2FIBA

Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) complexed to the peptide gly-pro-arg-pro at ph 6.0
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
250
structure length
250
Chain Sequence
VQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (blood coagulation/peptide)
molecule keywords FIBRINOGEN
publication title The primary fibrin polymerization pocket: three-dimensional structure of a 30-kDa C-terminal gamma chain fragment complexed with the peptide Gly-Pro-Arg-Pro.
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 1997-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2fibA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2fibA02
1N86C 2XNXB 4M7HA 1Z3SA 3H32C 3BVHB 1FZAC 1FZFB 1LWUC 1FZGC 1N73B 1FZEB 2J2PA 1RE4C 2J3OA 2FFDB 2OYIB 2OYHC 2Z4EB 4R9TA 2D39A 1N86B 1LT9C 1FZDA 2GY7A 2FIBA 1M1JC 2HODC 2J5ZA 2JHLF 1FZCC 2J60A 3H32B 2J61B 2H43B 1FZAB 2J61A 2J3UA 2HLOC 2WNPF 1LWUB 1FZGB 1RF0B 1RF1C 3E1IC 2OYHB 1Z3UA 1FZBB 1JC9A 3HUSC 2HPCC 1LT9B 2J1GA 1RE3C 2Q9IC 1FIBA 2JHKF 4ZFGA 2XNXC 4JYOX 1FZCB 4EPUA 2J3FD 2HLOB 1FICA 1RF1B 2J64A 2J3FA 2J0GA 4M7FA 1FIDA 1N73C 1FZEC 1RE4B 2J0YA 2HPCB 2FFDC 2OYIC 2JHMF 1LTJC 1RE3B 2Q9IB 3FIBA 4R9JA 1M1JB 4NYTA 2HODB 2J0HA 2JHIF 2H43C 3BVHC 1FZFC 2JHHC 2J3GA 3E1IB 3GHGC 1RF0C 1FZBC 1LTJB 3HUSB 2Z4EC 4JZCA
chains in the Genus database with same CATH superfamily
1N86C 2XNXB 4M7HA 1Z3SA 3H32C 3BVHB 1FZAC 1FZFB 3GHGB 1LWUC 1FZGC 1N73B 1FZEB 2J2PA 1RE4C 2J3OA 2FFDB 2OYIB 2OYHC 2Z4EB 4R9TA 2D39A 1N86B 1LT9C 1FZDA 2GY7A 2FIBA 1M1JC 2HODC 2J5ZA 2JHLF 1FZCC 2J60A 3H32B 2J61B 2H43B 1FZAB 2J61A 2J3UA 2HLOC 2WNPF 1LWUB 1FZGB 1RF0B 1RF1C 3E1IC 2OYHB 1Z3UA 1FZBB 1JC9A 3HUSC 2HPCC 1LT9B 2J1GA 1RE3C 2Q9IC 1FIBA 2JHKF 4ZFGA 2XNXC 4JYOX 1FZCB 4EPUA 2J3FD 2HLOB 1FICA 1RF1B 2J64A 2J3FA 2J0GA 4M7FA 1FIDA 1N73C 1FZEC 1RE4B 2J0YA 2HPCB 2FFDC 2OYIC 2JHMF 1LTJC 1RE3B 2Q9IB 3FIBA 4R9JA 1M1JB 4NYTA 2HODB 2J0HA 2JHIF 2H43C 3BVHC 1FZFC 2JHHC 2J3GA 3E1IB 3GHGC 1RF0C 1FZBC 1LTJB 3HUSB 2Z4EC 4JZCA
chains in the Genus database with same CATH topology
1N86C 2XNXB 4M7HA 1Z3SA 3H32C 3BVHB 1FZAC 1FZFB 1LWUC 1FZGC 1N73B 1FZEB 2J2PA 1RE4C 2J3OA 2FFDB 2OYIB 2OYHC 2Z4EB 4R9TA 2D39A 1N86B 1LT9C 1FZDA 2GY7A 2FIBA 1M1JC 2HODC 2J5ZA 2JHLF 1FZCC 2J60A 3H32B 2J61B 2H43B 1FZAB 2J61A 2J3UA 2HLOC 2WNPF 1LWUB 1FZGB 1RF0B 1RF1C 3E1IC 2OYHB 1Z3UA 1FZBB 1JC9A 3HUSC 2HPCC 1LT9B 2J1GA 1RE3C 2Q9IC 1FIBA 2JHKF 4ZFGA 2XNXC 4JYOX 1FZCB 4EPUA 2J3FD 2HLOB 1FICA 1RF1B 2J64A 2J3FA 2J0GA 4M7FA 1FIDA 1N73C 1FZEC 1RE4B 2J0YA 2HPCB 2FFDC 2OYIC 2JHMF 1LTJC 1RE3B 2Q9IB 3FIBA 4R9JA 1M1JB 4NYTA 2HODB 2J0HA 2JHIF 2H43C 3BVHC 1FZFC 2JHHC 2J3GA 3E1IB 3GHGC 1RF0C 1FZBC 1LTJB 3HUSB 2Z4EC 4JZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N86 C;  2XNX B;  4M7H A;  1Z3S A;  3H32 C;  3BVH B;  1FZA C;  1FZF B;  1LWU C;  1FZG C;  1N73 B;  1FZE B;  2J2P A;  1RE4 C;  2J3O A;  2FFD B;  2OYI B;  2OYH C;  2Z4E B;  4R9T A;  2D39 A;  1N86 B;  1LT9 C;  1FZD A;  2GY7 A;  2FIB A;  1M1J C;  2HOD C;  2J5Z A;  2JHL F;  1FZC C;  2J60 A;  3H32 B;  2J61 B;  2H43 B;  1FZA B;  2J61 A;  2J3U A;  2HLO C;  2WNP F;  1LWU B;  1FZG B;  1RF0 B;  1RF1 C;  3E1I C;  2OYH B;  1Z3U A;  1FZB B;  1JC9 A;  3HUS C;  2HPC C;  1LT9 B;  2J1G A;  1RE3 C;  2Q9I C;  1FIB A;  2JHK F;  4ZFG A;  2XNX C;  4JYO X;  1FZC B;  4EPU A;  2J3F D;  2HLO B;  1FIC A;  1RF1 B;  2J64 A;  2J3F A;  2J0G A;  4M7F A;  1FID A;  1N73 C;  1FZE C;  1RE4 B;  2J0Y A;  2HPC B;  2FFD C;  2OYI C;  2JHM F;  1LTJ C;  1RE3 B;  2Q9I B;  3FIB A;  4R9J A;  1M1J B;  4NYT A;  2HOD B;  2J0H A;  2JHI F;  2H43 C;  3BVH C;  1FZF C;  2JHH C;  2J3G A;  3E1I B;  3GHG C;  1RF0 C;  1FZB C;  1LTJ B;  3HUS B;  2Z4E C;  4JZC A; 
#chains in the Genus database with same CATH topology
 1N86 C;  2XNX B;  4M7H A;  1Z3S A;  3H32 C;  3BVH B;  1FZA C;  1FZF B;  3GHG B;  1LWU C;  1FZG C;  1N73 B;  1FZE B;  2J2P A;  1RE4 C;  2J3O A;  2FFD B;  2OYI B;  2OYH C;  2Z4E B;  4R9T A;  2D39 A;  1N86 B;  1LT9 C;  1FZD A;  2GY7 A;  2FIB A;  1M1J C;  2HOD C;  2J5Z A;  2JHL F;  1FZC C;  2J60 A;  3H32 B;  2J61 B;  2H43 B;  1FZA B;  2J61 A;  2J3U A;  2HLO C;  2WNP F;  1LWU B;  1FZG B;  1RF0 B;  1RF1 C;  3E1I C;  2OYH B;  1Z3U A;  1FZB B;  1JC9 A;  3HUS C;  2HPC C;  1LT9 B;  2J1G A;  1RE3 C;  2Q9I C;  1FIB A;  2JHK F;  4ZFG A;  2XNX C;  4JYO X;  1FZC B;  4EPU A;  2J3F D;  2HLO B;  1FIC A;  1RF1 B;  2J64 A;  2J3F A;  2J0G A;  4M7F A;  1FID A;  1N73 C;  1FZE C;  1RE4 B;  2J0Y A;  2HPC B;  2FFD C;  2OYI C;  2JHM F;  1LTJ C;  1RE3 B;  2Q9I B;  3FIB A;  4R9J A;  1M1J B;  4NYT A;  2HOD B;  2J0H A;  2JHI F;  2H43 C;  3BVH C;  1FZF C;  2JHH C;  2J3G A;  3E1I B;  3GHG C;  1RF0 C;  1FZB C;  1LTJ B;  3HUS B;  2Z4E C;  4JZC A; 
#chains in the Genus database with same CATH homology
 1N86 C;  2XNX B;  4M7H A;  1Z3S A;  3H32 C;  3BVH B;  1FZA C;  1FZF B;  1LWU C;  1FZG C;  1N73 B;  1FZE B;  2J2P A;  1RE4 C;  2J3O A;  2FFD B;  2OYI B;  2OYH C;  2Z4E B;  4R9T A;  2D39 A;  1N86 B;  1LT9 C;  1FZD A;  2GY7 A;  2FIB A;  1M1J C;  2HOD C;  2J5Z A;  2JHL F;  1FZC C;  2J60 A;  3H32 B;  2J61 B;  2H43 B;  1FZA B;  2J61 A;  2J3U A;  2HLO C;  2WNP F;  1LWU B;  1FZG B;  1RF0 B;  1RF1 C;  3E1I C;  2OYH B;  1Z3U A;  1FZB B;  1JC9 A;  3HUS C;  2HPC C;  1LT9 B;  2J1G A;  1RE3 C;  2Q9I C;  1FIB A;  2JHK F;  4ZFG A;  2XNX C;  4JYO X;  1FZC B;  4EPU A;  2J3F D;  2HLO B;  1FIC A;  1RF1 B;  2J64 A;  2J3F A;  2J0G A;  4M7F A;  1FID A;  1N73 C;  1FZE C;  1RE4 B;  2J0Y A;  2HPC B;  2FFD C;  2OYI C;  2JHM F;  1LTJ C;  1RE3 B;  2Q9I B;  3FIB A;  4R9J A;  1M1J B;  4NYT A;  2HOD B;  2J0H A;  2JHI F;  2H43 C;  3BVH C;  1FZF C;  2JHH C;  2J3G A;  3E1I B;  3GHG C;  1RF0 C;  1FZB C;  1LTJ B;  3HUS B;  2Z4E C;  4JZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...