 1N7SD 3II6A 4IOIH 1YJWP 3FGAD 3QWOC 2Z5HA 5KLIC 1N86A 2KLUA 3RK2D 3CPWO 3L75G 3L73E 4QMAA 2Q6QA 1MFZA 1LTGC 3FXEA 2GM4A 1YQ4C 1OIPA 2IYPA 3WUUA 2HLOC 1VQ4P 3CCMP 3RL0g 3GLMA 1GL2B 3VN0A 1NTKK 1X0TA 5CCGA 3HD7C 1GL2A 4RKUJ 1DH3A 2E5TA 2KNCB 3NXSA 3CCUP 2FYNB 2E43A 2WZ7A 5E79E 3MUDC 3MD0A 3H1JG 4GOEA 1NWQA 3OAKA 2OYIC 3KHUA 5APXA 3VP9A 1T8ZA 2B88A 1SQPE 1NTZK 2WSCH 4R4LA 2OYIB 1P84I 1S2EA 3L70D 5AW4B 2HFED 1KORA 4H44B 1SQVD 4WBAA 4LLHA 1K05A 4GIFA 1MV8A 5B5EH 1LT9A 1OWAA 2KYVA 2YO2A 3ABVC 3RK3C 4O9BA 4U3FJ 5AVYB 1H0TB 1SQVE 2C0XA 5KLVK 1CW5A 4JYOX 3E1IC 1Z56A 3CI9A 3W67A 4OGQB 4XE5B 2KXPB 2M3BA 2QVAA 2XNXB 2FXMA 5TJHA 3AE9C 4PV1D 1G1IA 5GTIE 2ZVNB 2N1TA 1FZGB 1K8AQ 2WNPF 1FZEA 1N73A 4XA4A 2D2CB 4BWNA 1YTZT 3CXHI 1CI6B 2YKOA 1GL2C 3H1LJ 2E74B 1NHLA 3CX5D 4EOTA 2NPSA 2FBWC 3HUSB 1NYHA 4I2LC 5L8RJ 3B5NA 1JB0J 3MTUE 2QJYC 1HGZA 3EWKA 1J1DB 3TNUB 3H1KG 1L0LK 1UIXA 5E79H 2WQYC 1FE6A 1SQPK 2PGDA 4OVNF 5B5EE 2QJPB 4RESB 1VQNP 1L0LG 1XTCC 3A0BH 2JR8A 1LJ2A 4MN4C 3CD6P 3L73D 1SQPD 3RBXA 3P8CD 2J3UA 1PIXA 4WWIA 4D6TD 3MHVA 2B89A 1KQFB 3L73G 5KAIE 2Q3IA 1AV1A 1PGQA 2A45H 4ZMDA 1J1DC 4AYCA 3AE6C 3RK3D 3KYQA 1NTKG 1RF0B 2KB7P 5AW6B 1VQ6P 3U1CA 2ZFCA 1NU1G 3E1IA 2K9JA 4H13C 1T6AA 1N7SC 2AEMA 1VQ8P 2NRGA 1KYOE 1JTHB 1IFPA 5APSA 1PP9G 2M8RA 1YBKA 1LTIC 1TU3F 2O1JA 1EDJA 1PP9E 5CCHA 3AE3C 1Q7YQ 1JOCA 2FXOA 5CCGC 1FZCC 1YJ9P 2I8DA 5KAFH 2QA4P 2KP8A 4HB1A 4JBZA 1S4XA 1S3JA 3AEAC 1SFCD 2OYOA 5CMZA 2J2PA 1FOSE 4BXLA 1LTJA 2FY8A 4TT3H 1BCCD 1KQGB 1M7LA 3JCUH 3V2PA 3FWNA 3I5CA 1LP1A 1SS1A 1KILE 2KK7A 1GW4A 1SQXE 3H1IG 4DCKA 1NTMD 1SFCA 3E7KA 4DT0A 3KQGA 3L70G 4YTPC 3SWKA 1IFDA 3L75E 3CLQA 1OZHA 2LKMA 4UB8H 2J5ZA 2Z4EA 1K9MQ 3V2QA 4OWFA 3I56P 2Q7CA 1FZEC 4AUWA 2KUBA 1E79H 2JHLF 4R4MA 5KJ7C 1AQTA 4I6MC 3CCEP 4D6TE 3VP8A 2M5AB 3L73J 3AE4C 1EDLA 2L91A 3M06A 2XV5A 3R2PA 3AEGC 1KD1Q 2WITA 3Q5SA 1SQXG 2YMYA 1ZLLA 2FFDA 1T2KC 1JY3O 4L74A 4KT0J 3BCCE 3A5TA 1SQVJ 1ZR4A 1USEA 1YHQP 4JPZB 3H25A 3RL0D 2JEEA 2D39A 1LTSC 2B9BA 5KLVG 1FC2C 5KJ7D 1URQA 3MIWA 3N4XA 1S5LH 1PP9J 1EXJA 1NTKE 3QH9A 1JMBA 4W7YA 4WY4C 2Y9ZA 4H0LB 2IFNA 2HPCB 4ZFGA 2B87A 3I55P 2J0HA 3CWBE 2JJLA 3CXHH 3V4WA 1JCDA 5AVSB 4C46A 3HE4B 2GUVA 3B5NB 4GODA 1VPCA 5CHXA 1T3UA 4W7ZA 1NOHA 2QIWA 2J0GA 1FZAB 4N78E 1L0NK 3OA7A 1G2CB 1PZQA 1QL2A 2AXCA 2KSEA 2N1TC 3H6PA 4TLFA 4B86A 1LWUA 3SSUA 2V4HA 3RGUA 1NJIQ 5KTBA 2N1TB 4C7NA 2YIUB 3V6IA 3L74D 3V2NA 3CX5E 2IZ0A 2C9NY 1N86C 4OH8B 2J3FA 3L72D 1GDTA 3H1LD 2P1JA 4L73A 4N6JA 1VL2A 1Z3UA 3F89A 1VQ5P 1P84E 4WVZA 3H1IE 5CCGD 1LNQA 1DIPA 3D70A 1ZRTD 1U7MA 3RL0C 1FICA 2JHHC 2FYUD 4H13B 2YKPA 4I7ZB 1W5CE 1YTZI 3H1LE 2A06E 3AE1C 2WSFH 2HR3A 2GY7A 5APTA 1SFCB 1K04A 1JY3N 1SQBG 4PD4E 5DJUB 2ZAEB 3SFEC 1ZOYC 1S9KE 2O01H 1JTHA 1HTLC 1JMMA 3V5BA 3OW2O 2KNCA 1CI6A 3C1LA 2YO3A 1IFJA 1GK4A 2BCCD 3CCSP 1MZ9A 1JY2N 1NKNA 1LP1B 1VF5B 2N1TD 1WMKA 5TISH 1FS0E 3R4YA 4LGDE 1Q86Q 5KJ7A 1PGOA 2KOGA 4KJMA 2OGUA 2XNXC 5AVVB 1SQBD 1VQLP 3P32A 5KLIB 4U3FE 3W68A 2R44A 5APYA 2P58A 2IDBA 3U59A 4PV1B 2OYHB 3GHGA 4RJTA 1GZLA 2E5YA 3HE5B 2IX7C 1RF0A 2D2CD 1SQQJ 4BRYB 2PRRA 5CCHD 3LIEA 1U57A 2ZT9C 1S5LE 2H43C 1KILD 3H32C 2KS1B 3CCVP 3G4SP 1FZEB 4PJ0H 5TISE 1KTMA 3M0DC 1DD3A 3P7KA 2MJZA 1YIJP 3N7NA 2WMMA 4M3LA 2Y0DA 1VF5D 2WVRA 2E75C 3G6EP 3H1HE 4I1LA 3A0HE 3GHGB 1LWUC 4JQ0D 3U1AA 5CBOA 4EPUA 2K9JB 3UIAA 4EDFA 1HBWA 1RY3A 5CJ4A 1URQB 1PV3A 1BSHA 3KZIH 3O6QB 1ZR2A 5KLVD 3MP7B 1VDFA 1FZBB 2KZJA 4YXWH 1YQ3C 1RE4B 2FKWB 4PV1C 3C9IA 3CCJP 2WSFJ 1N73B 1KFMA 5GTHH 3HD7B 2K88A 2XNXA 3KXDA 1RE3B 3L4FA 1EZVG 3TGUG 3BCCJ 3G9RA 3CC7P 1LTBC 4DOJA 1BGYD 2M5AA 3Q5RA 1H0TA 2QE7H 1SQXJ 1L4AD 1KYOD 5KAFE 5BVZA 3M9HA 3WU2H 1BE3D 1NGMB 1R8EA 3VYIA 2JO1A 3L71E 3IAOA 1SLQA 1X9VA 2P10A 4M7HA 2IBZD 1NU1J 2Q3EA 1KFNA 1OW7A 3P8CE 3H32A 1PPJG 4ASWA 2HODC 2C0WA 3PP5A 4DJGA 1JNMA 5B66E 4GT1A 4HH2A 1MUUA 1L0NE 3NFQA 1L4AA 1IK7A 1GW3A 4XFJA 4U7JA 1M56D 1T3JA 3ZDMA 3M9BA 2A06D 1YYCA 3BATA 1BGYJ 3PJSK 5K5GB 2NPSC 1KB9D 1N7SA 2H88C 1CSBA 2JP3A 2Y0CA 3H1JJ 1L0ND 1M1JA 3PH0A 3GF3A 3WU2E 3WMM0 3CX5I 2FYUK 4M7FA 2H7HA 4N3YB 3GHGC 2W6BA 3JC22 2MKVA 2N9BA 4PJ0E 3H1IJ 1QVFO 4W80A 2OQQA 5CBNA 1BSNA 3S1KA 3G3ZA 2JHMF 3AE8C 1BGYE 1NTZJ 1NU1D 3RBZA 1FZGA 4HYTB 5B66H 2YMKA 1S9KD 4ASVA 2FYUJ 1EC5A 1NU1K 1RF1C 1PPJE 5AW7B 2Y9YA 3GF7A 3B4SA 4ZKPA 2WWWA 2H43B 2HYNA 1R5SA 2BASA 3RK2B 3L37A 1K73Q 2J58A 2ZYAA 5BU5A 1VQKP 2KLVA 3CCRP 3IR9A 2QJYB 5AW2B 4AQRD 2E42A 1FDOA 1IO4A 4H44C 2XDJA 3H32B 1Q81Q 5KLVE 3H1LG 4IFFA 3L71J 3E1RA 3BVHA 2K3RA 1Y8AA 3FX0A 1FZFA 1M90Q 2HG5D 2ZYDA 2IBZE 5GTHE 1LTJC 5APVA 1EDKA 1KILB 2KSJA 3CXHE 3TSIA 3H1HD 1KC8Q 1VF5C 3M9QA 1SQQK 2J59M 3O8ZA 1N7SB 2E75D 2HPCC 5DJTB 2R32A 3AECC 3B71A 3HD7D 5KKZB 2SPZA 2M3EA 3AE2C 1PGJA 2FXPA 3A3YB 2YXRB 4Y28J 1ZP0C 2A45I 1GU4A 3T97B 2J0YA 2J3OA 2A06G 1WT6A 5AVTB 2Q1KA 1VQ7P 1LT1A 1PFIA 4DZOA 3NTNA 2O01N 1M1JB 1VQMP 4UB6E 3GW6A 1J1EC 1DX7A 2BCCJ 1QGKB 4JYBA 4NPEA 1HWTC 1MKMA 1IZNB 4EIJA 2IZ1A 5GTIH 1LT9C 1EZVE 1DEBA 2CPSA 1M57D 1JY2O 1N2DC 2P2UA 1FZFC 1HJ0A 2KZIA 1OVUA 1L0LD 4WY4D 2KIKA 1X22A 2OYHC 1ZXGA 1W2BO 1QL1A 1SQBJ
chains in the Genus database with same CATH topology
4XA4A 3GHGA 5AVWB 5APQA 1GZLA 1YTZT 3HE5B 1GL2D 4JZCA 1CI6B 2YKOA 2J61A 2IX7C 1RF0A 5CCHC 1GL2C 2JHKF 1JC9A 1JO5A 5CCHD 3LIEA 1FZFB 1NHLA 1G2CA 4EOTA 1A02F 2NPSA 2H43C 2L5GB 3HUSB 1KILD 3B5NC 3H32C 1H88A 4I2LC 3EQ2A 1FZEB 2YNYA 3B5NA 2R5DA 3MTUE 2FIBA 1LWUB 3HE4A 1HGZA 3M0DC 2O1KA 1J1DB 3TNUB 2WT7A 1L0LK 3HE5A 2HLOA 2Q9IB 5AVXB 1SQPK 2W6AA 2Q5UA 1FZAC 3P7KA 4RESB 1XTCC 2MJZA 4IFDK 2HPCA 2JHIF 3N7NA 3HUSA 2NPSD 2J3GA 4M3LA 1ZN5A 2FYZA 3P8CD 2J3UA 5AW9B 2QM8A 2CPBA 3FIBA 4I1LA 2Q3IA 1NAFA 1KQLA 1NH4A 1FZBA 2A45H 1J1DC 4N78D 1H89A 3GHGB 4AYCA 1LWUC 1KZUB 3RK3D 2HLOB 3KYQA 2WT7B 1RF0B 3U1AA 2KB7P 5AW6B 1FBMA 1SQVK 4EPUA 3UIAA 1RF1B 1HBWA 1RY3A 3HUSC 3U1CA 2ZFCA 3VMYA 1NO4A 5CJ4A 1CZQA 1URQB 3E1IA 1NKZB 1LGHB 1IK9A 1ZR2A 1N7SC 1FU1A 2P7JA 3RK2C 1JTHB 1VDFA 1WRGA 3BRVB 1FZBB 5AW3B 5APSA 1RE4B 2Z4EC 2FKWB 2PP6A 2M8RA 3C9IA 3P8MC 1LTIC 1X8YA 2O1JA 1FOSF 4JYCA 2OYHA 5CCHA 2XZRA 1KFMA 1N73B 1T2KD 1JOCA 3HD7B 1HUCA 5CCGC 3V4QA 4R9TA 1FZCC 2KP8A 2J60A 2XNXA 3B8EB 1SFCD 1RE3B 1JY2P 3B5ND 3L4FA 3M91A 1SFCC 5CMZA 2J2PA 3SWYA 1FOSE 1LTBC 2HODA 1KILC 2XKMA 3M0DA 4DOJA 3V2RA 1LTJA 2WPSA 1FZAA 1L4AD 1M7LA 3V2PA 5BVZA 2I1KA 3M9HA 2FFDC 3VYIA 5AW8B 1L4AB 1SQBK 1SLQA 1FZCA 1X9VA 3I5CA 1GW4A 3BRTB 3A2AA 4M7HA 2PAJA 3TK1A 1ZV8A 1FAVA 1SFCA 1RE3A 1RE4C 1HVVA 1KFNA 2P67A 3P8CE 3H32A 3CL3D 1LTJB 2HODC 3KQGA 5BU8B 2C0WA 3PP5A 1LTAC 2Q9IA 1JNMA 1AFOA 2C9LY 4GT1A 1FZBC 1FIBA 1OXZA 4HH2A 1IFIA 2J64A 1IFDA 3CLQA 2OYIA 2W27A 1MUUA 4GKGA 4LC1A 5AW1B 3NFQA 2LKMA 1FZCB 1L4AA 2J5ZA 2Z4EA 1GW3A 3V2QA 5APWA 3HTKB 1M1JC 2Q7CA 1SP4A 4AUWA 1FZEC 1E5WA 2XU6A 1N7LA 2IFMA 2J1GA 1HJBA 2JHLF 1FJKA 3VTPC 1T3JA 1IFMA 2QM7A 5KJ7C 1GK6A 3M9BA 3VOPA 4I6MC 1YYCA 1JCCA 3BATA 3L36A 4Y99B 1JUNA 3VP8A 1GTWA 2NPSC 2H43A 4KHXA 1N7SA 1FIDA 2YKQA 1J1EB 3BASA 1J2JB 1CSBA 3M06A 3NMDA 2XV5A 5CJ0A 3TNUA 1AQ5A 3R2PA 3IFMA 2WITA 5APUA 4WY4A 1M1JA 2YMYA 1ZLLA 2FFDA 3WMM0 1T2KC 2FYUK 1JY3O 4M7FA 2H7HA 4N3YB 3A5TA 3GHGC 1ZR4A 3RL0B 2W6BA 1IFNA 2IPPA 2N9BA 3RL0D 2JEEA 5AVUB 2D39A 1LTSC 1HGVA 4W80A 1Z3SA 2J61B 4C7NB 1LTTC 1FJPA 1SVFA 2ZXEB 5KJ7D 3LIDA 2Z4EB 2OARA 2POHA 3HRNA 1URQA 3MIWA 3G3ZA 3N4XA 5AVQB 1H8AA 2JHMF 3KDPB 1A02J 4IFMA 4W7YA 4WY4C 1LT9B 2WPRA 2J3FD 1IJDB 2IFNA 3EFGA 2HPCB 4ZFGA 4WB4A 1L4AC 4R9JA 2J0HA 3E1IB 2JJLA 3V4WA 1FZGA 4HYTB 3MGNA 1JCDA 1SQXK 5AVSB 1S9KD 1HH0A 1NU1K 4C46A 1RF1C 3HE4B 3OJAB 5AW7B 2GUVA 3B5NB 4ZKPA 1VPCA 1X79B 2WWWA 2H43B 3RK3B 5CHXA 1T3UA 1URQD 2HYNA 3M0AA 4W7ZA 1NOHA 2BASA 3MUDA 1RE4A 2J0GA 3RK2B 1FZAB 2NPSB 3L37A 2R5BA 4N78E 1L0NK 3OA7A 2Z5IA 2FFDB 3T97A 5AVZB 1G2CB 2J58A 2Q9IC 5BU5A 3L35A 4WY4B 2KLVA 4NYTA 3IR9A 4AQRD 5AW2B 2E42A 1QL2A 2N1TC 3H6PA 4ZKUA 3HTKA 1GD2E 1IC2A 4B86A 4C7RA 1FZGC 1N73C 1IO4A 1LWUA 1G1JA 5AW5B 2XDJA 3H32B 5KTBA 1EQ7A 2A45G 1RE3C 2N1TB 1N7SD 2GUSA 3II6A 4C7NA 4IFFA 5AW0B 3BVHA 2H8PD 2Z5HA 3HD7A 3V2NA 1N86A 1FZFA 3RK2D 2C9NY 2HG5D 1JY3P 2R3CA 1KILA 1N86C 1URQC 1LTJC 5APVA 1KILB 2KSJA 4OH8B 2J3FA 1MFZA 1LTGC 1GDTA 2P1JA 4N6JA 2GM4A 1Z3UA 2HLOC 3TSIA 3VMZA 3M9QA 5CCGD 1SQQK 2J59M 4Y99C 1FZDA 1GL2B 3O8ZA 3RL0C 1N7SB 1NTKK 3VN0A 1FICA 2JHHC 5CCGA 2HPCC 2WTYA 2YKPA 3HD7C 2R32A 1GL2A 1FDMA 1DH3A 3HD7D 1YTZI 3NXSA 3A3YB 2WSFH 2E43A 2WZ7A 3MD0A 2A45I 3VMXA 1GU4A 5APTA 2GY7A 2J0YA 1NWQA 1SFCB 2J3OA 1JY3N 3OAKA 2VRSA 2OYIC 1WT6A 5APXA 5AVTB 3VP9A 1T8ZA 1GU5A 2WSEH 1NTZK 2OYHB 1S9KE 2O01H 1JTHA 2WSCH 1HTLC 2OYIB 2HODB 1PFIA 1JMMA 3V5BA 1CI6A 2YO3A 4DZOA 5AW4B 2HFED 3NTNA 1IFJA 1GK4A 1M1JB 4WBAA 1RF1A 1MZ9A 3KPEA 4LLHA 2WPQA 1J1EC 1DX7A 1JY2N 4JYBA 4GIFA 1MV8A 1LT9A 3SWFA 1HWTC 1OWAA 1NKNA 2KYVA 2YO2A 4EIJA 2N1TD 1LT9C 3RK3C 4JF7A 4O9BA 4LGDE 5AVYB 1DEBA 1NTMK 5KJ7A 3TYYA 2C0XA 2CPSA 3LW5H 2KOGA 5KLVK 1N86B 1RF0C 1CW5A 5AVRB 1JY2O 1N2DC 3BVHB 4JYOX 2XNXC 2P2UA 3A7OA 1FZFC 5AVVB 3E1IC 1Z56A 3CI9A 3P32A 2I1JA 1XTGB 4XE5B 1W2EA 4WY4D 2M3BA 5APYA 2XNXB 3BVHC 2FXMA 2OYHC 1G1IA 3U59A 1QL1A 2N1TA 1FZGB 2WNPF 1FZEA 1N73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z3U A;  3GHG A;  2FFD A;  2HLO C;  4JZC A;  4M7F A;  1JY3 O;  4R9T A;  2J61 A;  1FZC C;  1RF0 A;  2JHK F;  3GHG C;  1JC9 A;  1FZD A;  2J60 A;  2XNX A;  1FIC A;  2JHH C;  1FZF B;  2HPC C;  1RE3 B;  1JY2 P;  2D39 A;  2H43 C;  3HUS B;  1Z3S A;  2J61 B;  2J2P A;  3H32 C;  2HOD A;  2Z4E B;  1N73 A;  1LTJ A;  1FZE B;  2A45 I;  2GY7 A;  2J0Y A;  2JHM F;  2J3O A;  2FIB A;  1JY3 N;  1LWU B;  1LT9 B;  2OYI C;  2J3F D;  1FZA A;  2FFD C;  2HPC B;  4ZFG A;  2HLO A;  2Q9I B;  4R9J A;  2J0H A;  3E1I B;  1FZC A;  1FZA C;  1FZG A;  2OYI B;  2HOD B;  4M7H A;  2HPC A;  2JHI F;  3HUS A;  2J3G A;  1RF1 C;  1RE3 A;  1RE4 C;  2OYH A;  2J3U A;  3H32 A;  1LTJ B;  1M1J B;  2H43 B;  2HOD C;  1T3U A;  1RF1 A;  1FZB C;  2Q9I A;  1FIB A;  1JY2 N;  1RE4 A;  3FIB A;  2J0G A;  1FZA B;  2J64 A;  1LT9 A;  2OYI A;  2FFD B;  1FZB A;  2A45 H;  2Q9I C;  3GHG B;  1FZC B;  1LWU C;  2J5Z A;  2Z4E A;  4NYT A;  1LT9 C;  2HLO B;  1RF0 B;  1M1J C;  1FZE C;  1FZG C;  1N73 C;  1LWU A;  4EPU A;  1RF1 B;  3HUS C;  3H32 B;  3E1I A;  2J1G A;  1N86 B;  2JHL F;  1RF0 C;  2A45 G;  1RE3 C;  1JY2 O;  3BVH B;  4JYO X;  2XNX C;  1FZF C;  3BVH A;  3E1I C;  1N86 A;  1W2E A;  2H43 A;  1FZF A;  1FID A;  1FZB B;  2XNX B;  3BVH C;  1JY3 P;  2OYH C;  1N86 C;  1LTJ C;  1RE4 B;  2Z4E C;  2J3F A;  1FZG B;  2WNP F;  1M1J A;  1FZE A;  1N73 B;  2OYH B; 
#chains in the Genus database with same CATH topology
 3PHL A;  1GL2 D;  4JZC A;  2J61 A;  3PLN A;  3L72 J;  1SQQ E;  4CPG A;  2RKL A;  1FZF B;  1L0L E;  2G3A A;  1G2C A;  2V7Q H;  2JDI H;  2QRX A;  3O6Q A;  3L75 D;  1QLE D;  3L74 J;  3WUT A;  1H88 A;  2YNY A;  4PD4 D;  3HE4 A;  2G8Y A;  2O1K A;  2IYO A;  2Q9I B;  2E74 D;  2HPC A;  1L2P A;  2GA1 A;  3HUS A;  2NPS D;  1BCC G;  1Q82 Q;  2FYZ A;  1ZRT E;  3TGU J;  3CC2 P;  1EDI A;  4HKZ H;  4L76 A;  1NH4 A;  1FZB A;  3FXD A;  1H89 A;  2JWA A;  1KZU B;  2HLO B;  2WT7 B;  2NZ2 A;  1SQV K;  1RF1 B;  1U7J A;  2E76 B;  1N8R Q;  3VMY A;  1PPJ D;  1NO4 A;  1CZQ A;  1LGH B;  1IK9 A;  1PP9 D;  1OW8 A;  2ZYG A;  1FU1 A;  2P7J A;  2E74 C;  1NTM J;  2IBZ G;  3CXH D;  1JM0 A;  3P8M C;  1FOS F;  1X8Y A;  1R5L A;  2OYH A;  4JYC A;  2XZR A;  1Q90 D;  2CK3 H;  4U3F G;  4R9T A;  3TDK A;  3TGU D;  1JY2 P;  2WSC J;  3M91 A;  1SFC C;  3SWY A;  1KIL C;  2FYU E;  3SFD C;  3M0D A;  2DW3 A;  3Q1M A;  1OMI A;  3IN6 A;  1P84 D;  1OVR A;  1L4A B;  1SQB K;  3GMA A;  1FZC A;  3BRT B;  3A2A A;  2QG4 A;  3TK1 A;  1OW6 A;  3A0H H;  1USD A;  1HVV A;  3CWB G;  1LTJ B;  5BU8 B;  3F5H A;  1LTA C;  2Q9I A;  1AFO A;  1FIB A;  5H2F H;  1OVV A;  1IFI A;  2PFX A;  2YXQ B;  2W27 A;  3CCQ P;  3KZI E;  2D2C C;  2W90 A;  1NTZ G;  5APW A;  3HTK B;  1SP4 A;  1L0L J;  1NVO A;  1E5W A;  2XU6 A;  1N7L A;  2FYU G;  2IFM A;  2J1G A;  1BCC J;  1HJB A;  3VTP C;  2QM7 A;  1L0N G;  4D6T J;  3VOP A;  2WSS H;  1SQP J;  2H43 A;  3BCC G;  2YKQ A;  1KN7 A;  1J2J B;  1S72 P;  1KB9 H;  1BDC A;  3NMD A;  5CJ0 A;  1AQ5 A;  3IFM A;  1YI2 P;  3G71 P;  3CME P;  3FWL A;  3JCU E;  2ZT9 B;  2K9Y A;  1AVO A;  2IPP A;  3EFF K;  1EXI A;  2ZJS E;  4H44 D;  5AVU B;  1VQ9 P;  1NTM G;  2LR2 A;  4C7N B;  1LTT C;  1FJP A;  1SVF A;  2ZXE B;  3LID A;  2OAR A;  2AXT E;  2K1A A;  5AVQ B;  4NPD A;  3KDP B;  1LT9 B;  2WPR A;  1IJD B;  1JEK A;  4Z1M H;  3L70 E;  1L4A C;  4R9J A;  3MGN A;  1SQX K;  1KMI Z;  3AEF C;  3C8V A;  1KYO H;  4UB6 H;  1BGY G;  1URQ D;  3M0A A;  3MUD A;  1EZV I;  4HJG H;  2NPS B;  2R5B A;  2Q9I C;  2Z5I A;  3T97 A;  5AVZ B;  4RO0 A;  4WY4 B;  2B87 B;  4ZKU A;  1NTM E;  1G1J A;  1SQQ G;  5KAI H;  2GUS A;  2BEQ D;  2OTL P;  4IL6 X;  5AW0 B;  4OGQ C;  2H8P D;  3HD7 A;  3L70 J;  3PRJ A;  1PGP A;  3S4R A;  1JY3 P;  2R3C A;  1KIL A;  1GMJ A;  1URQ C;  1YIT P;  3Q2Y A;  1VQP P;  2QJK B;  2IBZ I;  4IL6 H;  3CCL P;  1BCC E;  3VMZ A;  1FZD A;  3H1K E;  4Y99 C;  5M1B A;  4D6T G;  2WTY A;  1RHZ B;  1BDD A;  3H1J E;  1SQP G;  1FDM A;  1YJN P;  1OFC X;  1RQU A;  2ITA A;  1NAY A;  3VMX A;  2VRS A;  1GU5 A;  2M0B A;  2WSE H;  4U3F D;  3AE7 C;  3L72 G;  1Y47 A;  2HOD B;  1ZW0 A;  3AE5 C;  2E76 D;  3L71 G;  4I7Z C;  3RK3 E;  1FDI A;  3A0B E;  1RF1 A;  3KPE A;  2WPQ A;  4EYY Q;  2K37 A;  1SQB E;  3SWF A;  3L75 J;  2YIU C;  3H1K J;  3IF4 A;  2OTJ P;  2KS1 A;  4JF7 A;  2QEX P;  2BCC E;  3CMA P;  1QVG O;  1NTM K;  3D71 A;  3TYY A;  1NTZ E;  3LW5 H;  1N86 B;  1RF0 C;  5AVR B;  2AXT H;  3BVH B;  4OGQ D;  3A7O A;  2H89 C;  4A7P A;  1QX8 A;  2I1J A;  1XTG B;  1W2E A;  5H2F E;  2KI7 B;  3Q3D A;  3BVH C;  2AEJ A;  1RH5 B;  2JWD A;  1KB9 I;  1S5L X;  2O3J A;  5AVW B;  3H1H J;  3MZW B;  5APQ A;  4PD4 H;  1PL5 A;  5CCH C;  2JHK F;  1JC9 A;  3CC4 P;  1JO5 A;  3D6Z A;  1A02 F;  2L5G B;  2QSI A;  2ZT9 D;  2W8Z A;  3B5N C;  3EQ2 A;  1D7M A;  2BCC G;  2BEZ F;  2R5D A;  2FIB A;  1LWU B;  1RQV A;  3TGU E;  1KQS O;  2WT7 A;  3HE5 A;  3S9O A;  2HLO A;  1AJY A;  5AVX B;  2Y0E A;  2W6A A;  2Q5U A;  3D6Y A;  1FZA C;  1Q2N A;  4IFD K;  2JHI F;  2J3G A;  1ZN5 A;  2E76 C;  3GG2 A;  1KV4 A;  1KB9 E;  5AW9 B;  2JKV A;  2QM8 A;  2CPB A;  4YXD C;  2WPV B;  3FIB A;  2WSE J;  1NAF A;  1KQL A;  4N78 D;  1NU1 E;  4GDO A;  4GOF A;  4L75 A;  3CX5 H;  1FBM A;  3K5B A;  3HUS C;  4YPC A;  1NKZ B;  4UB8 E;  3RK2 C;  4EI2 A;  1WRG A;  3BRV B;  2N9Y B;  1P84 H;  3WUV A;  3L74 G;  5AW3 B;  3H1I D;  4NPF X;  1KYO I;  2Z4E C;  3L74 E;  2FYN C;  1Y9B A;  2PP6 A;  4H0L D;  3LW5 J;  3L71 D;  2RN0 A;  2XND H;  3L72 E;  1T2K D;  1HUC A;  3V4Q A;  1L0N J;  2J60 A;  3B8E B;  3BCC D;  1VQO P;  2O01 J;  2W83 C;  3B5N D;  2ZXX A;  5C39 A;  1BE3 G;  4ZNC A;  2HOD A;  2XKM A;  3VMA A;  3V2R A;  5KKZ C;  2WPS A;  1FZA A;  2FFD C;  2I1K A;  3H1H G;  5AW8 B;  3PTZ A;  1NTK J;  4H13 D;  4H0L C;  2PAJ A;  1S1C X;  1ZV8 A;  1NTZ D;  1FAV A;  1RE3 A;  1RE4 C;  1SQQ D;  2P67 A;  3CL3 D;  5KLV J;  1FZB C;  2RMZ A;  2C9L Y;  1OXZ A;  1AA0 A;  2J64 A;  2OYI A;  4GKG A;  4LC1 A;  5AW1 B;  3CWB D;  1MFT A;  1FZC B;  1ZME C;  1HF9 A;  1BE3 E;  1M1J C;  1NTK D;  1EZV D;  1DD4 A;  1FJK A;  1SQX D;  1IFM A;  2ZVO B;  1GK6 A;  3USS A;  1JCC A;  3L36 A;  4Y99 B;  1JUN A;  2W6J H;  3H1J D;  1GTW A;  4KHX A;  1FID A;  1M8O B;  1J1E B;  3BAS A;  3TNU A;  3H1K D;  5APU A;  4WY4 A;  2QJP C;  3Q5P A;  3RL0 B;  3JSV C;  1IFN A;  2RH0 A;  1DEE G;  2LXB A;  5EFW B;  2E75 B;  1HGV A;  4PD4 I;  3AEE C;  2R3S A;  1Z3S A;  2J61 B;  2LXC B;  3CWB J;  2Z4E B;  2POH A;  3HRN A;  1H8A A;  2UWJ E;  1A02 J;  4IFM A;  2J3F D;  3EFG A;  4WB4 A;  2J5U A;  1OX3 A;  4K35 A;  3E1I B;  2V7Q J;  4IL6 E;  3ITK A;  1HH0 A;  2QJK C;  3OJA B;  1BE3 J;  1X79 B;  1M1K Q;  3RK3 B;  4BRY A;  1RE4 A;  1AVY A;  2AEF A;  2FFD B;  3AED C;  3L35 A;  4K3A A;  3TF5 A;  4NYT A;  3AEB C;  1UII A;  3HTK A;  1GD2 E;  1IC2 A;  4C7R A;  1FZG C;  1N73 C;  1QEX A;  5AW5 B;  2OTK E;  1EQ7 A;  2A45 G;  1RE3 C;  1SQV G;  1N7S D;  3II6 A;  4IOI H;  1YJW P;  3FGA D;  3QWO C;  2Z5H A;  5KLI C;  1N86 A;  2KLU A;  3RK2 D;  3CPW O;  3L75 G;  3L73 E;  4QMA A;  2Q6Q A;  1MFZ A;  1LTG C;  3FXE A;  2GM4 A;  1YQ4 C;  1OIP A;  2IYP A;  3WUU A;  2HLO C;  1VQ4 P;  3CCM P;  3RL0 g;  3GLM A;  1GL2 B;  3VN0 A;  1NTK K;  1X0T A;  5CCG A;  3HD7 C;  1GL2 A;  4RKU J;  1DH3 A;  2E5T A;  2KNC B;  3NXS A;  3CCU P;  2FYN B;  2E43 A;  2WZ7 A;  5E79 E;  3MUD C;  3MD0 A;  3H1J G;  4GOE A;  1NWQ A;  3OAK A;  2OYI C;  3KHU A;  5APX A;  3VP9 A;  1T8Z A;  2B88 A;  1SQP E;  1NTZ K;  2WSC H;  4R4L A;  2OYI B;  1P84 I;  1S2E A;  3L70 D;  5AW4 B;  2HFE D;  1KOR A;  4H44 B;  1SQV D;  4WBA A;  4LLH A;  1K05 A;  4GIF A;  1MV8 A;  5B5E H;  1LT9 A;  1OWA A;  2KYV A;  2YO2 A;  3ABV C;  3RK3 C;  4O9B A;  4U3F J;  5AVY B;  1H0T B;  1SQV E;  2C0X A;  5KLV K;  1CW5 A;  4JYO X;  3E1I C;  1Z56 A;  3CI9 A;  3W67 A;  4OGQ B;  4XE5 B;  2KXP B;  2M3B A;  2QVA A;  2XNX B;  2FXM A;  5TJH A;  3AE9 C;  4PV1 D;  1G1I A;  5GTI E;  2ZVN B;  2N1T A;  1FZG B;  1K8A Q;  2WNP F;  1FZE A;  1N73 A;  4XA4 A;  2D2C B;  4BWN A;  1YTZ T;  3CXH I;  1CI6 B;  2YKO A;  1GL2 C;  3H1L J;  2E74 B;  1NHL A;  3CX5 D;  4EOT A;  2NPS A;  2FBW C;  3HUS B;  1NYH A;  4I2L C;  5L8R J;  3B5N A;  1JB0 J;  3MTU E;  2QJY C;  1HGZ A;  3EWK A;  1J1D B;  3TNU B;  3H1K G;  1L0L K;  1UIX A;  5E79 H;  2WQY C;  1FE6 A;  1SQP K;  2PGD A;  4OVN F;  5B5E E;  2QJP B;  4RES B;  1VQN P;  1L0L G;  1XTC C;  3A0B H;  2JR8 A;  1LJ2 A;  4MN4 C;  3CD6 P;  3L73 D;  1SQP D;  3RBX A;  3P8C D;  2J3U A;  1PIX A;  4WWI A;  4D6T D;  3MHV A;  2B89 A;  1KQF B;  3L73 G;  5KAI E;  2Q3I A;  1AV1 A;  1PGQ A;  2A45 H;  4ZMD A;  1J1D C;  4AYC A;  3AE6 C;  3RK3 D;  3KYQ A;  1NTK G;  1RF0 B;  2KB7 P;  5AW6 B;  1VQ6 P;  3U1C A;  2ZFC A;  1NU1 G;  3E1I A;  2K9J A;  4H13 C;  1T6A A;  1N7S C;  2AEM A;  1VQ8 P;  2NRG A;  1KYO E;  1JTH B;  1IFP A;  5APS A;  1PP9 G;  2M8R A;  1YBK A;  1LTI C;  1TU3 F;  2O1J A;  1EDJ A;  1PP9 E;  5CCH A;  3AE3 C;  1Q7Y Q;  1JOC A;  2FXO A;  5CCG C;  1FZC C;  1YJ9 P;  2I8D A;  5KAF H;  2QA4 P;  2KP8 A;  4HB1 A;  4JBZ A;  1S4X A;  1S3J A;  3AEA C;  1SFC D;  2OYO A;  5CMZ A;  2J2P A;  1FOS E;  4BXL A;  1LTJ A;  2FY8 A;  4TT3 H;  1BCC D;  1KQG B;  1M7L A;  3JCU H;  3V2P A;  3FWN A;  3I5C A;  1LP1 A;  1SS1 A;  1KIL E;  2KK7 A;  1GW4 A;  1SQX E;  3H1I G;  4DCK A;  1NTM D;  1SFC A;  3E7K A;  4DT0 A;  3KQG A;  3L70 G;  4YTP C;  3SWK A;  1IFD A;  3L75 E;  3CLQ A;  1OZH A;  2LKM A;  4UB8 H;  2J5Z A;  2Z4E A;  1K9M Q;  3V2Q A;  4OWF A;  3I56 P;  2Q7C A;  1FZE C;  4AUW A;  2KUB A;  1E79 H;  2JHL F;  4R4M A;  5KJ7 C;  1AQT A;  4I6M C;  3CCE P;  4D6T E;  3VP8 A;  2M5A B;  3L73 J;  3AE4 C;  1EDL A;  2L91 A;  3M06 A;  2XV5 A;  3R2P A;  3AEG C;  1KD1 Q;  2WIT A;  3Q5S A;  1SQX G;  2YMY A;  1ZLL A;  2FFD A;  1T2K C;  1JY3 O;  4L74 A;  4KT0 J;  3BCC E;  3A5T A;  1SQV J;  1ZR4 A;  1USE A;  1YHQ P;  4JPZ B;  3H25 A;  3RL0 D;  2JEE A;  2D39 A;  1LTS C;  2B9B A;  5KLV G;  1FC2 C;  5KJ7 D;  1URQ A;  3MIW A;  3N4X A;  1S5L H;  1PP9 J;  1EXJ A;  1NTK E;  3QH9 A;  1JMB A;  4W7Y A;  4WY4 C;  2Y9Z A;  4H0L B;  2IFN A;  2HPC B;  4ZFG A;  2B87 A;  3I55 P;  2J0H A;  3CWB E;  2JJL A;  3CXH H;  3V4W A;  1JCD A;  5AVS B;  4C46 A;  3HE4 B;  2GUV A;  3B5N B;  4GOD A;  1VPC A;  5CHX A;  1T3U A;  4W7Z A;  1NOH A;  2QIW A;  2J0G A;  1FZA B;  4N78 E;  1L0N K;  3OA7 A;  1G2C B;  1PZQ A;  1QL2 A;  2AXC A;  2KSE A;  2N1T C;  3H6P A;  4TLF A;  4B86 A;  1LWU A;  3SSU A;  2V4H A;  3RGU A;  1NJI Q;  5KTB A;  2N1T B;  4C7N A;  2YIU B;  3V6I A;  3L74 D;  3V2N A;  3CX5 E;  2IZ0 A;  2C9N Y;  1N86 C;  4OH8 B;  2J3F A;  3L72 D;  1GDT A;  3H1L D;  2P1J A;  4L73 A;  4N6J A;  1VL2 A;  1Z3U A;  3F89 A;  1VQ5 P;  1P84 E;  4WVZ A;  3H1I E;  5CCG D;  1LNQ A;  1DIP A;  3D70 A;  1ZRT D;  1U7M A;  3RL0 C;  1FIC A;  2JHH C;  2FYU D;  4H13 B;  2YKP A;  4I7Z B;  1W5C E;  1YTZ I;  3H1L E;  2A06 E;  3AE1 C;  2WSF H;  2HR3 A;  2GY7 A;  5APT A;  1SFC B;  1K04 A;  1JY3 N;  1SQB G;  4PD4 E;  5DJU B;  2ZAE B;  3SFE C;  1ZOY C;  1S9K E;  2O01 H;  1JTH A;  1HTL C;  1JMM A;  3V5B A;  3OW2 O;  2KNC A;  1CI6 A;  3C1L A;  2YO3 A;  1IFJ A;  1GK4 A;  2BCC D;  3CCS P;  1MZ9 A;  1JY2 N;  1NKN A;  1LP1 B;  1VF5 B;  2N1T D;  1WMK A;  5TIS H;  1FS0 E;  3R4Y A;  4LGD E;  1Q86 Q;  5KJ7 A;  1PGO A;  2KOG A;  4KJM A;  2OGU A;  2XNX C;  5AVV B;  1SQB D;  1VQL P;  3P32 A;  5KLI B;  4U3F E;  3W68 A;  2R44 A;  5APY A;  2P58 A;  2IDB A;  3U59 A;  4PV1 B;  2OYH B;  3GHG A;  4RJT A;  1GZL A;  2E5Y A;  3HE5 B;  2IX7 C;  1RF0 A;  2D2C D;  1SQQ J;  4BRY B;  2PRR A;  5CCH D;  3LIE A;  1U57 A;  2ZT9 C;  1S5L E;  2H43 C;  1KIL D;  3H32 C;  2KS1 B;  3CCV P;  3G4S P;  1FZE B;  4PJ0 H;  5TIS E;  1KTM A;  3M0D C;  1DD3 A;  3P7K A;  2MJZ A;  1YIJ P;  3N7N A;  2WMM A;  4M3L A;  2Y0D A;  1VF5 D;  2WVR A;  2E75 C;  3G6E P;  3H1H E;  4I1L A;  3A0H E;  3GHG B;  1LWU C;  4JQ0 D;  3U1A A;  5CBO A;  4EPU A;  2K9J B;  3UIA A;  4EDF A;  1HBW A;  1RY3 A;  5CJ4 A;  1URQ B;  1PV3 A;  1BSH A;  3KZI H;  3O6Q B;  1ZR2 A;  5KLV D;  3MP7 B;  1VDF A;  1FZB B;  2KZJ A;  4YXW H;  1YQ3 C;  1RE4 B;  2FKW B;  4PV1 C;  3C9I A;  3CCJ P;  2WSF J;  1N73 B;  1KFM A;  5GTH H;  3HD7 B;  2K88 A;  2XNX A;  3KXD A;  1RE3 B;  3L4F A;  1EZV G;  3TGU G;  3BCC J;  3G9R A;  3CC7 P;  1LTB C;  4DOJ A;  1BGY D;  2M5A A;  3Q5R A;  1H0T A;  2QE7 H;  1SQX J;  1L4A D;  1KYO D;  5KAF E;  5BVZ A;  3M9H A;  3WU2 H;  1BE3 D;  1NGM B;  1R8E A;  3VYI A;  2JO1 A;  3L71 E;  3IAO A;  1SLQ A;  1X9V A;  2P10 A;  4M7H A;  2IBZ D;  1NU1 J;  2Q3E A;  1KFN A;  1OW7 A;  3P8C E;  3H32 A;  1PPJ G;  4ASW A;  2HOD C;  2C0W A;  3PP5 A;  4DJG A;  1JNM A;  5B66 E;  4GT1 A;  4HH2 A;  1MUU A;  1L0N E;  3NFQ A;  1L4A A;  1IK7 A;  1GW3 A;  4XFJ A;  4U7J A;  1M56 D;  1T3J A;  3ZDM A;  3M9B A;  2A06 D;  1YYC A;  3BAT A;  1BGY J;  3PJS K;  5K5G B;  2NPS C;  1KB9 D;  1N7S A;  2H88 C;  1CSB A;  2JP3 A;  2Y0C A;  3H1J J;  1L0N D;  1M1J A;  3PH0 A;  3GF3 A;  3WU2 E;  3WMM 0;  3CX5 I;  2FYU K;  4M7F A;  2H7H A;  4N3Y B;  3GHG C;  2W6B A;  3JC2 2;  2MKV A;  2N9B A;  4PJ0 E;  3H1I J;  1QVF O;  4W80 A;  2OQQ A;  5CBN A;  1BSN A;  3S1K A;  3G3Z A;  2JHM F;  3AE8 C;  1BGY E;  1NTZ J;  1NU1 D;  3RBZ A;  1FZG A;  4HYT B;  5B66 H;  2YMK A;  1S9K D;  4ASV A;  2FYU J;  1EC5 A;  1NU1 K;  1RF1 C;  1PPJ E;  5AW7 B;  2Y9Y A;  3GF7 A;  3B4S A;  4ZKP A;  2WWW A;  2H43 B;  2HYN A;  1R5S A;  2BAS A;  3RK2 B;  3L37 A;  1K73 Q;  2J58 A;  2ZYA A;  5BU5 A;  1VQK P;  2KLV A;  3CCR P;  3IR9 A;  2QJY B;  5AW2 B;  4AQR D;  2E42 A;  1FDO A;  1IO4 A;  4H44 C;  2XDJ A;  3H32 B;  1Q81 Q;  5KLV E;  3H1L G;  4IFF A;  3L71 J;  3E1R A;  3BVH A;  2K3R A;  1Y8A A;  3FX0 A;  1FZF A;  1M90 Q;  2HG5 D;  2ZYD A;  2IBZ E;  5GTH E;  1LTJ C;  5APV A;  1EDK A;  1KIL B;  2KSJ A;  3CXH E;  3TSI A;  3H1H D;  1KC8 Q;  1VF5 C;  3M9Q A;  1SQQ K;  2J59 M;  3O8Z A;  1N7S B;  2E75 D;  2HPC C;  5DJT B;  2R32 A;  3AEC C;  3B71 A;  3HD7 D;  5KKZ B;  2SPZ A;  2M3E A;  3AE2 C;  1PGJ A;  2FXP A;  3A3Y B;  2YXR B;  4Y28 J;  1ZP0 C;  2A45 I;  1GU4 A;  3T97 B;  2J0Y A;  2J3O A;  2A06 G;  1WT6 A;  5AVT B;  2Q1K A;  1VQ7 P;  1LT1 A;  1PFI A;  4DZO A;  3NTN A;  2O01 N;  1M1J B;  1VQM P;  4UB6 E;  3GW6 A;  1J1E C;  1DX7 A;  2BCC J;  1QGK B;  4JYB A;  4NPE A;  1HWT C;  1MKM A;  1IZN B;  4EIJ A;  2IZ1 A;  5GTI H;  1LT9 C;  1EZV E;  1DEB A;  2CPS A;  1M57 D;  1JY2 O;  1N2D C;  2P2U A;  1FZF C;  1HJ0 A;  2KZI A;  1OVU A;  1L0L D;  4WY4 D;  2KIK A;  1X22 A;  2OYH C;  1ZXG A;  1W2B O;  1QL1 A;  1SQB J; 
#chains in the Genus database with same CATH homology
 4XA4 A;  3GHG A;  5AVW B;  5APQ A;  1GZL A;  1YTZ T;  3HE5 B;  1GL2 D;  4JZC A;  1CI6 B;  2YKO A;  2J61 A;  2IX7 C;  1RF0 A;  5CCH C;  1GL2 C;  2JHK F;  1JC9 A;  1JO5 A;  5CCH D;  3LIE A;  1FZF B;  1NHL A;  1G2C A;  4EOT A;  1A02 F;  2NPS A;  2H43 C;  2L5G B;  3HUS B;  1KIL D;  3B5N C;  3H32 C;  1H88 A;  4I2L C;  3EQ2 A;  1FZE B;  2YNY A;  3B5N A;  2R5D A;  3MTU E;  2FIB A;  1LWU B;  3HE4 A;  1HGZ A;  3M0D C;  2O1K A;  1J1D B;  3TNU B;  2WT7 A;  1L0L K;  3HE5 A;  2HLO A;  2Q9I B;  5AVX B;  1SQP K;  2W6A A;  2Q5U A;  1FZA C;  3P7K A;  4RES B;  1XTC C;  2MJZ A;  4IFD K;  2HPC A;  2JHI F;  3N7N A;  3HUS A;  2NPS D;  2J3G A;  4M3L A;  1ZN5 A;  2FYZ A;  3P8C D;  2J3U A;  5AW9 B;  2QM8 A;  2CPB A;  3FIB A;  4I1L A;  2Q3I A;  1NAF A;  1KQL A;  1NH4 A;  1FZB A;  2A45 H;  1J1D C;  4N78 D;  1H89 A;  3GHG B;  4AYC A;  1LWU C;  1KZU B;  3RK3 D;  2HLO B;  3KYQ A;  2WT7 B;  1RF0 B;  3U1A A;  2KB7 P;  5AW6 B;  1FBM A;  1SQV K;  4EPU A;  3UIA A;  1RF1 B;  1HBW A;  1RY3 A;  3HUS C;  3U1C A;  2ZFC A;  3VMY A;  1NO4 A;  5CJ4 A;  1CZQ A;  1URQ B;  3E1I A;  1NKZ B;  1LGH B;  1IK9 A;  1ZR2 A;  1N7S C;  1FU1 A;  2P7J A;  3RK2 C;  1JTH B;  1VDF A;  1WRG A;  3BRV B;  1FZB B;  5AW3 B;  5APS A;  1RE4 B;  2Z4E C;  2FKW B;  2PP6 A;  2M8R A;  3C9I A;  3P8M C;  1LTI C;  1X8Y A;  2O1J A;  1FOS F;  4JYC A;  2OYH A;  5CCH A;  2XZR A;  1KFM A;  1N73 B;  1T2K D;  1JOC A;  3HD7 B;  1HUC A;  5CCG C;  3V4Q A;  4R9T A;  1FZC C;  2KP8 A;  2J60 A;  2XNX A;  3B8E B;  1SFC D;  1RE3 B;  1JY2 P;  3B5N D;  3L4F A;  3M91 A;  1SFC C;  5CMZ A;  2J2P A;  3SWY A;  1FOS E;  1LTB C;  2HOD A;  1KIL C;  2XKM A;  3M0D A;  4DOJ A;  3V2R A;  1LTJ A;  2WPS A;  1FZA A;  1L4A D;  1M7L A;  3V2P A;  5BVZ A;  2I1K A;  3M9H A;  2FFD C;  3VYI A;  5AW8 B;  1L4A B;  1SQB K;  1SLQ A;  1FZC A;  1X9V A;  3I5C A;  1GW4 A;  3BRT B;  3A2A A;  4M7H A;  2PAJ A;  3TK1 A;  1ZV8 A;  1FAV A;  1SFC A;  1RE3 A;  1RE4 C;  1HVV A;  1KFN A;  2P67 A;  3P8C E;  3H32 A;  3CL3 D;  1LTJ B;  2HOD C;  3KQG A;  5BU8 B;  2C0W A;  3PP5 A;  1LTA C;  2Q9I A;  1JNM A;  1AFO A;  2C9L Y;  4GT1 A;  1FZB C;  1FIB A;  1OXZ A;  4HH2 A;  1IFI A;  2J64 A;  1IFD A;  3CLQ A;  2OYI A;  2W27 A;  1MUU A;  4GKG A;  4LC1 A;  5AW1 B;  3NFQ A;  2LKM A;  1FZC B;  1L4A A;  2J5Z A;  2Z4E A;  1GW3 A;  3V2Q A;  5APW A;  3HTK B;  1M1J C;  2Q7C A;  1SP4 A;  4AUW A;  1FZE C;  1E5W A;  2XU6 A;  1N7L A;  2IFM A;  2J1G A;  1HJB A;  2JHL F;  1FJK A;  3VTP C;  1T3J A;  1IFM A;  2QM7 A;  5KJ7 C;  1GK6 A;  3M9B A;  3VOP A;  4I6M C;  1YYC A;  1JCC A;  3BAT A;  3L36 A;  4Y99 B;  1JUN A;  3VP8 A;  1GTW A;  2NPS C;  2H43 A;  4KHX A;  1N7S A;  1FID A;  2YKQ A;  1J1E B;  3BAS A;  1J2J B;  1CSB A;  3M06 A;  3NMD A;  2XV5 A;  5CJ0 A;  3TNU A;  1AQ5 A;  3R2P A;  3IFM A;  2WIT A;  5APU A;  4WY4 A;  1M1J A;  2YMY A;  1ZLL A;  2FFD A;  3WMM 0;  1T2K C;  2FYU K;  1JY3 O;  4M7F A;  2H7H A;  4N3Y B;  3A5T A;  3GHG C;  1ZR4 A;  3RL0 B;  2W6B A;  1IFN A;  2IPP A;  2N9B A;  3RL0 D;  2JEE A;  5AVU B;  2D39 A;  1LTS C;  1HGV A;  4W80 A;  1Z3S A;  2J61 B;  4C7N B;  1LTT C;  1FJP A;  1SVF A;  2ZXE B;  5KJ7 D;  3LID A;  2Z4E B;  2OAR A;  2POH A;  3HRN A;  1URQ A;  3MIW A;  3G3Z A;  3N4X A;  5AVQ B;  1H8A A;  2JHM F;  3KDP B;  1A02 J;  4IFM A;  4W7Y A;  4WY4 C;  1LT9 B;  2WPR A;  2J3F D;  1IJD B;  2IFN A;  3EFG A;  2HPC B;  4ZFG A;  4WB4 A;  1L4A C;  4R9J A;  2J0H A;  3E1I B;  2JJL A;  3V4W A;  1FZG A;  4HYT B;  3MGN A;  1JCD A;  1SQX K;  5AVS B;  1S9K D;  1HH0 A;  1NU1 K;  4C46 A;  1RF1 C;  3HE4 B;  3OJA B;  5AW7 B;  2GUV A;  3B5N B;  4ZKP A;  1VPC A;  1X79 B;  2WWW A;  2H43 B;  3RK3 B;  5CHX A;  1T3U A;  1URQ D;  2HYN A;  3M0A A;  4W7Z A;  1NOH A;  2BAS A;  3MUD A;  1RE4 A;  2J0G A;  3RK2 B;  1FZA B;  2NPS B;  3L37 A;  2R5B A;  4N78 E;  1L0N K;  3OA7 A;  2Z5I A;  2FFD B;  3T97 A;  5AVZ B;  1G2C B;  2J58 A;  2Q9I C;  5BU5 A;  3L35 A;  4WY4 B;  2KLV A;  4NYT A;  3IR9 A;  4AQR D;  5AW2 B;  2E42 A;  1QL2 A;  2N1T C;  3H6P A;  4ZKU A;  3HTK A;  1GD2 E;  1IC2 A;  4B86 A;  4C7R A;  1FZG C;  1N73 C;  1IO4 A;  1LWU A;  1G1J A;  5AW5 B;  2XDJ A;  3H32 B;  5KTB A;  1EQ7 A;  2A45 G;  1RE3 C;  2N1T B;  1N7S D;  2GUS A;  3II6 A;  4C7N A;  4IFF A;  5AW0 B;  3BVH A;  2H8P D;  2Z5H A;  3HD7 A;  3V2N A;  1N86 A;  1FZF A;  3RK2 D;  2C9N Y;  2HG5 D;  1JY3 P;  2R3C A;  1KIL A;  1N86 C;  1URQ C;  1LTJ C;  5APV A;  1KIL B;  2KSJ A;  4OH8 B;  2J3F A;  1MFZ A;  1LTG C;  1GDT A;  2P1J A;  4N6J A;  2GM4 A;  1Z3U A;  2HLO C;  3TSI A;  3VMZ A;  3M9Q A;  5CCG D;  1SQQ K;  2J59 M;  4Y99 C;  1FZD A;  1GL2 B;  3O8Z A;  3RL0 C;  1N7S B;  1NTK K;  3VN0 A;  1FIC A;  2JHH C;  5CCG A;  2HPC C;  2WTY A;  2YKP A;  3HD7 C;  2R32 A;  1GL2 A;  1FDM A;  1DH3 A;  3HD7 D;  1YTZ I;  3NXS A;  3A3Y B;  2WSF H;  2E43 A;  2WZ7 A;  3MD0 A;  2A45 I;  3VMX A;  1GU4 A;  5APT A;  2GY7 A;  2J0Y A;  1NWQ A;  1SFC B;  2J3O A;  1JY3 N;  3OAK A;  2VRS A;  2OYI C;  1WT6 A;  5APX A;  5AVT B;  3VP9 A;  1T8Z A;  1GU5 A;  2WSE H;  1NTZ K;  2OYH B;  1S9K E;  2O01 H;  1JTH A;  2WSC H;  1HTL C;  2OYI B;  2HOD B;  1PFI A;  1JMM A;  3V5B A;  1CI6 A;  2YO3 A;  4DZO A;  5AW4 B;  2HFE D;  3NTN A;  1IFJ A;  1GK4 A;  1M1J B;  4WBA A;  1RF1 A;  1MZ9 A;  3KPE A;  4LLH A;  2WPQ A;  1J1E C;  1DX7 A;  1JY2 N;  4JYB A;  4GIF A;  1MV8 A;  1LT9 A;  3SWF A;  1HWT C;  1OWA A;  1NKN A;  2KYV A;  2YO2 A;  4EIJ A;  2N1T D;  1LT9 C;  3RK3 C;  4JF7 A;  4O9B A;  4LGD E;  5AVY B;  1DEB A;  1NTM K;  5KJ7 A;  3TYY A;  2C0X A;  2CPS A;  3LW5 H;  2KOG A;  5KLV K;  1N86 B;  1RF0 C;  1CW5 A;  5AVR B;  1JY2 O;  1N2D C;  3BVH B;  4JYO X;  2XNX C;  2P2U A;  3A7O A;  1FZF C;  5AVV B;  3E1I C;  1Z56 A;  3CI9 A;  3P32 A;  2I1J A;  1XTG B;  4XE5 B;  1W2E A;  4WY4 D;  2M3B A;  5APY A;  2XNX B;  3BVH C;  2FXM A;  2OYH C;  1G1I A;  3U59 A;  1QL1 A;  2N1T A;  1FZG B;  2WNP F;  1FZE A;  1N73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...