1LTJC

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 88
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ltjC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ltjC02
1JY2N 2J3GA 2JHKF 2OYIA 3H32B 2Z4EB 2HLOC 1M1JA 2FFDA 1RE4C 1T3UA 2H43A 1LT9A 2HODC 1FZCB 1RF0B 4R9TA 2Q9IC 1JY3N 2JHMF 2HPCA 2J3FD 4ZFGA 3HUSB 1FZGB 2HLOA 3FIBA 1FZGC 3GHGA 1RF1B 1RE4A 2JHLF 1FICA 2J0HA 1N73B 1FIBA 1FZAB 2J61A 1JY3O 1N73A 1JY3P 2XNXB 1RE4B 1FZEC 1FZGA 1FZAC 2J3OA 2OYHC 3BVHC 1LTJA 2GY7A 2JHIF 2A45G 1M1JB 1Z3UA 1RF0C 1FZAA 1M1JC 2HODB 2OYIB 2H43C 2XNXA 4M7FA 1LT9C 1LTJC 2HODA 3GHGB 2J60A 2HLOB 2J61B 3H32C 2WNPF 3BVHB 2HPCB 2HPCC 2OYHB 1JY2P 1RE3C 1RF0A 1LWUC 4R9JA 1LTJB 1LT9B 3GHGC 1FZBC 2J3UA 2FIBA 4JZCA 2XNXC 1FZDA 2H43B 2J64A 2Z4EA 1N73C 2J5ZA 2J1GA 3E1IC 4JYOX 4NYTA 1FZFB 1FZFC 2FFDC 1FIDA 1FZBA 2A45I 2J0YA 3E1IB 1RF1A 2Q9IB 1JY2O 2A45H 3HUSA 1FZEB 2J2PA 1FZBB 2J0GA 1LWUB 4EPUA 2JHHC 1FZFA 1FZCA 1N86A 1Z3SA 1RF1C 2FFDB 4M7HA 3HUSC 3H32A 1N86B 2OYIC 1RE3A 2J3FA 1FZEA 1LWUA 1FZCC 1JC9A 2D39A 1W2EA 2OYHA 1N86C 3BVHA 2Q9IA 2Z4EC 1RE3B 3E1IA
chains in the Genus database with same CATH superfamily
2JHKF 3MZWB 1IFJA 2BEQD 4XE5B 4PJ0H 1SQQG 3TYYA 1AQTA 3CCRP 4UB6E 2NPSC 3GHGA 2JHLF 4M3LA 3CX5H 1FZAB 1N8RQ 2IYOA 3AEAC 1MFZA 3WUVA 1S9KE 1NOHA 1H0TA 1FOSF 3CI9A 1LP1B 4K3AA 4NPFX 1M1JB 1DD3A 2OARA 3H1KG 5AW0B 2HODB 2W6JH 2FKWB 3L73E 1WT6A 1L4AA 2HLOB 5B66H 1IK9A 1MFTA 1JB0J 1M7LA 2WSSH 1LT9B 2M8RA 4K35A 1N73C 1MKMA 3L73G 2E75B 5KTBA 3CCJP 2B87A 1Z3SA 1SS1A 1T6AA 1AVYA 5K5GB 1Q7YQ 2J5UA 1GU4A 4AUWA 1RE3A 1BSHA 2RH0A 1BE3J 2E74D 1HGZA 2D2CC 1VQOP 4H44B 1WMKA 1M56D 2B87B 1LTAC 1T2KC 4ZFGA 1NTMK 2QG4A 1NJIQ 1SQQD 1RE4A 3GF3A 1JCCA 3V5BA 3M0DC 5TISE 2WZ7A 4JYBA 4N3YB 1Y8AA 2KZJA 1P84H 3IR9A 3W68A 2K88A 2KK7A 4UB8E 2GY7A 1NTKE 5KLVD 1GD2E 2Y0DA 3K5BA 2E75D 5E79H 2Q3EA 1M8OB 1YIJP 1BE3E 2HODA 1LTSC 4H0LB 2LR2A 3TF5A 3O6QB 2Y9YA 2ZT9C 2B89A 3MD0A 3MTUE 1L0NG 3KHUA 1VQ8P 3RL0g 1FIDA 3QH9A 1NU1G 4C46A 1R5LA 1SP4A 2ZAEB 2XDJA 3RBZA 2JHHC 3HTKA 3PRJA 5AVWB 1E5WA 2Q7CA 3SFEC 1NTKJ 3WU2E 3A0HE 3A2AA 1EQ7A 5DJTB 1JC9A 2RMZA 2E76B 4ZKPA 2WSFJ 1ZOYC 1BCCG 3HE5A 3RK3B 3KXDA 2IFMA 1N2DC 1BCCD 3H1KJ 2JHMF 1PZQA 1VL2A 2HPCA 1GL2D 1SFCB 2MKVA 2ITAA 2QJPB 5AVVB 1OXZA 3RL0C 3L70E 4ZMDA 5AW5B 1LTJA 1NTZE 1NU1D 3Q5RA 5AW7B 1Z3UA 3P7KA 4IOIH 5M1BA 1KYOI 1NHLA 1LGHB 1KC8Q 2KZIA 2KS1A 2O3JA 2M3BA 5BVZA 2QVAA 1LTJB 1ZXGA 2G8YA 1BGYE 2H43B 1N7SC 4W7ZA 1BSNA 1PPJG 1L0LD 4NYTA 2XU6A 2P67A 3L71D 4DCKA 3CMAP 3L75E 4EPUA 3M9BA 5KAIH 3C9IA 1PFIA 3RK3E 2FYUK 5CBOA 1N86B 3HE4B 2P58A 2KNCB 3P32A 1L0LG 2WT7B 2Q9IA 5AW8B 2ZYGA 2WSEH 5C39A 3MHVA 1M1JA 3H1LJ 1LP1A 1IC2A 1JTHB 5APQA 1VPCA 2V4HA 3AE6C 2QA4P 1CW5A 1DEBA 1OWAA 1P84D 3KQGA 1JY3P 1YJ9P 3L71E 2O1KA 4OH8B 1KQFB 1NGMB 4HJGH 4JPZB 4H0LD 1BGYJ 3OA7A 1J1DB 3ITKA 3LW5H 1PP9D 1HTLC 1YBKA 5BU5A 3VN0A 2CPSA 3L70G 1RF0A 1NTKG 4GDOA 4ZNCA 1JTHA 3B71A 4O9BA 2J64A 3EFGA 3CWBD 4Y99C 4PD4E 4DZOA 1KILD 2IYPA 1HH0A 1EXIA 1EZVD 3RL0B 1FZEB 4UB8H 1FZBB 4PV1C 3G71P 1RF1C 2NPSB 1BE3D 1PP9E 2P2UA 2A06D 2K37A 1FZCC 2JJLA 1GU5A 3JCUH 3NXSA 1SFCD 3V6IA 3NFQA 1L0NK 2WPSA 2Z4EB 2W27A 5APSA 1LTBC 2OTLP 3L74E 4L73A 3M0DA 2Q9IC 1KQSO 1Q82Q 2PP6A 1H8AA 5APVA 3VOPA 1FZGC 1SQPJ 2N9YB 1T3JA 1OX3A 1QX8A 1ZV8A 4JQ0D 5APXA 4LGDE 3L72J 1N7LA 1KYOH 1ZMEC 1VQNP 4C7NB 2L5GB 1KB9H 2FYZA 3S4RA 2QSIA 2B88A 5AW3B 3RK2B 3AEEC 2XNXA 2J60A 2BCCJ 4TT3H 1JCDA 2WT7A 1VQMP 2IFNA 2HPCB 2E42A 2OYHB 1H0TB 3VMYA 2FIBA 2C9NY 1E79H 2WPVB 1LNQA 2J5ZA 1JOCA 1L0LJ 3A7OA 1P84E 2AXCA 2R3SA 3BCCD 1VDFA 3HD7C 3TDKA 1N7SB 3H25A 3H6PA 3H1LG 2GM4A 1S5LH 3CC2P 5APUA 2H7HA 5DJUB 3CPWO 1FU1A 2KLVA 1P84I 2OTJP 3D71A 1BDCA 1PGQA 1K04A 1NU1J 4WY4C 1ZR2A 1NYHA 3L36A 3H1IE 1GW4A 2JWDA 2D2CD 1JY2N 2J3GA 3Q3DA 2PRRA 1SQQE 3V4WA 2E43A 1NTMD 2Q6QA 2O01N 3CXHD 4A7PA 1QLED 1OW6A 1FZGB 4HYTB 1BCCJ 2JP3A 1PV3A 1NU1K 3L70J 1IK7A 4RKUJ 5CBNA 2QE7H 3AE1C 3SWFA 5CCGD 3QWOC 1HF9A 3M9QA 2ZVOB 1UIXA 1Q86Q 4R4MA 1MV8A 4I7ZB 1RF0C 2QRXA 3B5NB 1NTKD 1LT9C 1NO4A 1DD4A 1QGKB 1NU1E 4D6TG 3D70A 2QJKC 2JO1A 4WWIA 1SQQK 2GUSA 1NVOA 3N7NA 2E5YA 3KYQA 3KZIE 1S72P 1CI6B 3AEGC 1OVVA 1PIXA 2K9JB 2J2PA 3P8MC 1NTMG 3B8EB 1JO5A 3E1RA 4H0LC 1FDIA 2FFDB 1X79B 1H89A 3HTKB 1OMIA 2KXPB 4WB4A 2ZT9B 1VQKP 5KKZB 1T8ZA 3L72G 3O6QA 5KLVJ 5AVQB 1JMBA 2K9JA 3OW2O 4BRYB 2WSCJ 2KSEA 1K05A 3CCLP 1NTME 1U7MA 1M1KQ 4PD4I 2YIUB 3BCCG 1ZP0C 4H13B 1VF5C 1YQ3C 2KLUA 5KJ7D 1FOSE 1GTWA 3BATA 1RE4B 1MZ9A 2WVRA 4HB1A 4C7NA 1EC5A 4YXWH 1MUUA 1SQVG 2FYUE 2WPQA 3E7KA 2YXQB 4M7FA 3G3ZA 3P8CE 3GHGB 2XNDH 2Y0CA 3TGUE 4KT0J 2FXMA 1KQGB 1BGYG 1L0LK 1KILE 2MJZA 1GK4A 1KFNA 1GK6A 3RK2D 1OFCX 3CCQP 2N1TB 3C8VA 1NTZJ 2J59M 5CMZA 4Y28J 1FBMA 2KNCA 2H8PD 5KLVK 1K73Q 1KTMA 1NWQA 2E75C 1KB9E 4H44C 4WVZA 2FXPA 5KAIE 1JM0A 3PLNA 4M7HA 3HUSC 2XV5A 1YTZI 5CCHA 1FJPA 3MGNA 3U1CA 2I1KA 1SQVD 1RQVA 1FDOA 1L4AB 1FE6A 2N1TD 1N7SD 3BVHA 2SPZA 2QJYB 2NRGA 2JDIH 2WMMA 1HUCA 4N78D 3JSVC 3L37A 4WY4B 3G9RA 3LW5J 1FAVA 2KUBA 3W67A 1NAFA 3S9OA 3Q2YA 3HUSB 2WQYC 4PJ0E 5H2FH 3Q1MA 3TSIA 4OVNF 4N6JA 2P7JA 1N73B 1NKZB 4D6TJ 4NPDA 1KB9D 2AEFA 1FZAC 2W6AA 3TGUJ 3D6ZA 1R8EA 1U57A 1L4AD 2IBZI 2KYVA 4HKZH 3HD7A 1KILB 4JF7A 1DEEG 1SQPG 2IDBA 1J1EB 1SLQA 1YI2P 1QL1A 2WNPF 1KYOD 3MUDC 2HPCC 3CCUP 3AECC 3GF7A 1J2JB 4W80A 2IBZE 5KLVG 3VYIA 1FZFB 1OVRA 1FZFC 2BCCG 2FFDC 4XFJA 1LTIC 4C7RA 3WMM0 2UWJE 2LXBA 1QL2A 2IBZD 1HGVA 2XKMA 1X8YA 1N86A 2JR8A 3USSA 3CX5E 1USDA 1M90Q 1CI6A 2R5DA 1W2EA 2IX7C 3AE9C 5AVSB 1URQB 1YITP 2LXCB 2Z4EC 1X0TA 3H1ID 2OYIA 3T97B 5KJ7A 4KHXA 2FFDA 4GKGA 3H1JE 3CC7P 1SVFA 3IFMA 1KD1Q 2YXRB 1L0NE 3Q5SA 1FZCB 1G1JA 2B9BA 4I7ZC 1SQBK 3AE5C 1KN7A 5AVTB 2AXTH 2J0HA 3MIWA 5GTIE 2J61A 1W5CE 1YQ4C 5CCHC 2QEXP 1FZEC 3CL3D 1NTKK 2RN0A 3I55P 2JKVA 4R4LA 4B86A 2CK3H 1NTZG 2A45G 1HJBA 5GTHH 1J1EC 2IZ0A 2JWAA 3VP9A 1VQLP 1CZQA 1S5LE 1PL5A 4EDFA 4ASWA 1AJYA 3CC4P 1Z56A 1HBWA 1GL2A 1LJ2A 1NH4A 1FC2C 3H1LE 2YO3A 2N9BA 2J1GA 2KP8A 2N1TC 4L76A 1Q90D 2G3AA 3N4XA 2A45H 2FYUD 4LLHA 1SQXK 1S9KD 3HE4A 3L70D 1EXJA 1EDKA 1A02F 3H1JJ 5KLVE 2FBWC 1QVGO 1IJDB 2ZVNB 1PP9G 4CPGA 4U3FJ 1NTMJ 1SQBD 3TGUG 1EDJA 1PGPA 1RE4C 1T3UA 1OVUA 1LT9A 3RK2C 3SWYA 3NMDA 1ZRTD 2HLOA 1KMIZ 2P10A 2W83C 1RH5B 2OQQA 1VQ6P 4BXLA 3AE7C 1OZHA 3B5NA 3PTZA 3I56P 4Z1MH 1SQVK 2OYHC 3C1LA 1SQXE 3A3YB 3IAOA 4H13C 2HG5D 2WWWA 3BCCJ 3RK3D 1Q81Q 2VRSA 2HYNA 1FZAA 1FS0E 1VQ7P 1LTJC 1G1IA 3H32C 3SSUA 1IFIA 1LWUC 2A06E 3L4FA 3PP5A 1YHQP 3GG2A 1FZDA 2BCCD 1SQVJ 4GOEA 1UIIA 2Z4EA 3CWBE 3F5HA 1D7MA 3H1HD 2Q3IA 1RHZB 3FXDA 1LTTC 2A45I 3CCMP 1EZVE 2IZ1A 2W90A 4IFDK 2NPSA 3L73D 2N1TA 1JEKA 4YPCA 3L72D 1NTZD 1U7JA 4Y99B 3A0HH 5L8RJ 3B5NC 1FZEA 5B5EE 1LWUA 3VP8A 1YJWP 2GUVA 2YNYA 2KIKA 5EFWB 1SQBE 3RK3C 2OYOA 5B66E 3E1IA 2V7QJ 3EWKA 1TU3F 4U7JA 2Q1KA 1JNMA 3M06A 5AW1B 2KSJA 1RF0B 1SQXJ 1PPJE 1J1DC 1URQD 3U1AA 1ZN5A 1RF1B 3II6A 2ZT9D 3O8ZA 1FIBA 4I6MC 3Q5PA 2XNXB 2QJKB 3AEBC 2J3OA 2O01J 4JYCA 2V7QH 2QJYC 4OGQB 3BVHC 2O1JA 2JHIF 3MUDA 2PFXA 3FXEA 3CWBJ 4WY4D 5CCGC 2M0BA 4D6TE 2Y0EA 3WUUA 1KILA 3JC22 3EQ2A 3L74G 1ZLLA 3FWLA 2M3EA 1QVFO 3GMAA 3AEDC 5H2FE 2KI7B 1YTZT 3CCVP 1PP9J 5KLIB 3BASA 1BGYD 1IO4A 1RF1A 1SQXD 3HUSA 1VQ9P 2PGDA 1JMMA 4MN4C 3VMXA 4WY4A 1ZW0A 2E74C 1QEXA 1XTGB 1YYCA 3CLQA 2WSCH 3R4YA 1N86C 1SQPE 5AW9B 3HD7D 4QMAA 3L74D 2H43A 2Z5IA 1ZRTE 3MP7B 1JY3N 5KLIC 5AW6B 3BRTB 4H44D 2E74B 2NZ2A 4IFFA 3RBXA 3L75D 3PHLA 1HVVA 2ZXXA 2RKLA 3WUTA 3V2PA 1DX7A 2IBZG 1RY3A 1IFMA 2KOGA 2FYNB 2OYIB 2H43C 1SQVE 5B5EH 2YKPA 5GTHE 2WSEJ 3ZDMA 5CJ0A 4YXDC 4OGQC 5AVUB 2XNXC 3G4SP 4EI2A 3D6YA 1VF5D 2BASA 1S3JA 3E1IC 3B5ND 3LIEA 2PAJA 3I5CA 3H1HE 2Q9IB 1JY2O 4IFMA 4I2LC 1AFOA 1X22A 2J0GA 2R5BA 1FZFA 1S4XA 1HJ0A 1OW7A 1SQXG 4RESB 1SQBJ 1X9VA 4L74A 4IL6X 2YO2A 2FYNC 1VQ4P 4N78E 1XTCC 2AEMA 3CX5I 1GL2B 4U3FE 3H1HG 3H1KD 2LKMA 1KYOE 3H1JD 2M5AB 4ZKUA 3WU2H 3L75J 4EYYQ 3H1JG 1DH3A 2H89C 2Q5UA 2FY8A 5APWA 3CWBG 2J3FD 3L72E 2KS1B 4U3FG 1FICA 2C0XA 3CMEP 1G2CB 3L74J 3B4SA 2WSFH 3IF4A 2C9LY 4DT0A 1IFNA 5AVXB 1SQPD 2YKOA 2L91A 4EIJA 3V2QA 1Y47A 4L75A 3TNUA 3H1KE 1L2PA 3T97A 3VTPC 5E79E 4OGQD 1KZUB 2H88C 1JY2P 1ZR4A 1SFCA 2GA1A 3TK1A 2JEEA 4PD4H 3R2PA 4AYCA 1YJNP 2E5TA 1S2EA 4AQRD 4KJMA 1L0LE 1FZBA 3HE5B 3CXHI 4RJTA 2I8DA 2WTYA 3V2RA 1FZCA 4IL6E 3OJAB 3S1KA 3H1IJ 2FYUG 5CHXA 2Z5HA 4DJGA 1SQQJ 1VQPP 4ASVA 5KJ7C 1OW8A 3GW6A 3U59A 4JBZA 2D39A 3A0BH 1GMJA 1DIPA 1FDMA 2K1AA 3P8CD 4TLFA 2FXOA 2HLOC 2HFED 5CCGA 5CJ4A 1LT1A 3KDPB 2HODC 3G6EP 1PPJD 2P1JA 3A5TA 4OWFA 2QIWA 1A02J 1SQPK 1GZLA 3OAKA 1BCCE 1JY3O 3CCEP 2WITA 4I1LA 1N73A 3CXHH 4WBAA 1NTZK 2QJPC 1WRGA 3KZIH 3ABVC 2E76C 1S5LX 2OTKE 4BWNA 1GL2C 1IFDA 3H1LD 5AW2B 2YKQA 3AE3C 2YMKA 2CPBA 3L73J 3BVHB 1AV1A 2K3RA 5TISH 4PV1B 3RL0D 3TGUD 1SQBG 2XZRA 1EDLA 5KAFH 1FZBC 2R44A 4JZCA 2AEJA 3F89A 4D6TD 1CSBA 2QM8A 1KQLA 3H1HJ 2M5AA 1OIPA 2IPPA 2K9YA 3BCCE 1VQ5P 1H88A 2BCCE 2ZFCA 3E1IB 2YMYA 3L75G 1JUNA 3L71J 1BE3G 1LWUB 3VMZA 1LTGC 3CD6P 1Y9BA 3PJSK 1VF5B 1AVOA 2YIUC 2ZJSE 1AQ5A 1KORA 2WPRA 2OYIC 2J3FA 4UB6H 5AVRB 2NPSD 3H32B 1KB9I 1L0ND 3IN6A 4GODA 1USEA 1KILC 3RGUA 5BU8B 3A0BE 5KAFE 1GDTA 1BDDA 2I1JA 4GOFA 2C0WA 3SWKA 4U3FD 2ZYDA 3TNUB 3V4QA 2W8ZA 2J58A 1NAYA 3EFFK 3FX0A 1G2CA 1W2BO 1EDIA 1PGJA 4BRYA 1Q2NA 2R32A 3AE4C 2Y9ZA 3AE2C 3H1IG 2FYUJ 4R9JA 2ZXEB 3AEFC 1IZNB 2E76D 3SFDC 2QM7A 4JYOX 5APYA 5TJHA 4EOTA 1KV4A 1HWTC 1URQA 1EZVI 2W6BA 4HH2A 1T2KD 1N7SA 1K8AQ 3CCSP 2HR3A 1RQUA 3VMAA 3HRNA 2D2CB 4H13D 5APTA 2ZYAA 3NTNA 3CX5D 4RO0A 5AW4B 5AVYB 3V2NA 1NKNA 3PH0A 3M0AA 4GIFA 4R9TA 3CXHE 1IFPA 1KFMA 2R3CA 1SFCC 3FIBA 3FWNA 1PGOA 3M91A 4W7YA 3HD7B 3FGAD 4NPEA 1FZGA 2BEZF 2KB7P 1R5SA 1FJKA 1M1JC 3M9HA 4LC1A 3LIDA 3UIAA 3L71G 2J61B 4XA4A 4YTPC 1RE3C 1GW3A 1K9MQ 3GHGC 3KPEA 2J3UA 4IL6H 1URQC 5AVZB 5KKZC 2POHA 2OGUA 3BRVB 3JCUE 2DW3A 2J0YA 4GT1A 4PV1D 5CCHD 4PD4D 4DOJA 2A06G 1L4AC 3H32A 3GLMA 5GTIH 3L35A 2AXTE 1M57D 1S1CX 2OYHA 3AE8C 1L0NJ 1AA0A 2O01H 1RE3B 1EZVG
chains in the Genus database with same CATH topology
1SFCD 3NFQA 4ZKUA 1L0NK 2WPSA 2JHKF 2OYIA 5KJ7A 4KHXA 2Z4EB 2W27A 5APSA 2FFDA 4GKGA 1LTBC 1IFJA 4XE5B 1DH3A 1SVFA 3IFMA 1FZCB 3M0DA 1G1JA 2Q5UA 2Q9IC 3TYYA 5APWA 1SQBK 2PP6A 1H8AA 5APVA 2J3FD 2NPSC 3VOPA 1FZGC 3GHGA 5AVTB 2JHLF 4M3LA 1FICA 2J0HA 3MIWA 1T3JA 1ZV8A 2C0XA 1FZAB 5APXA 1G2CB 4LGDE 1N7LA 2J61A 5CCHC 2WSFH 1MFZA 1FZEC 3CL3D 4C7NB 2C9LY 1NTKK 2L5GB 1IFNA 5AVXB 2FYZA 1S9KE 2YKOA 1NOHA 4EIJA 3V2QA 4B86A 1FOSF 3CI9A 2A45G 1HJBA 3TNUA 5AW3B 1J1EC 1M1JB 2OARA 5AW0B 3RK2B 2HODB 3T97A 3VP9A 2FKWB 1CZQA 2XNXA 1WT6A 3VTPC 1L4AA 2J60A 2HLOB 1KZUB 1JCDA 2WT7A 2HPCB 2IFNA 2E42A 1IK9A 1Z56A 1HBWA 1GL2A 1JY2P 2OYHB 1ZR4A 1SFCA 1M7LA 1NH4A 3VMYA 1LT9B 2M8RA 3TK1A 2FIBA 2JEEA 2C9NY 2YO3A 3R2PA 4AYCA 2N9BA 1N73C 2J5ZA 2J1GA 1JOCA 2KP8A 3A7OA 4AQRD 2N1TC 1FZBA 3HE5B 1VDFA 3N4XA 2A45H 3HD7C 1N7SB 5KTBA 3H6PA 2WTYA 4LLHA 1SQXK 2GM4A 3V2RA 1FZCA 5APUA 1S9KD 3OJAB 3HE4A 2H7HA 1Z3SA 1FU1A 5CHXA 2KLVA 1A02F 2Z5HA 1GU4A 4AUWA 1RE3A 5KJ7C 1IJDB 3U59A 4WY4C 1ZR2A 2D39A 3L36A 1FDMA 1GW4A 1HGZA 3P8CD 1JY2N 2J3GA 3V4WA 2E43A 2HLOC 1RE4C 1T3UA 2HFED 5CCGA 5CJ4A 3KDPB 1LT9A 2HODC 3RK2C 1T2KC 1LTAC 3SWYA 3NMDA 4ZFGA 1NTMK 2P1JA 3A5TA 1FZGB 2HLOA 1RE4A 4HYTB 1A02J 1SQPK 1GZLA 1JCCA 3V5BA 3OAKA 3M0DC 1NU1K 2WZ7A 1JY3O 4JYBA 2WITA 4I1LA 1N73A 4N3YB 4WBAA 3B5NA 1NTZK 3SWFA 5CCGD 1SQVK 3IR9A 2OYHC 3M9QA 1WRGA 3A3YB 2HG5D 2WWWA 2GY7A 1GD2E 3RK3D 1MV8A 2VRSA 1GL2C 2HYNA 1RF0C 1FZAA 3B5NB 1IFDA 5AW2B 2YKQA 1LT9C 1LTJC 1G1IA 2HODA 1NO4A 2CPBA 3H32C 3BVHB 1LTSC 3RL0D 2XZRA 1IFIA 1LWUC 1FZBC 3L4FA 3PP5A 4JZCA 1SQQK 1FZDA 2GUSA 2Z4EA 1CSBA 2QM8A 1KQLA 3MD0A 3MTUE 3N7NA 3KYQA 2Q3IA 2IPPA 1H88A 1FIDA 1LTTC 2A45I 2ZFCA 3E1IB 1CI6B 1SP4A 2YMYA 4C46A 1JUNA 2XDJA 2J2PA 3P8MC 4IFDK 2NPSA 1LWUB 3VMZA 1LTGC 2JHHC 2N1TA 3B8EB 1JO5A 3HTKA 5AVWB 1E5WA 2Q7CA 2FFDB 3A2AA 4Y99B 1EQ7A 1X79B 1H89A 1AQ5A 2WPRA 3HTKB 4WB4A 3B5NC 2OYIC 2J3FA 1FZEA 1LWUA 1JC9A 3VP8A 1T8ZA 2GUVA 5AVQB 2YNYA 4ZKPA 3RK3C 3E1IA 5AVRB 3HE5A 2NPSD 3H32B 3RK3B 2IFMA 1JNMA 3M06A 5AW1B 2KSJA 1N2DC 1RF0B 2JHMF 2HPCA 1J1DC 1KILC 1GL2D 1URQD 1SFCB 5BU8B 3U1AA 1ZN5A 1RF1B 1GDTA 3II6A 2I1JA 3O8ZA 1FIBA 4I6MC 5AVVB 2XNXB 1OXZA 5KJ7D 1GTWA 1FOSE 3BATA 2C0WA 1RE4B 3RL0C 1MZ9A 2J3OA 4JYCA 5AW5B 3TNUB 3BVHC 1LTJA 2O1JA 3V4QA 2JHIF 4C7NA 2J58A 3MUDA 1MUUA 5AW7B 2WPQA 1Z3UA 1G2CA 4WY4D 5CCGC 3P7KA 4M7FA 3G3ZA 3P8CE 3GHGB 1NHLA 1LGHB 2R32A 1KILA 2M3BA 3EQ2A 1ZLLA 5BVZA 2FXMA 4R9JA 1LTJB 2ZXEB 1L0LK 2MJZA 1GK4A 1KFNA 2H43B 1N7SC 4W7ZA 1GK6A 1YTZT 3RK2D 2QM7A 4JYOX 5APYA 2N1TB 4NYTA 4EOTA 1HWTC 2J59M 5CMZA 1URQA 3BASA 2W6BA 2XU6A 4HH2A 1T2KD 2P67A 1N7SA 1RF1A 1IO4A 1FBMA 3HUSA 2H8PD 5KLVK 1JMMA 3VMXA 4EPUA 3M9BA 1NWQA 4WY4A 3HRNA 3C9IA 1PFIA 1XTGB 4M7HA 2FYUK 3HUSC 1YYCA 2XV5A 1YTZI 3CLQA 5APTA 5CCHA 1N86B 3HE4B 3NTNA 1FJPA 3MGNA 3U1CA 2I1KA 2WSCH 3P32A 1L4AB 5AW4B 2N1TD 1N86C 1N7SD 5AVYB 2WT7B 3BVHA 3V2NA 5AW9B 1NKNA 2Q9IA 5AW8B 3HD7D 2WSEH 3M0AA 1M1JA 1HUCA 4N78D 2Z5IA 2H43A 1IC2A 1JTHB 4GIFA 3L37A 4WY4B 1FAVA 4R9TA 5APQA 1JY3N 1VPCA 1NAFA 1KFMA 3HUSB 2R3CA 1SFCC 5AW6B 3FIBA 3BRTB 1CW5A 1DEBA 3TSIA 1OWAA 4N6JA 2P7JA 1N73B 4IFFA 3KQGA 1NKZB 3M91A 4W7YA 1JY3P 2O1KA 3HD7B 1FZGA 1FZAC 2W6AA 1HVVA 4OH8B 1L4AD 2KYVA 3V2PA 3HD7A 3OA7A 1J1DB 1KILB 2KB7P 1DX7A 4JF7A 1RY3A 1FJKA 3LW5H 1IFMA 2KOGA 1J1EB 1M1JC 3M9HA 1SLQA 3LIDA 4LC1A 2OYIB 2H43C 1HTLC 2YKPA 3UIAA 5CJ0A 5BU5A 2J61B 1QL1A 2WNPF 2HPCC 4XA4A 1RE3C 5AVUB 1GW3A 2CPSA 3VN0A 1RF0A 3GHGC 3KPEA 2J3UA 1JTHA 1URQC 2XNXC 1J2JB 4W80A 5AVZB 4O9BA 2POHA 2J64A 3EFGA 3BRVB 2BASA 3E1IC 3B5ND 3VYIA 4Y99C 3LIEA 4DZOA 1FZFB 1KILD 2PAJA 1FZFC 3I5CA 2FFDC 1HH0A 1LTIC 2J0YA 4GT1A 4C7RA 3WMM0 2Q9IB 1JY2O 1QL2A 5CCHD 3RL0B 4IFMA 1FZEB 4I2LC 1AFOA 1FZBB 2J0GA 1HGVA 2R5BA 1FZFA 2XKMA 4DOJA 1X8YA 4RESB 1N86A 1RF1C 1L4AC 1X9VA 2NPSB 3H32A 2YO2A 2P2UA 3L35A 2JJLA 1XTCC 4N78E 1CI6A 1GU5A 1FZCC 2R5DA 1GL2B 1W2EA 2IX7C 2OYHA 5AVSB 1URQB 2LKMA 3NXSA 2Z4EC 2O01H 1RE3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 N;  2J3G A;  2JHK F;  2OYI A;  3H32 B;  2Z4E B;  2HLO C;  1M1J A;  2FFD A;  1RE4 C;  1T3U A;  2H43 A;  1LT9 A;  2HOD C;  1FZC B;  1RF0 B;  4R9T A;  2Q9I C;  1JY3 N;  2JHM F;  2HPC A;  2J3F D;  4ZFG A;  3HUS B;  1FZG B;  2HLO A;  3FIB A;  1FZG C;  3GHG A;  1RF1 B;  1RE4 A;  2JHL F;  1FIC A;  2J0H A;  1N73 B;  1FIB A;  1FZA B;  2J61 A;  1JY3 O;  1N73 A;  1JY3 P;  2XNX B;  1RE4 B;  1FZE C;  1FZG A;  1FZA C;  2J3O A;  2OYH C;  3BVH C;  1LTJ A;  2GY7 A;  2JHI F;  2A45 G;  1M1J B;  1Z3U A;  1RF0 C;  1FZA A;  1M1J C;  2HOD B;  2OYI B;  2H43 C;  2XNX A;  4M7F A;  1LT9 C;  1LTJ C;  2HOD A;  3GHG B;  2J60 A;  2HLO B;  2J61 B;  3H32 C;  2WNP F;  3BVH B;  2HPC B;  2HPC C;  2OYH B;  1JY2 P;  1RE3 C;  1RF0 A;  1LWU C;  4R9J A;  1LTJ B;  1LT9 B;  3GHG C;  1FZB C;  2J3U A;  2FIB A;  4JZC A;  2XNX C;  1FZD A;  2H43 B;  2J64 A;  2Z4E A;  1N73 C;  2J5Z A;  2J1G A;  3E1I C;  4JYO X;  4NYT A;  1FZF B;  1FZF C;  2FFD C;  1FID A;  1FZB A;  2A45 I;  2J0Y A;  3E1I B;  1RF1 A;  2Q9I B;  1JY2 O;  2A45 H;  3HUS A;  1FZE B;  2J2P A;  1FZB B;  2J0G A;  1LWU B;  4EPU A;  2JHH C;  1FZF A;  1FZC A;  1N86 A;  1Z3S A;  1RF1 C;  2FFD B;  4M7H A;  3HUS C;  3H32 A;  1N86 B;  2OYI C;  1RE3 A;  2J3F A;  1FZE A;  1LWU A;  1FZC C;  1JC9 A;  2D39 A;  1W2E A;  2OYH A;  1N86 C;  3BVH A;  2Q9I A;  2Z4E C;  1RE3 B;  3E1I A; 
#chains in the Genus database with same CATH topology
 2JHK F;  3MZW B;  1IFJ A;  2BEQ D;  4XE5 B;  4PJ0 H;  1SQQ G;  3TYY A;  1AQT A;  3CCR P;  4UB6 E;  2NPS C;  3GHG A;  2JHL F;  4M3L A;  3CX5 H;  1FZA B;  1N8R Q;  2IYO A;  3AEA C;  1MFZ A;  3WUV A;  1S9K E;  1NOH A;  1H0T A;  1FOS F;  3CI9 A;  1LP1 B;  4K3A A;  4NPF X;  1M1J B;  1DD3 A;  2OAR A;  3H1K G;  5AW0 B;  2HOD B;  2W6J H;  2FKW B;  3L73 E;  1WT6 A;  1L4A A;  2HLO B;  5B66 H;  1IK9 A;  1MFT A;  1JB0 J;  1M7L A;  2WSS H;  1LT9 B;  2M8R A;  4K35 A;  1N73 C;  1MKM A;  3L73 G;  2E75 B;  5KTB A;  3CCJ P;  2B87 A;  1Z3S A;  1SS1 A;  1T6A A;  1AVY A;  5K5G B;  1Q7Y Q;  2J5U A;  1GU4 A;  4AUW A;  1RE3 A;  1BSH A;  2RH0 A;  1BE3 J;  2E74 D;  1HGZ A;  2D2C C;  1VQO P;  4H44 B;  1WMK A;  1M56 D;  2B87 B;  1LTA C;  1T2K C;  4ZFG A;  1NTM K;  2QG4 A;  1NJI Q;  1SQQ D;  1RE4 A;  3GF3 A;  1JCC A;  3V5B A;  3M0D C;  5TIS E;  2WZ7 A;  4JYB A;  4N3Y B;  1Y8A A;  2KZJ A;  1P84 H;  3IR9 A;  3W68 A;  2K88 A;  2KK7 A;  4UB8 E;  2GY7 A;  1NTK E;  5KLV D;  1GD2 E;  2Y0D A;  3K5B A;  2E75 D;  5E79 H;  2Q3E A;  1M8O B;  1YIJ P;  1BE3 E;  2HOD A;  1LTS C;  4H0L B;  2LR2 A;  3TF5 A;  3O6Q B;  2Y9Y A;  2ZT9 C;  2B89 A;  3MD0 A;  3MTU E;  1L0N G;  3KHU A;  1VQ8 P;  3RL0 g;  1FID A;  3QH9 A;  1NU1 G;  4C46 A;  1R5L A;  1SP4 A;  2ZAE B;  2XDJ A;  3RBZ A;  2JHH C;  3HTK A;  3PRJ A;  5AVW B;  1E5W A;  2Q7C A;  3SFE C;  1NTK J;  3WU2 E;  3A0H E;  3A2A A;  1EQ7 A;  5DJT B;  1JC9 A;  2RMZ A;  2E76 B;  4ZKP A;  2WSF J;  1ZOY C;  1BCC G;  3HE5 A;  3RK3 B;  3KXD A;  2IFM A;  1N2D C;  1BCC D;  3H1K J;  2JHM F;  1PZQ A;  1VL2 A;  2HPC A;  1GL2 D;  1SFC B;  2MKV A;  2ITA A;  2QJP B;  5AVV B;  1OXZ A;  3RL0 C;  3L70 E;  4ZMD A;  5AW5 B;  1LTJ A;  1NTZ E;  1NU1 D;  3Q5R A;  5AW7 B;  1Z3U A;  3P7K A;  4IOI H;  5M1B A;  1KYO I;  1NHL A;  1LGH B;  1KC8 Q;  2KZI A;  2KS1 A;  2O3J A;  2M3B A;  5BVZ A;  2QVA A;  1LTJ B;  1ZXG A;  2G8Y A;  1BGY E;  2H43 B;  1N7S C;  4W7Z A;  1BSN A;  1PPJ G;  1L0L D;  4NYT A;  2XU6 A;  2P67 A;  3L71 D;  4DCK A;  3CMA P;  3L75 E;  4EPU A;  3M9B A;  5KAI H;  3C9I A;  1PFI A;  3RK3 E;  2FYU K;  5CBO A;  1N86 B;  3HE4 B;  2P58 A;  2KNC B;  3P32 A;  1L0L G;  2WT7 B;  2Q9I A;  5AW8 B;  2ZYG A;  2WSE H;  5C39 A;  3MHV A;  1M1J A;  3H1L J;  1LP1 A;  1IC2 A;  1JTH B;  5APQ A;  1VPC A;  2V4H A;  3AE6 C;  2QA4 P;  1CW5 A;  1DEB A;  1OWA A;  1P84 D;  3KQG A;  1JY3 P;  1YJ9 P;  3L71 E;  2O1K A;  4OH8 B;  1KQF B;  1NGM B;  4HJG H;  4JPZ B;  4H0L D;  1BGY J;  3OA7 A;  1J1D B;  3ITK A;  3LW5 H;  1PP9 D;  1HTL C;  1YBK A;  5BU5 A;  3VN0 A;  2CPS A;  3L70 G;  1RF0 A;  1NTK G;  4GDO A;  4ZNC A;  1JTH A;  3B71 A;  4O9B A;  2J64 A;  3EFG A;  3CWB D;  4Y99 C;  4PD4 E;  4DZO A;  1KIL D;  2IYP A;  1HH0 A;  1EXI A;  1EZV D;  3RL0 B;  1FZE B;  4UB8 H;  1FZB B;  4PV1 C;  3G71 P;  1RF1 C;  2NPS B;  1BE3 D;  1PP9 E;  2P2U A;  2A06 D;  2K37 A;  1FZC C;  2JJL A;  1GU5 A;  3JCU H;  3NXS A;  1SFC D;  3V6I A;  3NFQ A;  1L0N K;  2WPS A;  2Z4E B;  2W27 A;  5APS A;  1LTB C;  2OTL P;  3L74 E;  4L73 A;  3M0D A;  2Q9I C;  1KQS O;  1Q82 Q;  2PP6 A;  1H8A A;  5APV A;  3VOP A;  1FZG C;  1SQP J;  2N9Y B;  1T3J A;  1OX3 A;  1QX8 A;  1ZV8 A;  4JQ0 D;  5APX A;  4LGD E;  3L72 J;  1N7L A;  1KYO H;  1ZME C;  1VQN P;  4C7N B;  2L5G B;  1KB9 H;  2FYZ A;  3S4R A;  2QSI A;  2B88 A;  5AW3 B;  3RK2 B;  3AEE C;  2XNX A;  2J60 A;  2BCC J;  4TT3 H;  1JCD A;  2WT7 A;  1VQM P;  2IFN A;  2HPC B;  2E42 A;  2OYH B;  1H0T B;  3VMY A;  2FIB A;  2C9N Y;  1E79 H;  2WPV B;  1LNQ A;  2J5Z A;  1JOC A;  1L0L J;  3A7O A;  1P84 E;  2AXC A;  2R3S A;  3BCC D;  1VDF A;  3HD7 C;  3TDK A;  1N7S B;  3H25 A;  3H6P A;  3H1L G;  2GM4 A;  1S5L H;  3CC2 P;  5APU A;  2H7H A;  5DJU B;  3CPW O;  1FU1 A;  2KLV A;  1P84 I;  2OTJ P;  3D71 A;  1BDC A;  1PGQ A;  1K04 A;  1NU1 J;  4WY4 C;  1ZR2 A;  1NYH A;  3L36 A;  3H1I E;  1GW4 A;  2JWD A;  2D2C D;  1JY2 N;  2J3G A;  3Q3D A;  2PRR A;  1SQQ E;  3V4W A;  2E43 A;  1NTM D;  2Q6Q A;  2O01 N;  3CXH D;  4A7P A;  1QLE D;  1OW6 A;  1FZG B;  4HYT B;  1BCC J;  2JP3 A;  1PV3 A;  1NU1 K;  3L70 J;  1IK7 A;  4RKU J;  5CBN A;  2QE7 H;  3AE1 C;  3SWF A;  5CCG D;  3QWO C;  1HF9 A;  3M9Q A;  2ZVO B;  1UIX A;  1Q86 Q;  4R4M A;  1MV8 A;  4I7Z B;  1RF0 C;  2QRX A;  3B5N B;  1NTK D;  1LT9 C;  1NO4 A;  1DD4 A;  1QGK B;  1NU1 E;  4D6T G;  3D70 A;  2QJK C;  2JO1 A;  4WWI A;  1SQQ K;  2GUS A;  1NVO A;  3N7N A;  2E5Y A;  3KYQ A;  3KZI E;  1S72 P;  1CI6 B;  3AEG C;  1OVV A;  1PIX A;  2K9J B;  2J2P A;  3P8M C;  1NTM G;  3B8E B;  1JO5 A;  3E1R A;  4H0L C;  1FDI A;  2FFD B;  1X79 B;  1H89 A;  3HTK B;  1OMI A;  2KXP B;  4WB4 A;  2ZT9 B;  1VQK P;  5KKZ B;  1T8Z A;  3L72 G;  3O6Q A;  5KLV J;  5AVQ B;  1JMB A;  2K9J A;  3OW2 O;  4BRY B;  2WSC J;  2KSE A;  1K05 A;  3CCL P;  1NTM E;  1U7M A;  1M1K Q;  4PD4 I;  2YIU B;  3BCC G;  1ZP0 C;  4H13 B;  1VF5 C;  1YQ3 C;  2KLU A;  5KJ7 D;  1FOS E;  1GTW A;  3BAT A;  1RE4 B;  1MZ9 A;  2WVR A;  4HB1 A;  4C7N A;  1EC5 A;  4YXW H;  1MUU A;  1SQV G;  2FYU E;  2WPQ A;  3E7K A;  2YXQ B;  4M7F A;  3G3Z A;  3P8C E;  3GHG B;  2XND H;  2Y0C A;  3TGU E;  4KT0 J;  2FXM A;  1KQG B;  1BGY G;  1L0L K;  1KIL E;  2MJZ A;  1GK4 A;  1KFN A;  1GK6 A;  3RK2 D;  1OFC X;  3CCQ P;  2N1T B;  3C8V A;  1NTZ J;  2J59 M;  5CMZ A;  4Y28 J;  1FBM A;  2KNC A;  2H8P D;  5KLV K;  1K73 Q;  1KTM A;  1NWQ A;  2E75 C;  1KB9 E;  4H44 C;  4WVZ A;  2FXP A;  5KAI E;  1JM0 A;  3PLN A;  4M7H A;  3HUS C;  2XV5 A;  1YTZ I;  5CCH A;  1FJP A;  3MGN A;  3U1C A;  2I1K A;  1SQV D;  1RQV A;  1FDO A;  1L4A B;  1FE6 A;  2N1T D;  1N7S D;  3BVH A;  2SPZ A;  2QJY B;  2NRG A;  2JDI H;  2WMM A;  1HUC A;  4N78 D;  3JSV C;  3L37 A;  4WY4 B;  3G9R A;  3LW5 J;  1FAV A;  2KUB A;  3W67 A;  1NAF A;  3S9O A;  3Q2Y A;  3HUS B;  2WQY C;  4PJ0 E;  5H2F H;  3Q1M A;  3TSI A;  4OVN F;  4N6J A;  2P7J A;  1N73 B;  1NKZ B;  4D6T J;  4NPD A;  1KB9 D;  2AEF A;  1FZA C;  2W6A A;  3TGU J;  3D6Z A;  1R8E A;  1U57 A;  1L4A D;  2IBZ I;  2KYV A;  4HKZ H;  3HD7 A;  1KIL B;  4JF7 A;  1DEE G;  1SQP G;  2IDB A;  1J1E B;  1SLQ A;  1YI2 P;  1QL1 A;  2WNP F;  1KYO D;  3MUD C;  2HPC C;  3CCU P;  3AEC C;  3GF7 A;  1J2J B;  4W80 A;  2IBZ E;  5KLV G;  3VYI A;  1FZF B;  1OVR A;  1FZF C;  2BCC G;  2FFD C;  4XFJ A;  1LTI C;  4C7R A;  3WMM 0;  2UWJ E;  2LXB A;  1QL2 A;  2IBZ D;  1HGV A;  2XKM A;  1X8Y A;  1N86 A;  2JR8 A;  3USS A;  3CX5 E;  1USD A;  1M90 Q;  1CI6 A;  2R5D A;  1W2E A;  2IX7 C;  3AE9 C;  5AVS B;  1URQ B;  1YIT P;  2LXC B;  2Z4E C;  1X0T A;  3H1I D;  2OYI A;  3T97 B;  5KJ7 A;  4KHX A;  2FFD A;  4GKG A;  3H1J E;  3CC7 P;  1SVF A;  3IFM A;  1KD1 Q;  2YXR B;  1L0N E;  3Q5S A;  1FZC B;  1G1J A;  2B9B A;  4I7Z C;  1SQB K;  3AE5 C;  1KN7 A;  5AVT B;  2AXT H;  2J0H A;  3MIW A;  5GTI E;  2J61 A;  1W5C E;  1YQ4 C;  5CCH C;  2QEX P;  1FZE C;  3CL3 D;  1NTK K;  2RN0 A;  3I55 P;  2JKV A;  4R4L A;  4B86 A;  2CK3 H;  1NTZ G;  2A45 G;  1HJB A;  5GTH H;  1J1E C;  2IZ0 A;  2JWA A;  3VP9 A;  1VQL P;  1CZQ A;  1S5L E;  1PL5 A;  4EDF A;  4ASW A;  1AJY A;  3CC4 P;  1Z56 A;  1HBW A;  1GL2 A;  1LJ2 A;  1NH4 A;  1FC2 C;  3H1L E;  2YO3 A;  2N9B A;  2J1G A;  2KP8 A;  2N1T C;  4L76 A;  1Q90 D;  2G3A A;  3N4X A;  2A45 H;  2FYU D;  4LLH A;  1SQX K;  1S9K D;  3HE4 A;  3L70 D;  1EXJ A;  1EDK A;  1A02 F;  3H1J J;  5KLV E;  2FBW C;  1QVG O;  1IJD B;  2ZVN B;  1PP9 G;  4CPG A;  4U3F J;  1NTM J;  1SQB D;  3TGU G;  1EDJ A;  1PGP A;  1RE4 C;  1T3U A;  1OVU A;  1LT9 A;  3RK2 C;  3SWY A;  3NMD A;  1ZRT D;  2HLO A;  1KMI Z;  2P10 A;  2W83 C;  1RH5 B;  2OQQ A;  1VQ6 P;  4BXL A;  3AE7 C;  1OZH A;  3B5N A;  3PTZ A;  3I56 P;  4Z1M H;  1SQV K;  2OYH C;  3C1L A;  1SQX E;  3A3Y B;  3IAO A;  4H13 C;  2HG5 D;  2WWW A;  3BCC J;  3RK3 D;  1Q81 Q;  2VRS A;  2HYN A;  1FZA A;  1FS0 E;  1VQ7 P;  1LTJ C;  1G1I A;  3H32 C;  3SSU A;  1IFI A;  1LWU C;  2A06 E;  3L4F A;  3PP5 A;  1YHQ P;  3GG2 A;  1FZD A;  2BCC D;  1SQV J;  4GOE A;  1UII A;  2Z4E A;  3CWB E;  3F5H A;  1D7M A;  3H1H D;  2Q3I A;  1RHZ B;  3FXD A;  1LTT C;  2A45 I;  3CCM P;  1EZV E;  2IZ1 A;  2W90 A;  4IFD K;  2NPS A;  3L73 D;  2N1T A;  1JEK A;  4YPC A;  3L72 D;  1NTZ D;  1U7J A;  4Y99 B;  3A0H H;  5L8R J;  3B5N C;  1FZE A;  5B5E E;  1LWU A;  3VP8 A;  1YJW P;  2GUV A;  2YNY A;  2KIK A;  5EFW B;  1SQB E;  3RK3 C;  2OYO A;  5B66 E;  3E1I A;  2V7Q J;  3EWK A;  1TU3 F;  4U7J A;  2Q1K A;  1JNM A;  3M06 A;  5AW1 B;  2KSJ A;  1RF0 B;  1SQX J;  1PPJ E;  1J1D C;  1URQ D;  3U1A A;  1ZN5 A;  1RF1 B;  3II6 A;  2ZT9 D;  3O8Z A;  1FIB A;  4I6M C;  3Q5P A;  2XNX B;  2QJK B;  3AEB C;  2J3O A;  2O01 J;  4JYC A;  2V7Q H;  2QJY C;  4OGQ B;  3BVH C;  2O1J A;  2JHI F;  3MUD A;  2PFX A;  3FXE A;  3CWB J;  4WY4 D;  5CCG C;  2M0B A;  4D6T E;  2Y0E A;  3WUU A;  1KIL A;  3JC2 2;  3EQ2 A;  3L74 G;  1ZLL A;  3FWL A;  2M3E A;  1QVF O;  3GMA A;  3AED C;  5H2F E;  2KI7 B;  1YTZ T;  3CCV P;  1PP9 J;  5KLI B;  3BAS A;  1BGY D;  1IO4 A;  1RF1 A;  1SQX D;  3HUS A;  1VQ9 P;  2PGD A;  1JMM A;  4MN4 C;  3VMX A;  4WY4 A;  1ZW0 A;  2E74 C;  1QEX A;  1XTG B;  1YYC A;  3CLQ A;  2WSC H;  3R4Y A;  1N86 C;  1SQP E;  5AW9 B;  3HD7 D;  4QMA A;  3L74 D;  2H43 A;  2Z5I A;  1ZRT E;  3MP7 B;  1JY3 N;  5KLI C;  5AW6 B;  3BRT B;  4H44 D;  2E74 B;  2NZ2 A;  4IFF A;  3RBX A;  3L75 D;  3PHL A;  1HVV A;  2ZXX A;  2RKL A;  3WUT A;  3V2P A;  1DX7 A;  2IBZ G;  1RY3 A;  1IFM A;  2KOG A;  2FYN B;  2OYI B;  2H43 C;  1SQV E;  5B5E H;  2YKP A;  5GTH E;  2WSE J;  3ZDM A;  5CJ0 A;  4YXD C;  4OGQ C;  5AVU B;  2XNX C;  3G4S P;  4EI2 A;  3D6Y A;  1VF5 D;  2BAS A;  1S3J A;  3E1I C;  3B5N D;  3LIE A;  2PAJ A;  3I5C A;  3H1H E;  2Q9I B;  1JY2 O;  4IFM A;  4I2L C;  1AFO A;  1X22 A;  2J0G A;  2R5B A;  1FZF A;  1S4X A;  1HJ0 A;  1OW7 A;  1SQX G;  4RES B;  1SQB J;  1X9V A;  4L74 A;  4IL6 X;  2YO2 A;  2FYN C;  1VQ4 P;  4N78 E;  1XTC C;  2AEM A;  3CX5 I;  1GL2 B;  4U3F E;  3H1H G;  3H1K D;  2LKM A;  1KYO E;  3H1J D;  2M5A B;  4ZKU A;  3WU2 H;  3L75 J;  4EYY Q;  3H1J G;  1DH3 A;  2H89 C;  2Q5U A;  2FY8 A;  5APW A;  3CWB G;  2J3F D;  3L72 E;  2KS1 B;  4U3F G;  1FIC A;  2C0X A;  3CME P;  1G2C B;  3L74 J;  3B4S A;  2WSF H;  3IF4 A;  2C9L Y;  4DT0 A;  1IFN A;  5AVX B;  1SQP D;  2YKO A;  2L91 A;  4EIJ A;  3V2Q A;  1Y47 A;  4L75 A;  3TNU A;  3H1K E;  1L2P A;  3T97 A;  3VTP C;  5E79 E;  4OGQ D;  1KZU B;  2H88 C;  1JY2 P;  1ZR4 A;  1SFC A;  2GA1 A;  3TK1 A;  2JEE A;  4PD4 H;  3R2P A;  4AYC A;  1YJN P;  2E5T A;  1S2E A;  4AQR D;  4KJM A;  1L0L E;  1FZB A;  3HE5 B;  3CXH I;  4RJT A;  2I8D A;  2WTY A;  3V2R A;  1FZC A;  4IL6 E;  3OJA B;  3S1K A;  3H1I J;  2FYU G;  5CHX A;  2Z5H A;  4DJG A;  1SQQ J;  1VQP P;  4ASV A;  5KJ7 C;  1OW8 A;  3GW6 A;  3U59 A;  4JBZ A;  2D39 A;  3A0B H;  1GMJ A;  1DIP A;  1FDM A;  2K1A A;  3P8C D;  4TLF A;  2FXO A;  2HLO C;  2HFE D;  5CCG A;  5CJ4 A;  1LT1 A;  3KDP B;  2HOD C;  3G6E P;  1PPJ D;  2P1J A;  3A5T A;  4OWF A;  2QIW A;  1A02 J;  1SQP K;  1GZL A;  3OAK A;  1BCC E;  1JY3 O;  3CCE P;  2WIT A;  4I1L A;  1N73 A;  3CXH H;  4WBA A;  1NTZ K;  2QJP C;  1WRG A;  3KZI H;  3ABV C;  2E76 C;  1S5L X;  2OTK E;  4BWN A;  1GL2 C;  1IFD A;  3H1L D;  5AW2 B;  2YKQ A;  3AE3 C;  2YMK A;  2CPB A;  3L73 J;  3BVH B;  1AV1 A;  2K3R A;  5TIS H;  4PV1 B;  3RL0 D;  3TGU D;  1SQB G;  2XZR A;  1EDL A;  5KAF H;  1FZB C;  2R44 A;  4JZC A;  2AEJ A;  3F89 A;  4D6T D;  1CSB A;  2QM8 A;  1KQL A;  3H1H J;  2M5A A;  1OIP A;  2IPP A;  2K9Y A;  3BCC E;  1VQ5 P;  1H88 A;  2BCC E;  2ZFC A;  3E1I B;  2YMY A;  3L75 G;  1JUN A;  3L71 J;  1BE3 G;  1LWU B;  3VMZ A;  1LTG C;  3CD6 P;  1Y9B A;  3PJS K;  1VF5 B;  1AVO A;  2YIU C;  2ZJS E;  1AQ5 A;  1KOR A;  2WPR A;  2OYI C;  2J3F A;  4UB6 H;  5AVR B;  2NPS D;  3H32 B;  1KB9 I;  1L0N D;  3IN6 A;  4GOD A;  1USE A;  1KIL C;  3RGU A;  5BU8 B;  3A0B E;  5KAF E;  1GDT A;  1BDD A;  2I1J A;  4GOF A;  2C0W A;  3SWK A;  4U3F D;  2ZYD A;  3TNU B;  3V4Q A;  2W8Z A;  2J58 A;  1NAY A;  3EFF K;  3FX0 A;  1G2C A;  1W2B O;  1EDI A;  1PGJ A;  4BRY A;  1Q2N A;  2R32 A;  3AE4 C;  2Y9Z A;  3AE2 C;  3H1I G;  2FYU J;  4R9J A;  2ZXE B;  3AEF C;  1IZN B;  2E76 D;  3SFD C;  2QM7 A;  4JYO X;  5APY A;  5TJH A;  4EOT A;  1KV4 A;  1HWT C;  1URQ A;  1EZV I;  2W6B A;  4HH2 A;  1T2K D;  1N7S A;  1K8A Q;  3CCS P;  2HR3 A;  1RQU A;  3VMA A;  3HRN A;  2D2C B;  4H13 D;  5APT A;  2ZYA A;  3NTN A;  3CX5 D;  4RO0 A;  5AW4 B;  5AVY B;  3V2N A;  1NKN A;  3PH0 A;  3M0A A;  4GIF A;  4R9T A;  3CXH E;  1IFP A;  1KFM A;  2R3C A;  1SFC C;  3FIB A;  3FWN A;  1PGO A;  3M91 A;  4W7Y A;  3HD7 B;  3FGA D;  4NPE A;  1FZG A;  2BEZ F;  2KB7 P;  1R5S A;  1FJK A;  1M1J C;  3M9H A;  4LC1 A;  3LID A;  3UIA A;  3L71 G;  2J61 B;  4XA4 A;  4YTP C;  1RE3 C;  1GW3 A;  1K9M Q;  3GHG C;  3KPE A;  2J3U A;  4IL6 H;  1URQ C;  5AVZ B;  5KKZ C;  2POH A;  2OGU A;  3BRV B;  3JCU E;  2DW3 A;  2J0Y A;  4GT1 A;  4PV1 D;  5CCH D;  4PD4 D;  4DOJ A;  2A06 G;  1L4A C;  3H32 A;  3GLM A;  5GTI H;  3L35 A;  2AXT E;  1M57 D;  1S1C X;  2OYH A;  3AE8 C;  1L0N J;  1AA0 A;  2O01 H;  1RE3 B;  1EZV G; 
#chains in the Genus database with same CATH homology
 1SFC D;  3NFQ A;  4ZKU A;  1L0N K;  2WPS A;  2JHK F;  2OYI A;  5KJ7 A;  4KHX A;  2Z4E B;  2W27 A;  5APS A;  2FFD A;  4GKG A;  1LTB C;  1IFJ A;  4XE5 B;  1DH3 A;  1SVF A;  3IFM A;  1FZC B;  3M0D A;  1G1J A;  2Q5U A;  2Q9I C;  3TYY A;  5APW A;  1SQB K;  2PP6 A;  1H8A A;  5APV A;  2J3F D;  2NPS C;  3VOP A;  1FZG C;  3GHG A;  5AVT B;  2JHL F;  4M3L A;  1FIC A;  2J0H A;  3MIW A;  1T3J A;  1ZV8 A;  2C0X A;  1FZA B;  5APX A;  1G2C B;  4LGD E;  1N7L A;  2J61 A;  5CCH C;  2WSF H;  1MFZ A;  1FZE C;  3CL3 D;  4C7N B;  2C9L Y;  1NTK K;  2L5G B;  1IFN A;  5AVX B;  2FYZ A;  1S9K E;  2YKO A;  1NOH A;  4EIJ A;  3V2Q A;  4B86 A;  1FOS F;  3CI9 A;  2A45 G;  1HJB A;  3TNU A;  5AW3 B;  1J1E C;  1M1J B;  2OAR A;  5AW0 B;  3RK2 B;  2HOD B;  3T97 A;  3VP9 A;  2FKW B;  1CZQ A;  2XNX A;  1WT6 A;  3VTP C;  1L4A A;  2J60 A;  2HLO B;  1KZU B;  1JCD A;  2WT7 A;  2HPC B;  2IFN A;  2E42 A;  1IK9 A;  1Z56 A;  1HBW A;  1GL2 A;  1JY2 P;  2OYH B;  1ZR4 A;  1SFC A;  1M7L A;  1NH4 A;  3VMY A;  1LT9 B;  2M8R A;  3TK1 A;  2FIB A;  2JEE A;  2C9N Y;  2YO3 A;  3R2P A;  4AYC A;  2N9B A;  1N73 C;  2J5Z A;  2J1G A;  1JOC A;  2KP8 A;  3A7O A;  4AQR D;  2N1T C;  1FZB A;  3HE5 B;  1VDF A;  3N4X A;  2A45 H;  3HD7 C;  1N7S B;  5KTB A;  3H6P A;  2WTY A;  4LLH A;  1SQX K;  2GM4 A;  3V2R A;  1FZC A;  5APU A;  1S9K D;  3OJA B;  3HE4 A;  2H7H A;  1Z3S A;  1FU1 A;  5CHX A;  2KLV A;  1A02 F;  2Z5H A;  1GU4 A;  4AUW A;  1RE3 A;  5KJ7 C;  1IJD B;  3U59 A;  4WY4 C;  1ZR2 A;  2D39 A;  3L36 A;  1FDM A;  1GW4 A;  1HGZ A;  3P8C D;  1JY2 N;  2J3G A;  3V4W A;  2E43 A;  2HLO C;  1RE4 C;  1T3U A;  2HFE D;  5CCG A;  5CJ4 A;  3KDP B;  1LT9 A;  2HOD C;  3RK2 C;  1T2K C;  1LTA C;  3SWY A;  3NMD A;  4ZFG A;  1NTM K;  2P1J A;  3A5T A;  1FZG B;  2HLO A;  1RE4 A;  4HYT B;  1A02 J;  1SQP K;  1GZL A;  1JCC A;  3V5B A;  3OAK A;  3M0D C;  1NU1 K;  2WZ7 A;  1JY3 O;  4JYB A;  2WIT A;  4I1L A;  1N73 A;  4N3Y B;  4WBA A;  3B5N A;  1NTZ K;  3SWF A;  5CCG D;  1SQV K;  3IR9 A;  2OYH C;  3M9Q A;  1WRG A;  3A3Y B;  2HG5 D;  2WWW A;  2GY7 A;  1GD2 E;  3RK3 D;  1MV8 A;  2VRS A;  1GL2 C;  2HYN A;  1RF0 C;  1FZA A;  3B5N B;  1IFD A;  5AW2 B;  2YKQ A;  1LT9 C;  1LTJ C;  1G1I A;  2HOD A;  1NO4 A;  2CPB A;  3H32 C;  3BVH B;  1LTS C;  3RL0 D;  2XZR A;  1IFI A;  1LWU C;  1FZB C;  3L4F A;  3PP5 A;  4JZC A;  1SQQ K;  1FZD A;  2GUS A;  2Z4E A;  1CSB A;  2QM8 A;  1KQL A;  3MD0 A;  3MTU E;  3N7N A;  3KYQ A;  2Q3I A;  2IPP A;  1H88 A;  1FID A;  1LTT C;  2A45 I;  2ZFC A;  3E1I B;  1CI6 B;  1SP4 A;  2YMY A;  4C46 A;  1JUN A;  2XDJ A;  2J2P A;  3P8M C;  4IFD K;  2NPS A;  1LWU B;  3VMZ A;  1LTG C;  2JHH C;  2N1T A;  3B8E B;  1JO5 A;  3HTK A;  5AVW B;  1E5W A;  2Q7C A;  2FFD B;  3A2A A;  4Y99 B;  1EQ7 A;  1X79 B;  1H89 A;  1AQ5 A;  2WPR A;  3HTK B;  4WB4 A;  3B5N C;  2OYI C;  2J3F A;  1FZE A;  1LWU A;  1JC9 A;  3VP8 A;  1T8Z A;  2GUV A;  5AVQ B;  2YNY A;  4ZKP A;  3RK3 C;  3E1I A;  5AVR B;  3HE5 A;  2NPS D;  3H32 B;  3RK3 B;  2IFM A;  1JNM A;  3M06 A;  5AW1 B;  2KSJ A;  1N2D C;  1RF0 B;  2JHM F;  2HPC A;  1J1D C;  1KIL C;  1GL2 D;  1URQ D;  1SFC B;  5BU8 B;  3U1A A;  1ZN5 A;  1RF1 B;  1GDT A;  3II6 A;  2I1J A;  3O8Z A;  1FIB A;  4I6M C;  5AVV B;  2XNX B;  1OXZ A;  5KJ7 D;  1GTW A;  1FOS E;  3BAT A;  2C0W A;  1RE4 B;  3RL0 C;  1MZ9 A;  2J3O A;  4JYC A;  5AW5 B;  3TNU B;  3BVH C;  1LTJ A;  2O1J A;  3V4Q A;  2JHI F;  4C7N A;  2J58 A;  3MUD A;  1MUU A;  5AW7 B;  2WPQ A;  1Z3U A;  1G2C A;  4WY4 D;  5CCG C;  3P7K A;  4M7F A;  3G3Z A;  3P8C E;  3GHG B;  1NHL A;  1LGH B;  2R32 A;  1KIL A;  2M3B A;  3EQ2 A;  1ZLL A;  5BVZ A;  2FXM A;  4R9J A;  1LTJ B;  2ZXE B;  1L0L K;  2MJZ A;  1GK4 A;  1KFN A;  2H43 B;  1N7S C;  4W7Z A;  1GK6 A;  1YTZ T;  3RK2 D;  2QM7 A;  4JYO X;  5APY A;  2N1T B;  4NYT A;  4EOT A;  1HWT C;  2J59 M;  5CMZ A;  1URQ A;  3BAS A;  2W6B A;  2XU6 A;  4HH2 A;  1T2K D;  2P67 A;  1N7S A;  1RF1 A;  1IO4 A;  1FBM A;  3HUS A;  2H8P D;  5KLV K;  1JMM A;  3VMX A;  4EPU A;  3M9B A;  1NWQ A;  4WY4 A;  3HRN A;  3C9I A;  1PFI A;  1XTG B;  4M7H A;  2FYU K;  3HUS C;  1YYC A;  2XV5 A;  1YTZ I;  3CLQ A;  5APT A;  5CCH A;  1N86 B;  3HE4 B;  3NTN A;  1FJP A;  3MGN A;  3U1C A;  2I1K A;  2WSC H;  3P32 A;  1L4A B;  5AW4 B;  2N1T D;  1N86 C;  1N7S D;  5AVY B;  2WT7 B;  3BVH A;  3V2N A;  5AW9 B;  1NKN A;  2Q9I A;  5AW8 B;  3HD7 D;  2WSE H;  3M0A A;  1M1J A;  1HUC A;  4N78 D;  2Z5I A;  2H43 A;  1IC2 A;  1JTH B;  4GIF A;  3L37 A;  4WY4 B;  1FAV A;  4R9T A;  5APQ A;  1JY3 N;  1VPC A;  1NAF A;  1KFM A;  3HUS B;  2R3C A;  1SFC C;  5AW6 B;  3FIB A;  3BRT B;  1CW5 A;  1DEB A;  3TSI A;  1OWA A;  4N6J A;  2P7J A;  1N73 B;  4IFF A;  3KQG A;  1NKZ B;  3M91 A;  4W7Y A;  1JY3 P;  2O1K A;  3HD7 B;  1FZG A;  1FZA C;  2W6A A;  1HVV A;  4OH8 B;  1L4A D;  2KYV A;  3V2P A;  3HD7 A;  3OA7 A;  1J1D B;  1KIL B;  2KB7 P;  1DX7 A;  4JF7 A;  1RY3 A;  1FJK A;  3LW5 H;  1IFM A;  2KOG A;  1J1E B;  1M1J C;  3M9H A;  1SLQ A;  3LID A;  4LC1 A;  2OYI B;  2H43 C;  1HTL C;  2YKP A;  3UIA A;  5CJ0 A;  5BU5 A;  2J61 B;  1QL1 A;  2WNP F;  2HPC C;  4XA4 A;  1RE3 C;  5AVU B;  1GW3 A;  2CPS A;  3VN0 A;  1RF0 A;  3GHG C;  3KPE A;  2J3U A;  1JTH A;  1URQ C;  2XNX C;  1J2J B;  4W80 A;  5AVZ B;  4O9B A;  2POH A;  2J64 A;  3EFG A;  3BRV B;  2BAS A;  3E1I C;  3B5N D;  3VYI A;  4Y99 C;  3LIE A;  4DZO A;  1FZF B;  1KIL D;  2PAJ A;  1FZF C;  3I5C A;  2FFD C;  1HH0 A;  1LTI C;  2J0Y A;  4GT1 A;  4C7R A;  3WMM 0;  2Q9I B;  1JY2 O;  1QL2 A;  5CCH D;  3RL0 B;  4IFM A;  1FZE B;  4I2L C;  1AFO A;  1FZB B;  2J0G A;  1HGV A;  2R5B A;  1FZF A;  2XKM A;  4DOJ A;  1X8Y A;  4RES B;  1N86 A;  1RF1 C;  1L4A C;  1X9V A;  2NPS B;  3H32 A;  2YO2 A;  2P2U A;  3L35 A;  2JJL A;  1XTC C;  4N78 E;  1CI6 A;  1GU5 A;  1FZC C;  2R5D A;  1GL2 B;  1W2E A;  2IX7 C;  2OYH A;  5AVS B;  1URQ B;  2LKM A;  3NXS A;  2Z4E C;  2O01 H;  1RE3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...