1RF0C

Crystal structure of fragment d of gammae132a fibrinogen
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLAAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 85
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf0C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf0C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf0C03
1N73B 2J61B 1RF0B 2JHHC 1LTJC 3GHGA 2HODB 2XNXC 4M7HA 4M7FA 1N73C 3FIBA 1N86A 2Z4EC 1FIBA 1M1JA 1FZAC 1JC9A 1JY3N 2Q9IA 1LTJB 1RF0C 2J3FD 1FZCA 3HUSC 3HUSA 3H32A 3H32C 4EPUA 1LT9B 1W2EA 1RF0A 2J0HA 2Q9IC 1FZCB 1FZBB 1RE3B 2HLOA 2FFDC 1Z3UA 1FZGC 2XNXB 4R9JA 1N73A 2H43B 1RF1C 2HODA 2XNXA 2J3FA 4NYTA 3H32B 3HUSB 2HODC 1RF1A 2OYHB 2JHIF 1LTJA 2WNPF 1T3UA 2J5ZA 1FZAB 1FZGA 2HPCB 2FFDA 2HLOC 1Z3SA 3E1IB 1FIDA 1JY3O 1RE3C 2D39A 2Z4EB 1FZFA 1JY2N 1RE4A 1FZGB 2Q9IB 3BVHC 2J3UA 1FICA 2HLOB 3E1IC 2J3GA 1LWUB 2HPCC 1FZCC 1LT9A 2J60A 2J3OA 3BVHB 2JHKF 2J1GA 4JZCA 1LWUA 1FZAA 1M1JC 2J2PA 1JY2O 2OYHA 1RF1B 2H43C 1M1JB 1FZEB 1FZEA 1N86C 2Z4EA 1RE4B 1FZFB 1FZEC 4R9TA 1JY3P 2H43A 2OYHC 2A45H 2OYIB 1LWUC 4JYOX 3GHGC 2J64A 2JHLF 2J0GA 3GHGB 1LT9C 3E1IA 2HPCA 2FFDB 2A45G 2OYIC 2J0YA 1FZBC 4ZFGA 3BVHA 2FIBA 2GY7A 2A45I 1RE4C 1FZFC 2J61A 1N86B 1FZDA 1RE3A 1FZBA 1JY2P 2OYIA 2JHMF
chains in the Genus database with same CATH superfamily
1M7LA 2IBZI 1L0LE 3HD7C 2OYOA 1S5LE 2JEEA 5CJ0A 1YTZI 3B8EB 1FIBA 2ZXXA 3OW2O 3V4WA 4GOFA 5E79E 5DJUB 2WZ7A 1RF0C 3L70J 4PD4D 3CCLP 4OVNF 2J0HA 1FZCB 2ZXEB 2YIUC 1LTTC 3PLNA 1SQBE 2ZVOB 3H1LJ 4GT1A 2W6AA 2IZ1A 3G71P 3H32B 2WPVB 1ZMEC 2AEMA 3L71D 2FFDA 1EZVD 5CCHD 2QA4P 4D6TE 1NGMB 3BVHC 2IFMA 5AW1B 2KS1B 1BGYE 3M0DC 1CZQA 2Z5IA 3V2QA 1JNMA 2OYHA 5APYA 1FZEB 3HTKA 2H8PD 2W83C 2KZIA 4LC1A 5BVZA 2QJYB 4IOIH 2QM7A 4PJ0H 1D7MA 3U1CA 1LT9C 3QWOC 1FDMA 1KN7A 2OQQA 3BATA 2E76B 1QVFO 2KUBA 2KZJA 4EOTA 2N1TC 2SPZA 2J5UA 1JY2P 1KQSO 1HJ0A 2LXBA 1JEKA 1JCCA 5AVSB 4M7HA 1PL5A 5CJ4A 3EFFK 4N78D 1YQ3C 2M8RA 3AEGC 2R44A 3RK2B 1NAYA 1S5LH 3L35A 4AYCA 3CX5E 3E1RA 3CD6P 2KIKA 5KJ7A 1IK7A 3CI9A 4BXLA 2XNXB 1L0LG 2C9LY 1Q81Q 2E75C 3L74G 1RF1A 1KYOH 3AE9C 3CCQP 3TGUG 1J1DB 1W2BO 2Q9IB 1AQTA 4GODA 4OWFA 1J2JB 2WMMA 1QEXA 1WMKA 2JHKF 3RBZA 1K9MQ 1G1JA 1R8EA 2IFNA 1KQLA 1JY2O 1PGJA 3CXHD 2WSEH 1PFIA 3M06A 1BCCE 4R4MA 2GUVA 2A45H 3V2PA 1IO4A 3PH0A 1J1EB 2B87B 2ZT9C 2WSCH 3L4FA 2FIBA 2HR3A 3E7KA 4H13D 1GL2B 3CMAP 1NTMJ 2JHHC 1PP9G 1SQQJ 1SQXG 2CPBA 3PJSK 3RK2D 1LTIC 2KB7P 4WVZA 1RHZB 3WU2E 1VQ8P 1OVUA 5KLVJ 1PP9E 3QH9A 3L75J 2Y9YA 2W90A 1BSHA 3OJAB 2XV5A 3H1ID 3H1LE 1FOSE 1VQ9P 2M3EA 1RF0A 3IFMA 3CX5D 1KFNA 1M56D 1H8AA 3H1LG 1NVOA 2MJZA 2FKWB 1LTSC 2YKOA 2IYOA 3H1JD 2HODC 4O9BA 1IFNA 2J5ZA 1GZLA 3A3YB 1UIIA 1DEEG 3A0BH 1YJ9P 3CWBG 1MKMA 1SQQE 1FICA 2HLOB 3HD7B 2YNYA 1LWUA 2QSIA 3CCJP 2C0XA 2WVRA 1BDCA 3H1JJ 1VDFA 5GTHH 1JY3P 1Q86Q 4R4LA 1DX7A 1NWQA 3L74E 3L73G 3GHGC 5KLVG 1NTZJ 1NU1J 2KK7A 5AW7B 4Z1MH 3NMDA 2J61A 1FZBA 1PGOA 1NKZB 3M9BA 3D6ZA 2J61B 3RK3B 1LTGC 1PIXA 1JO5A 4WY4A 2E75B 3AE6C 1EXIA 1USEA 1ZRTE 1EDKA 1JMBA 1X22A 4W7YA 1ZLLA 3CXHH 5GTIE 1NTZE 3MIWA 1GTWA 2ZYDA 1LGHB 1CW5A 1E79H 3LIDA 3H1LD 2QG4A 1OVVA 1K05A 1KQGB 1SQBG 1SQBK 1KFMA 1N7LA 1EZVI 4IFFA 1N8RQ 1W2EA 2YXRB 3P7KA 5APQA 1URQB 4U3FE 1LJ2A 2BEQD 2WITA 3U59A 1BCCG 2XU6A 1OWAA 4XFJA 3CMEP 1PZQA 1SQXE 2IYPA 2OYHB 2XNDH 1U7MA 4EI2A 2HPCB 1JY3O 2N1TB 1L0LK 1AVOA 1OIPA 2QJPC 4AQRD 2K9YA 3H1KJ 1T6AA 1RQVA 1YIJP 2E43A 3MTUE 1SS1A 4L75A 2G8YA 5CCHC 3WUUA 1FZEA 1S3JA 1ZV8A 4JF7A 1JTHA 1SQVK 3M9QA 1KYOD 1S2EA 1LWUC 4NPFX 4PV1C 4WY4C 2RN0A 5CCGC 3H25A 2K88A 5AVWB 4ASWA 1IFPA 1FZBC 1SQBJ 1FZFC 5GTIH 1GMJA 1ZW0A 3MD0A 2C0WA 2KXPB 2JDIH 5AW5B 3LW5H 4C46A 1NU1D 3AEEC 1Q7YQ 2BCCJ 2ZYGA 1JUNA 3O6QA 3GW6A 4JQ0D 4K35A 3HD7D 1EDJA 4N3YB 1SQVD 4I2LC 2OTKE 4OGQB 2LXCB 1P84I 2K3RA 2XNXA 2JWDA 1HGZA 5EFWB 2PAJA 1T2KC 1Y9BA 2NPSB 3W67A 4RJTA 1KQFB 3RL0D 3CLQA 3Q5PA 1SQVG 3I55P 2KNCA 1JM0A 5APWA 1FDOA 2BCCE 2YMYA 3FWLA 3G9RA 4HJGH 1FBMA 2Z4EA 1NTMG 1NTZG 2BCCG 2H43A 3L73J 1L4AA 1W5CE 5H2FH 1VPCA 1HJBA 3GHGB 1J1DC 2KI7B 3E1IA 1URQC 1OVRA 1R5SA 3JCUH 1FJKA 2I1JA 1NO4A 4PD4H 1YBKA 3L71E 1L0NJ 4AUWA 2NRGA 4LLHA 4IL6E 1S9KD 1NTMK 1VQ7P 1ZP0C 3RK2C 1FJPA 2J3FD 3VTPC 3CCSP 1OXZA 3TDKA 2QJPB 3S1KA 1L0NE 3TSIA 4H13C 3CCRP 2GM4A 2HLOA 4HH2A 1GW4A 2CK3H 3HRNA 3BRTB 2KSJA 3VMYA 3Q5SA 5K5GB 2WNPF 2R3CA 2QE7H 5CMZA 1VQNP 3VMAA 2HLOC 1RE3C 2N1TA 1VQOP 1USDA 1FU1A 2WWWA 2VRSA 1MFZA 2QJYC 4DOJA 3LIEA 2QIWA 4IFDK 2ZVNB 1EDIA 3Q2YA 4TT3H 2B89A 5KLVE 1NTMD 1KILE 1BE3D 4R9TA 4YXDC 1BE3E 3CX5H 2OYIB 2AXTE 3AE2C 1EXJA 2QEXP 2J0GA 1WT6A 2ITAA 4GKGA 1GK4A 2Y0DA 1FZDA 2Q5UA 3L73D 5DJTB 1NHLA 2L5GB 4OGQD 1YQ4C 1VQ4P 1VF5C 4EIJA 1KYOI 5M1BA 3AEDC 1L4AC 4IL6X 1ZRTD 2JKVA 2A06E 4W7ZA 1LTJB 1RY3A 3HUSA 2FFDC 4UB8E 2XZRA 5CBNA 3OAKA 1MUUA 4D6TG 2JHIF 5B5EH 5AVUB 2FYZA 1SQPG 3AE7C 3H1IJ 1FZFA 2WPRA 1N2DC 3T97B 2O1JA 2FYUK 1H0TA 3JSVC 2HFED 5AW2B 3RL0g 1EZVE 3VN0A 4KHXA 1M1JC 3A5TA 1CI6B 2R5BA 1VQMP 4N6JA 3NTNA 1FZEC 1G1IA 1JTHB 4EYYQ 2WSFJ 3CWBD 3S4RA 3KYQA 3HE5B 3JC22 1YJWP 1M90Q 4TLFA 5BU8B 2FFDB 4UB6H 2WPSA 1SQXD 1L0NG 5APSA 2WSFH 3L70E 2K9JB 3WMM0 1PP9D 3L36A 1LTJC 5APUA 2YMKA 1H0TB 2J59M 4ASVA 5APTA 3A0HH 2Q3IA 1NU1K 3H1HG 3FIBA 1DEBA 3MZWB 2YO2A 2BASA 1HWTC 1A02J 1NTKK 1JC9A 5B66E 3L72D 1FC2C 3H32A 1SQQD 3Q1MA 4EPUA 2E76D 1PV3A 1PPJD 3EFGA 3L75D 1GK6A 2H43B 4KT0J 4UB6E 4HB1A 2OGUA 3VP8A 1MV8A 1T3UA 3H6PA 1FZAB 3L72J 1X0TA 1ZR4A 1N7SC 3VMXA 1JY2N 2QJKC 1VQ6P 2IDBA 3RK3E 4BWNA 1P84E 2JO1A 3PHLA 4U3FJ 2P10A 3BRVB 4PJ0E 1G2CB 1KORA 1T3JA 2FXOA 1EC5A 1KILD 1FE6A 1L4AB 1QGKB 3MHVA 1IFDA 2WT7B 1FDIA 5AVYB 1SFCC 1FAVA 2XKMA 1KZUB 2JR8A 2WT7A 3GF7A 3H1JE 4ZFGA 3H1HD 4UB8H 4N78E 2E74D 2BEZF 1IZNB 1XTCC 3C8VA 3H1JG 1RF0B 3CX5I 4HYTB 3TF5A 2AEJA 1KB9I 2RMZA 1JCDA 2OTJP 1K8AQ 1R5LA 2CPSA 3N4XA 2FYNB 1P84D 3RBXA 3HE4A 3AECC 1L0LJ 2ZFCA 1SQBD 5AVVB 3CXHI 3IAOA 3HUSC 3W68A 4C7NB 1AJYA 1Z56A 1EZVG 1NH4A 3CC4P 1VQKP 2O01N 3B5ND 1Z3UA 1FZGC 1GL2D 1SQPK 1SFCB 2PRRA 4H44B 1BGYJ 2R5DA 1NJIQ 2LKMA 3H1HE 1YITP 1K04A 1S4XA 1RE4A 4I1LA 1K73Q 2RH0A 4JYCA 1VL2A 3L70G 3T97A 2NPSC 5B66H 1KILB 1AVYA 3PTZA 2Q7CA 2H89C 3SWFA 5TISE 3B5NC 3II6A 2D2CD 5AW4B 3V5BA 3NXSA 2KNCB 2V7QH 2AEFA 4JYOX 1TU3F 2WQYC 3FGAD 1KB9E 3AEFC 3M9HA 1VQ5P 2GY7A 1M1KQ 1RE3A 1AA0A 4ZMDA 3VOPA 4XA4A 3OA7A 1EDLA 1GW3A 3L74J 2P2UA 4H13B 1KV4A 1N73C 1QL1A 2PFXA 1NOHA 1JB0J 3WUTA 3NFQA 1SFCD 1FZCA 4H44D 2M0BA 1DIPA 1YTZT 2XDJA 4JBZA 3TGUD 3SFDC 4JYBA 5KKZC 1FZBB 3U1AA 1L0ND 3WUVA 1AQ5A 2HYNA 1N73A 1SQPE 1H88A 3D71A 1NU1E 3MP7B 2OTLP 3L70D 5AVXB 2WSSH 3R2PA 5KJ7C 1N7SD 3V2NA 1BDDA 1FZCC 1LT9A 4JZCA 4YPCA 1LT1A 4ZKUA 1SQXJ 3K5BA 1NTZK 1NYHA 2FYNC 2OYHC 5APXA 2FY8A 4EDFA 3Q3DA 4DCKA 2KLUA 3P8CE 3H1KE 1SLQA 4A7PA 2QM8A 2HPCA 2OYIC 2J0YA 1RH5B 3BVHA 2FYUE 4QMAA 3ITKA 1RE4C 1H89A 4GDOA 3L73E 4JPZB 1KD1Q 2KLVA 3G3ZA 3LW5J 1AV1A 2IBZD 2HODB 5GTHE 2XNXC 1IJDB 3H1IE 3MGNA 1HTLC 1S5LX 3B5NA 3RK3D 2MKVA 2Z5HA 3C9IA 1OW8A 3L72G 4PV1D 4WY4D 2ZYAA 1EQ7A 4I7ZC 3KQGA 3H1KD 1DD4A 2O01J 2FXPA 3Q5RA 1NKNA 1FZGA 1PPJG 3E1IB 2FXMA 1OMIA 1YHQP 2ZAEB 1IK9A 3BCCE 2N9YB 3WU2H 2K1AA 4U3FG 2KSEA 4DJGA 1RF1B 2W6BA 4ZNCA 1S1CX 2M3BA 5KJ7D 5CCHA 2YO3A 4PD4E 3USSA 1NTKG 1JOCA 2Y0EA 2KP8A 5AVRB 2QVAA 2B9BA 1IFIA 4ZKPA 1GD2E 3L71G 4LGDE 3ZDMA 1BE3J 2IBZG 5H2FE 1L0LD 4H44C 1BCCJ 2OARA 3B71A 1SP4A 3VYIA 1LP1B 4MN4C 1QLED 3FXDA 3PP5A 4M7FA 4OGQC 2V4HA 3VP9A 1SQVJ 1FZAC 3UIAA 1GDTA 2C9NY 1Y8AA 5KLIB 3H1KG 5AW0B 2H7HA 3L71J 4I7ZB 1RE3B 1SQPD 2G3AA 2ZT9B 3GMAA 3B4SA 3SFEC 3AEBC 3CPWO 3CWBE 1SQQG 2D2CC 2K37A 3I5CA 2Y9ZA 3L75G 2K9JA 5KAFE 2J3UA 2POHA 2M5AA 2IX7C 3D6YA 2YKQA 3TGUE 1KMIZ 2LR2A 2NPSD 1NAFA 3L75E 1PGQA 3M0AA 1N86C 1RE4B 1FZFB 3TNUB 5CBOA 2BCCD 1OW7A 3N7NA 2P1JA 5BU5A 2WPQA 2I1KA 1KB9D 2JHLF 4K3AA 5AVTB 2P67A 4PV1B 4WY4B 5KTBA 3L72E 2W8ZA 2PGDA 2A45I 1N86B 3CCVP 4RKUJ 1N73B 3CWBJ 4RO0A 3GHGA 5KLVK 2M5AB 4WB4A 5KAIH 3A7OA 2YIUB 1BGYD 1M1JA 1URQD 3S9OA 1JY3N 4WBAA 2ZT9D 4I6MC 1BCCD 1KC8Q 1QVGO 2JWAA 1YJNP 1GU4A 1NU1G 3BCCG 4NPDA 2KYVA 4BRYA 3JCUE 4R9JA 5AVZB 3GG2A 2HODA 4NYTA 1M8OB 5KAIE 3VMZA 4L73A 3GLMA 3BCCD 4IFMA 1Z3SA 2D39A 1LNQA 2P7JA 4U7JA 1T2KD 3RGUA 4GOEA 5AW3B 2HPCC 3IR9A 1JMMA 1AFOA 1OW6A 2E75D 1WRGA 2HG5D 3HTKB 1KB9H 3CL3D 1Q2NA 4H0LB 1XTGB 1M1JB 4WWIA 2E5TA 2FYUG 2O3JA 3SWYA 1KYOE 1A02F 3SWKA 2J64A 1Y47A 1QX8A 5C39A 1BE3G 3F89A 2FBWC 3O6QB 3L37A 5KAFH 2UWJE 2OYIA 1VQPP 3A2AA 3TGUJ 5AW8B 5KLIC 1ZOYC 3GF3A 1J1EC 2KOGA 1IFMA 2KS1A 1Q82Q 1RQUA 3RK3C 2N1TD 2YKPA 1BSNA 3FXEA 4DZOA 3ABVC 3AE3C 2A06G 4PD4I 3A0BE 3MUDA 5CCGD 2ZJSE 2WSEJ 2V7QJ 3EQ2A 2R32A 1L2PA 2W6JH 4D6TJ 3KDPB 1GU5A 2NZ2A 2E42A 1YYCA 1NTME 3CC7P 1PPJE 3RL0B 1RF1C 4OH8B 1YI2P 4C7NA 4GIFA 2QRXA 2A06D 2JP3A 1KTMA 5AW6B 1IC2A 3V4QA 1CI6A 1LTBC 1URQA 5B5EE 1DH3A 2O1KA 4D6TD 3E1IC 2J3GA 3V2RA 3MUDC 3HE5A 2J3OA 2L91A 1NTKE 2GA1A 3I56P 2H43C 1FOSF 1BGYG 3CCMP 3P8MC 1PP9J 2B87A 1MZ9A 2B88A 1NTKD 1HUCA 4NPEA 5KLVD 2IBZE 1HBWA 2A45G 1P84H 1T8ZA 3KHUA 4XE5B 1G2CA 1S9KE 2O01H 2RKLA 4M3LA 1LP1A 1HVVA 1E5WA 4DT0A 1ZN5A 2QJKB 3AEAC 4HKZH 2YXQB 1X79B 2Z4EC 5E79H 3TK1A 1U57A 1L4AD 3CXHE 1HH0A 3M0DA 3C1LA 1VF5D 2AXTH 2JJLA 2NPSA 3L74D 1M57D 2Y0CA 1OZHA 4H0LD 1SQXK 5TISH 4YXWH 4RESB 1Q90D 5L8RJ 3G4SP 3HD7A 3H1IG 3IN6A 2AXCA 4U3FD 1X9VA 3AE8C 1FIDA 2P58A 1LTAC 1IFJA 5APVA 1FZGB 4YTPC 5CCGA 2J1GA 3M91A 2J2PA 1SVFA 1SQVE 3FWNA 4BRYB 2WTYA 3H1HJ 2FYUJ 1S72P 3B5NB 5CHXA 1U7JA 5KKZB 2Q1KA 4L74A 2PP6A 3KZIH 2I8DA 4CPGA 1HF9A 1GL2C 1UIXA 1N7SA 4IL6H 1PGPA 1CSBA 3O8ZA 3HE4B 4Y28J 1SFCA 4Y99B 1NTKJ 4B86A 1DD3A 3TYYA 2E74B 3AE4C 1N86A 1QL2A 1OX3A 1NTZD 3P32A 5AW9B 3R4YA 3P8CD 1MFTA 2Q9IA 4C7RA 1OFCX 2E5YA 2IZ0A 2W27A 3H32C 1LT9B 2IPPA 1X8YA 2Q9IC 3TNUA 3BCCJ 2E74C 3F5HA 5TJHA 1KILA 2GUSA 4L76A 3CC2P 3KZIE 2J3FA 3HUSB 1HGVA 1LTJA 3D70A 4W80A 3BASA 5AVQB 1KILC 2Q3EA 2Q6QA 1L0NK 2Z4EB 2H88C 3FX0A 3V6IA 3G6EP 1GL2A 3SSUA 1ZR2A 1LWUB 3CCEP 2J60A 1SQPJ 3BVHB 2N9BA 1FZAA 3PRJA 1ZXGA 3IF4A 3RL0C 3KXDA 4H0LC 2R3SA 1VQLP 1VF5B 1FS0E 3AE5C 2J58A 1SQQK 2D2CB 3CCUP 3AE1C 4KJMA 4Y99C 1N7SB 2FYUD 3EWKA 2WSCJ 2E76C 3A0HE 2JHMF 2DW3A 3KPEA
chains in the Genus database with same CATH topology
1N73B 1RF0B 1M7LA 3GHGA 3HD7C 4HYTB 5AW5B 5KLVK 3LW5H 4C46A 2JEEA 4WB4A 5CJ0A 1JUNA 1YTZI 3A7OA 1JCDA 3B8EB 1FIBA 2CPSA 3V4WA 3N4XA 1M1JA 1URQD 1JY3N 3HE4A 2WZ7A 2ZFCA 4I6MC 4WBAA 1RF0C 5AVVB 3HD7D 3HUSC 4C7NB 1Z56A 4N3YB 1GU4A 2J0HA 1NH4A 1FZCB 2KYVA 2ZXEB 1LTTC 3B5ND 1Z3UA 1FZGC 4R9JA 1GL2D 1SQPK 4I2LC 5AVZB 1SFCB 4GT1A 2W6AA 2HODA 2XNXA 4NYTA 3H32B 1HGZA 2R5DA 2LKMA 3VMZA 2PAJA 1T2KC 2FFDA 2NPSB 4IFMA 1Z3SA 2D39A 3RL0D 5CCHD 3CLQA 1RE4A 4I1LA 2P7JA 3BVHC 4JYCA 1T2KD 3T97A 2NPSC 5AW3B 1KILB 2HPCC 2IFMA 1JMMA 3IR9A 5APWA 5AW1B 1AFOA 2YMYA 1WRGA 3M0DC 2HG5D 1CZQA 3HTKB 3CL3D 2Z5IA 2Q7CA 3V2QA 3SWFA 1JNMA 2OYHA 1XTGB 1M1JB 3B5NC 5APYA 1FZEB 1FBMA 3HTKA 2Z4EA 3II6A 2H8PD 2H43A 5AW4B 4LC1A 3V5BA 1L4AA 3NXSA 5BVZA 1VPCA 1HJBA 3SWYA 4JYOX 2QM7A 1A02F 2J64A 3U1CA 3GHGB 1LT9C 1FDMA 1J1DC 3E1IA 3BATA 3M9HA 1URQC 2GY7A 4EOTA 2N1TC 3L37A 1RE3A 1FJKA 2I1JA 1JY2P 2OYIA 3A2AA 3VOPA 1NO4A 4XA4A 5AW8B 3OA7A 1JCCA 4AUWA 1J1EC 2KOGA 5AVSB 4M7HA 1IFMA 1GW3A 4LLHA 5CJ4A 2P2UA 4N78D 3RK3C 1N73C 1QL1A 1S9KD 2M8RA 2N1TD 1NTMK 2YKPA 1NOHA 3RK2C 1FJPA 4DZOA 2J3FD 3VTPC 3RK2B 3NFQA 1SFCD 3MUDA 1FZCA 3L35A 5CCGD 1OXZA 4AYCA 1YTZT 3EQ2A 2R32A 2XDJA 3TSIA 3KDPB 4JYBA 1GU5A 1FZBB 3U1AA 5KJ7A 2GM4A 3CI9A 2E42A 2HLOA 1YYCA 2HYNA 1AQ5A 2XNXB 4HH2A 1N73A 1H88A 1GW4A 3RL0B 2C9LY 1RF1C 4OH8B 3HRNA 3BRTB 2KSJA 3VMYA 4C7NA 4GIFA 1RF1A 5AVXB 5AW6B 2WNPF 2R3CA 5CMZA 1IC2A 2HLOC 3R2PA 3V4QA 5KJ7C 1RE3C 2N1TA 1CI6A 1LTBC 1N7SD 3V2NA 1J1DB 1FU1A 1URQA 2Q9IB 1DH3A 2WWWA 2O1KA 2VRSA 1J2JB 1MFZA 3E1IC 2J3GA 3V2RA 1FZCC 4DOJA 3LIEA 1LT9A 3HE5A 4IFDK 2J3OA 2JHKF 1G1JA 4JZCA 2IFNA 4ZKUA 1KQLA 1JY2O 2H43C 1NTZK 2WSEH 1PFIA 3M06A 1FOSF 4R9TA 2OYHC 2GUVA 5APXA 2A45H 3P8MC 2OYIB 1MZ9A 1HUCA 3P8CE 3V2PA 2J0GA 1IO4A 1SLQA 1WT6A 1J1EB 2QM8A 2HPCA 2OYIC 2A45G 1HBWA 2WSCH 2J0YA 3BVHA 3L4FA 1T8ZA 2FIBA 4GKGA 1RE4C 1GK4A 1H89A 4XE5B 1FZDA 1G2CA 1S9KE 2O01H 1GL2B 2Q5UA 2KLVA 3G3ZA 1NHLA 2L5GB 4M3LA 2JHHC 2HODB 4EIJA 1HVVA 2XNXC 2CPBA 1IJDB 3RK2D 1L4AC 3MGNA 1E5WA 1LTIC 2KB7P 1HTLC 1ZN5A 1X79B 4W7ZA 2Z4EC 3B5NA 3RK3D 3TK1A 2Z5HA 3OJAB 1L4AD 2XV5A 3C9IA 1LTJB 1HH0A 3M0DA 1RY3A 2JJLA 3HUSA 1FOSE 4WY4D 2NPSA 1RF0A 3IFMA 1KFNA 1EQ7A 1SQXK 1H8AA 2FFDC 3KQGA 2MJZA 2FKWB 2XZRA 1LTSC 2YKOA 4RESB 3OAKA 1MUUA 2HODC 3HD7A 4O9BA 2JHIF 1NKNA 1X9VA 1IFNA 5AVUB 2FYZA 2J5ZA 1FZGA 3E1IB 2FXMA 1GZLA 1FIDA 3A3YB 1LTAC 1FZFA 1IFJA 5APVA 2WPRA 1FZGB 1N2DC 2O1JA 2FYUK 1IK9A 1FICA 2HLOB 3HD7B 2HFED 5AW2B 5CCGA 3VN0A 2J1GA 2YNYA 4KHXA 3M91A 1LWUA 1M1JC 2J2PA 2C0XA 3A5TA 1SVFA 1RF1B 2WTYA 2W6BA 1CI6B 1VDFA 2M3BA 2R5BA 4N6JA 5KJ7D 3NTNA 3B5NB 1FZEC 5CHXA 1G1IA 1JY3P 5CCHA 2YO3A 1JTHB 1DX7A 1JOCA 1NWQA 3KYQA 2KP8A 5AVRB 3GHGC 3HE5B 2PP6A 5AW7B 5BU8B 2FFDB 2WPSA 1IFIA 4ZKPA 1GD2E 1GL2C 3NMDA 4LGDE 5APSA 2J61A 1N7SA 2WSFH 1FZBA 1CSBA 3M9BA 3HE4B 3O8ZA 1NKZB 3WMM0 2OARA 1SFCA 3L36A 4Y99B 1SP4A 1LTGC 3RK3B 3VYIA 1LTJC 2J61B 5APUA 1JO5A 4WY4A 4B86A 2J59M 5APTA 3PP5A 2Q3IA 4M7FA 1NU1K 4W7YA 1ZLLA 3TYYA 3FIBA 3VP9A 1DEBA 3MIWA 1N86A 1GTWA 1LGHB 1QL2A 1CW5A 2YO2A 2BASA 1HWTC 3P32A 1A02J 3LIDA 1NTKK 5AW9B 1JC9A 1FZAC 3UIAA 3P8CD 2Q9IA 1GDTA 2C9NY 4C7RA 2W27A 1SQBK 1KFMA 1N7LA 3H32A 3H32C 4IFFA 5AW0B 4EPUA 1LT9B 1W2EA 2IPPA 2H7HA 1X8YA 2Q9IC 3TNUA 3P7KA 5APQA 1URQB 1RE3B 3EFGA 1KILA 2WITA 3U59A 2GUSA 2XU6A 1GK6A 1OWAA 2H43B 2J3FA 3HUSB 2OYHB 1HGVA 3VP8A 1LTJA 1MV8A 1T3UA 3H6PA 4W80A 3BASA 1FZAB 5AVQB 1KILC 2HPCB 1JY3O 1ZR4A 2N1TB 1N7SC 1L0NK 2Z4EB 3VMXA 1JY2N 3I5CA 1L0LK 1GL2A 4AQRD 1ZR2A 2J3UA 2POHA 1LWUB 2IX7C 2E43A 2J60A 2YKQA 3BVHB 3MTUE 2NPSD 2N9BA 1FZAA 3BRVB 1G2CB 1NAFA 3M0AA 1T3JA 3RL0C 5CCHC 1FZEA 1N86C 1RE4B 1FZFB 3TNUB 1KILD 1ZV8A 4JF7A 1JTHA 1L4AB 1SQVK 3M9QA 3N7NA 1LWUC 1IFDA 2P1JA 5BU5A 2WT7B 4WY4C 2WPQA 5AVYB 5CCGC 2I1KA 5AVTB 2JHLF 1SFCC 2P67A 4WY4B 5KTBA 1FAVA 5AVWB 2XKMA 1KZUB 2WT7A 2J58A 1FZBC 1SQQK 4ZFGA 4Y99C 2A45I 1FZFC 1N7SB 1N86B 4N78E 3MD0A 2C0WA 2JHMF 1XTCC 3KPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 B;  2J61 B;  1RF0 B;  2JHH C;  1LTJ C;  3GHG A;  2HOD B;  2XNX C;  4M7H A;  4M7F A;  1N73 C;  3FIB A;  1N86 A;  2Z4E C;  1FIB A;  1M1J A;  1FZA C;  1JC9 A;  1JY3 N;  2Q9I A;  1LTJ B;  1RF0 C;  2J3F D;  1FZC A;  3HUS C;  3HUS A;  3H32 A;  3H32 C;  4EPU A;  1LT9 B;  1W2E A;  1RF0 A;  2J0H A;  2Q9I C;  1FZC B;  1FZB B;  1RE3 B;  2HLO A;  2FFD C;  1Z3U A;  1FZG C;  2XNX B;  4R9J A;  1N73 A;  2H43 B;  1RF1 C;  2HOD A;  2XNX A;  2J3F A;  4NYT A;  3H32 B;  3HUS B;  2HOD C;  1RF1 A;  2OYH B;  2JHI F;  1LTJ A;  2WNP F;  1T3U A;  2J5Z A;  1FZA B;  1FZG A;  2HPC B;  2FFD A;  2HLO C;  1Z3S A;  3E1I B;  1FID A;  1JY3 O;  1RE3 C;  2D39 A;  2Z4E B;  1FZF A;  1JY2 N;  1RE4 A;  1FZG B;  2Q9I B;  3BVH C;  2J3U A;  1FIC A;  2HLO B;  3E1I C;  2J3G A;  1LWU B;  2HPC C;  1FZC C;  1LT9 A;  2J60 A;  2J3O A;  3BVH B;  2JHK F;  2J1G A;  4JZC A;  1LWU A;  1FZA A;  1M1J C;  2J2P A;  1JY2 O;  2OYH A;  1RF1 B;  2H43 C;  1M1J B;  1FZE B;  1FZE A;  1N86 C;  2Z4E A;  1RE4 B;  1FZF B;  1FZE C;  4R9T A;  1JY3 P;  2H43 A;  2OYH C;  2A45 H;  2OYI B;  1LWU C;  4JYO X;  3GHG C;  2J64 A;  2JHL F;  2J0G A;  3GHG B;  1LT9 C;  3E1I A;  2HPC A;  2FFD B;  2A45 G;  2OYI C;  2J0Y A;  1FZB C;  4ZFG A;  3BVH A;  2FIB A;  2GY7 A;  2A45 I;  1RE4 C;  1FZF C;  2J61 A;  1N86 B;  1FZD A;  1RE3 A;  1FZB A;  1JY2 P;  2OYI A;  2JHM F; 
#chains in the Genus database with same CATH topology
 1M7L A;  2IBZ I;  1L0L E;  3HD7 C;  2OYO A;  1S5L E;  2JEE A;  5CJ0 A;  1YTZ I;  3B8E B;  1FIB A;  2ZXX A;  3OW2 O;  3V4W A;  4GOF A;  5E79 E;  5DJU B;  2WZ7 A;  1RF0 C;  3L70 J;  4PD4 D;  3CCL P;  4OVN F;  2J0H A;  1FZC B;  2ZXE B;  2YIU C;  1LTT C;  3PLN A;  1SQB E;  2ZVO B;  3H1L J;  4GT1 A;  2W6A A;  2IZ1 A;  3G71 P;  3H32 B;  2WPV B;  1ZME C;  2AEM A;  3L71 D;  2FFD A;  1EZV D;  5CCH D;  2QA4 P;  4D6T E;  1NGM B;  3BVH C;  2IFM A;  5AW1 B;  2KS1 B;  1BGY E;  3M0D C;  1CZQ A;  2Z5I A;  3V2Q A;  1JNM A;  2OYH A;  5APY A;  1FZE B;  3HTK A;  2H8P D;  2W83 C;  2KZI A;  4LC1 A;  5BVZ A;  2QJY B;  4IOI H;  2QM7 A;  4PJ0 H;  1D7M A;  3U1C A;  1LT9 C;  3QWO C;  1FDM A;  1KN7 A;  2OQQ A;  3BAT A;  2E76 B;  1QVF O;  2KUB A;  2KZJ A;  4EOT A;  2N1T C;  2SPZ A;  2J5U A;  1JY2 P;  1KQS O;  1HJ0 A;  2LXB A;  1JEK A;  1JCC A;  5AVS B;  4M7H A;  1PL5 A;  5CJ4 A;  3EFF K;  4N78 D;  1YQ3 C;  2M8R A;  3AEG C;  2R44 A;  3RK2 B;  1NAY A;  1S5L H;  3L35 A;  4AYC A;  3CX5 E;  3E1R A;  3CD6 P;  2KIK A;  5KJ7 A;  1IK7 A;  3CI9 A;  4BXL A;  2XNX B;  1L0L G;  2C9L Y;  1Q81 Q;  2E75 C;  3L74 G;  1RF1 A;  1KYO H;  3AE9 C;  3CCQ P;  3TGU G;  1J1D B;  1W2B O;  2Q9I B;  1AQT A;  4GOD A;  4OWF A;  1J2J B;  2WMM A;  1QEX A;  1WMK A;  2JHK F;  3RBZ A;  1K9M Q;  1G1J A;  1R8E A;  2IFN A;  1KQL A;  1JY2 O;  1PGJ A;  3CXH D;  2WSE H;  1PFI A;  3M06 A;  1BCC E;  4R4M A;  2GUV A;  2A45 H;  3V2P A;  1IO4 A;  3PH0 A;  1J1E B;  2B87 B;  2ZT9 C;  2WSC H;  3L4F A;  2FIB A;  2HR3 A;  3E7K A;  4H13 D;  1GL2 B;  3CMA P;  1NTM J;  2JHH C;  1PP9 G;  1SQQ J;  1SQX G;  2CPB A;  3PJS K;  3RK2 D;  1LTI C;  2KB7 P;  4WVZ A;  1RHZ B;  3WU2 E;  1VQ8 P;  1OVU A;  5KLV J;  1PP9 E;  3QH9 A;  3L75 J;  2Y9Y A;  2W90 A;  1BSH A;  3OJA B;  2XV5 A;  3H1I D;  3H1L E;  1FOS E;  1VQ9 P;  2M3E A;  1RF0 A;  3IFM A;  3CX5 D;  1KFN A;  1M56 D;  1H8A A;  3H1L G;  1NVO A;  2MJZ A;  2FKW B;  1LTS C;  2YKO A;  2IYO A;  3H1J D;  2HOD C;  4O9B A;  1IFN A;  2J5Z A;  1GZL A;  3A3Y B;  1UII A;  1DEE G;  3A0B H;  1YJ9 P;  3CWB G;  1MKM A;  1SQQ E;  1FIC A;  2HLO B;  3HD7 B;  2YNY A;  1LWU A;  2QSI A;  3CCJ P;  2C0X A;  2WVR A;  1BDC A;  3H1J J;  1VDF A;  5GTH H;  1JY3 P;  1Q86 Q;  4R4L A;  1DX7 A;  1NWQ A;  3L74 E;  3L73 G;  3GHG C;  5KLV G;  1NTZ J;  1NU1 J;  2KK7 A;  5AW7 B;  4Z1M H;  3NMD A;  2J61 A;  1FZB A;  1PGO A;  1NKZ B;  3M9B A;  3D6Z A;  2J61 B;  3RK3 B;  1LTG C;  1PIX A;  1JO5 A;  4WY4 A;  2E75 B;  3AE6 C;  1EXI A;  1USE A;  1ZRT E;  1EDK A;  1JMB A;  1X22 A;  4W7Y A;  1ZLL A;  3CXH H;  5GTI E;  1NTZ E;  3MIW A;  1GTW A;  2ZYD A;  1LGH B;  1CW5 A;  1E79 H;  3LID A;  3H1L D;  2QG4 A;  1OVV A;  1K05 A;  1KQG B;  1SQB G;  1SQB K;  1KFM A;  1N7L A;  1EZV I;  4IFF A;  1N8R Q;  1W2E A;  2YXR B;  3P7K A;  5APQ A;  1URQ B;  4U3F E;  1LJ2 A;  2BEQ D;  2WIT A;  3U59 A;  1BCC G;  2XU6 A;  1OWA A;  4XFJ A;  3CME P;  1PZQ A;  1SQX E;  2IYP A;  2OYH B;  2XND H;  1U7M A;  4EI2 A;  2HPC B;  1JY3 O;  2N1T B;  1L0L K;  1AVO A;  1OIP A;  2QJP C;  4AQR D;  2K9Y A;  3H1K J;  1T6A A;  1RQV A;  1YIJ P;  2E43 A;  3MTU E;  1SS1 A;  4L75 A;  2G8Y A;  5CCH C;  3WUU A;  1FZE A;  1S3J A;  1ZV8 A;  4JF7 A;  1JTH A;  1SQV K;  3M9Q A;  1KYO D;  1S2E A;  1LWU C;  4NPF X;  4PV1 C;  4WY4 C;  2RN0 A;  5CCG C;  3H25 A;  2K88 A;  5AVW B;  4ASW A;  1IFP A;  1FZB C;  1SQB J;  1FZF C;  5GTI H;  1GMJ A;  1ZW0 A;  3MD0 A;  2C0W A;  2KXP B;  2JDI H;  5AW5 B;  3LW5 H;  4C46 A;  1NU1 D;  3AEE C;  1Q7Y Q;  2BCC J;  2ZYG A;  1JUN A;  3O6Q A;  3GW6 A;  4JQ0 D;  4K35 A;  3HD7 D;  1EDJ A;  4N3Y B;  1SQV D;  4I2L C;  2OTK E;  4OGQ B;  2LXC B;  1P84 I;  2K3R A;  2XNX A;  2JWD A;  1HGZ A;  5EFW B;  2PAJ A;  1T2K C;  1Y9B A;  2NPS B;  3W67 A;  4RJT A;  1KQF B;  3RL0 D;  3CLQ A;  3Q5P A;  1SQV G;  3I55 P;  2KNC A;  1JM0 A;  5APW A;  1FDO A;  2BCC E;  2YMY A;  3FWL A;  3G9R A;  4HJG H;  1FBM A;  2Z4E A;  1NTM G;  1NTZ G;  2BCC G;  2H43 A;  3L73 J;  1L4A A;  1W5C E;  5H2F H;  1VPC A;  1HJB A;  3GHG B;  1J1D C;  2KI7 B;  3E1I A;  1URQ C;  1OVR A;  1R5S A;  3JCU H;  1FJK A;  2I1J A;  1NO4 A;  4PD4 H;  1YBK A;  3L71 E;  1L0N J;  4AUW A;  2NRG A;  4LLH A;  4IL6 E;  1S9K D;  1NTM K;  1VQ7 P;  1ZP0 C;  3RK2 C;  1FJP A;  2J3F D;  3VTP C;  3CCS P;  1OXZ A;  3TDK A;  2QJP B;  3S1K A;  1L0N E;  3TSI A;  4H13 C;  3CCR P;  2GM4 A;  2HLO A;  4HH2 A;  1GW4 A;  2CK3 H;  3HRN A;  3BRT B;  2KSJ A;  3VMY A;  3Q5S A;  5K5G B;  2WNP F;  2R3C A;  2QE7 H;  5CMZ A;  1VQN P;  3VMA A;  2HLO C;  1RE3 C;  2N1T A;  1VQO P;  1USD A;  1FU1 A;  2WWW A;  2VRS A;  1MFZ A;  2QJY C;  4DOJ A;  3LIE A;  2QIW A;  4IFD K;  2ZVN B;  1EDI A;  3Q2Y A;  4TT3 H;  2B89 A;  5KLV E;  1NTM D;  1KIL E;  1BE3 D;  4R9T A;  4YXD C;  1BE3 E;  3CX5 H;  2OYI B;  2AXT E;  3AE2 C;  1EXJ A;  2QEX P;  2J0G A;  1WT6 A;  2ITA A;  4GKG A;  1GK4 A;  2Y0D A;  1FZD A;  2Q5U A;  3L73 D;  5DJT B;  1NHL A;  2L5G B;  4OGQ D;  1YQ4 C;  1VQ4 P;  1VF5 C;  4EIJ A;  1KYO I;  5M1B A;  3AED C;  1L4A C;  4IL6 X;  1ZRT D;  2JKV A;  2A06 E;  4W7Z A;  1LTJ B;  1RY3 A;  3HUS A;  2FFD C;  4UB8 E;  2XZR A;  5CBN A;  3OAK A;  1MUU A;  4D6T G;  2JHI F;  5B5E H;  5AVU B;  2FYZ A;  1SQP G;  3AE7 C;  3H1I J;  1FZF A;  2WPR A;  1N2D C;  3T97 B;  2O1J A;  2FYU K;  1H0T A;  3JSV C;  2HFE D;  5AW2 B;  3RL0 g;  1EZV E;  3VN0 A;  4KHX A;  1M1J C;  3A5T A;  1CI6 B;  2R5B A;  1VQM P;  4N6J A;  3NTN A;  1FZE C;  1G1I A;  1JTH B;  4EYY Q;  2WSF J;  3CWB D;  3S4R A;  3KYQ A;  3HE5 B;  3JC2 2;  1YJW P;  1M90 Q;  4TLF A;  5BU8 B;  2FFD B;  4UB6 H;  2WPS A;  1SQX D;  1L0N G;  5APS A;  2WSF H;  3L70 E;  2K9J B;  3WMM 0;  1PP9 D;  3L36 A;  1LTJ C;  5APU A;  2YMK A;  1H0T B;  2J59 M;  4ASV A;  5APT A;  3A0H H;  2Q3I A;  1NU1 K;  3H1H G;  3FIB A;  1DEB A;  3MZW B;  2YO2 A;  2BAS A;  1HWT C;  1A02 J;  1NTK K;  1JC9 A;  5B66 E;  3L72 D;  1FC2 C;  3H32 A;  1SQQ D;  3Q1M A;  4EPU A;  2E76 D;  1PV3 A;  1PPJ D;  3EFG A;  3L75 D;  1GK6 A;  2H43 B;  4KT0 J;  4UB6 E;  4HB1 A;  2OGU A;  3VP8 A;  1MV8 A;  1T3U A;  3H6P A;  1FZA B;  3L72 J;  1X0T A;  1ZR4 A;  1N7S C;  3VMX A;  1JY2 N;  2QJK C;  1VQ6 P;  2IDB A;  3RK3 E;  4BWN A;  1P84 E;  2JO1 A;  3PHL A;  4U3F J;  2P10 A;  3BRV B;  4PJ0 E;  1G2C B;  1KOR A;  1T3J A;  2FXO A;  1EC5 A;  1KIL D;  1FE6 A;  1L4A B;  1QGK B;  3MHV A;  1IFD A;  2WT7 B;  1FDI A;  5AVY B;  1SFC C;  1FAV A;  2XKM A;  1KZU B;  2JR8 A;  2WT7 A;  3GF7 A;  3H1J E;  4ZFG A;  3H1H D;  4UB8 H;  4N78 E;  2E74 D;  2BEZ F;  1IZN B;  1XTC C;  3C8V A;  3H1J G;  1RF0 B;  3CX5 I;  4HYT B;  3TF5 A;  2AEJ A;  1KB9 I;  2RMZ A;  1JCD A;  2OTJ P;  1K8A Q;  1R5L A;  2CPS A;  3N4X A;  2FYN B;  1P84 D;  3RBX A;  3HE4 A;  3AEC C;  1L0L J;  2ZFC A;  1SQB D;  5AVV B;  3CXH I;  3IAO A;  3HUS C;  3W68 A;  4C7N B;  1AJY A;  1Z56 A;  1EZV G;  1NH4 A;  3CC4 P;  1VQK P;  2O01 N;  3B5N D;  1Z3U A;  1FZG C;  1GL2 D;  1SQP K;  1SFC B;  2PRR A;  4H44 B;  1BGY J;  2R5D A;  1NJI Q;  2LKM A;  3H1H E;  1YIT P;  1K04 A;  1S4X A;  1RE4 A;  4I1L A;  1K73 Q;  2RH0 A;  4JYC A;  1VL2 A;  3L70 G;  3T97 A;  2NPS C;  5B66 H;  1KIL B;  1AVY A;  3PTZ A;  2Q7C A;  2H89 C;  3SWF A;  5TIS E;  3B5N C;  3II6 A;  2D2C D;  5AW4 B;  3V5B A;  3NXS A;  2KNC B;  2V7Q H;  2AEF A;  4JYO X;  1TU3 F;  2WQY C;  3FGA D;  1KB9 E;  3AEF C;  3M9H A;  1VQ5 P;  2GY7 A;  1M1K Q;  1RE3 A;  1AA0 A;  4ZMD A;  3VOP A;  4XA4 A;  3OA7 A;  1EDL A;  1GW3 A;  3L74 J;  2P2U A;  4H13 B;  1KV4 A;  1N73 C;  1QL1 A;  2PFX A;  1NOH A;  1JB0 J;  3WUT A;  3NFQ A;  1SFC D;  1FZC A;  4H44 D;  2M0B A;  1DIP A;  1YTZ T;  2XDJ A;  4JBZ A;  3TGU D;  3SFD C;  4JYB A;  5KKZ C;  1FZB B;  3U1A A;  1L0N D;  3WUV A;  1AQ5 A;  2HYN A;  1N73 A;  1SQP E;  1H88 A;  3D71 A;  1NU1 E;  3MP7 B;  2OTL P;  3L70 D;  5AVX B;  2WSS H;  3R2P A;  5KJ7 C;  1N7S D;  3V2N A;  1BDD A;  1FZC C;  1LT9 A;  4JZC A;  4YPC A;  1LT1 A;  4ZKU A;  1SQX J;  3K5B A;  1NTZ K;  1NYH A;  2FYN C;  2OYH C;  5APX A;  2FY8 A;  4EDF A;  3Q3D A;  4DCK A;  2KLU A;  3P8C E;  3H1K E;  1SLQ A;  4A7P A;  2QM8 A;  2HPC A;  2OYI C;  2J0Y A;  1RH5 B;  3BVH A;  2FYU E;  4QMA A;  3ITK A;  1RE4 C;  1H89 A;  4GDO A;  3L73 E;  4JPZ B;  1KD1 Q;  2KLV A;  3G3Z A;  3LW5 J;  1AV1 A;  2IBZ D;  2HOD B;  5GTH E;  2XNX C;  1IJD B;  3H1I E;  3MGN A;  1HTL C;  1S5L X;  3B5N A;  3RK3 D;  2MKV A;  2Z5H A;  3C9I A;  1OW8 A;  3L72 G;  4PV1 D;  4WY4 D;  2ZYA A;  1EQ7 A;  4I7Z C;  3KQG A;  3H1K D;  1DD4 A;  2O01 J;  2FXP A;  3Q5R A;  1NKN A;  1FZG A;  1PPJ G;  3E1I B;  2FXM A;  1OMI A;  1YHQ P;  2ZAE B;  1IK9 A;  3BCC E;  2N9Y B;  3WU2 H;  2K1A A;  4U3F G;  2KSE A;  4DJG A;  1RF1 B;  2W6B A;  4ZNC A;  1S1C X;  2M3B A;  5KJ7 D;  5CCH A;  2YO3 A;  4PD4 E;  3USS A;  1NTK G;  1JOC A;  2Y0E A;  2KP8 A;  5AVR B;  2QVA A;  2B9B A;  1IFI A;  4ZKP A;  1GD2 E;  3L71 G;  4LGD E;  3ZDM A;  1BE3 J;  2IBZ G;  5H2F E;  1L0L D;  4H44 C;  1BCC J;  2OAR A;  3B71 A;  1SP4 A;  3VYI A;  1LP1 B;  4MN4 C;  1QLE D;  3FXD A;  3PP5 A;  4M7F A;  4OGQ C;  2V4H A;  3VP9 A;  1SQV J;  1FZA C;  3UIA A;  1GDT A;  2C9N Y;  1Y8A A;  5KLI B;  3H1K G;  5AW0 B;  2H7H A;  3L71 J;  4I7Z B;  1RE3 B;  1SQP D;  2G3A A;  2ZT9 B;  3GMA A;  3B4S A;  3SFE C;  3AEB C;  3CPW O;  3CWB E;  1SQQ G;  2D2C C;  2K37 A;  3I5C A;  2Y9Z A;  3L75 G;  2K9J A;  5KAF E;  2J3U A;  2POH A;  2M5A A;  2IX7 C;  3D6Y A;  2YKQ A;  3TGU E;  1KMI Z;  2LR2 A;  2NPS D;  1NAF A;  3L75 E;  1PGQ A;  3M0A A;  1N86 C;  1RE4 B;  1FZF B;  3TNU B;  5CBO A;  2BCC D;  1OW7 A;  3N7N A;  2P1J A;  5BU5 A;  2WPQ A;  2I1K A;  1KB9 D;  2JHL F;  4K3A A;  5AVT B;  2P67 A;  4PV1 B;  4WY4 B;  5KTB A;  3L72 E;  2W8Z A;  2PGD A;  2A45 I;  1N86 B;  3CCV P;  4RKU J;  1N73 B;  3CWB J;  4RO0 A;  3GHG A;  5KLV K;  2M5A B;  4WB4 A;  5KAI H;  3A7O A;  2YIU B;  1BGY D;  1M1J A;  1URQ D;  3S9O A;  1JY3 N;  4WBA A;  2ZT9 D;  4I6M C;  1BCC D;  1KC8 Q;  1QVG O;  2JWA A;  1YJN P;  1GU4 A;  1NU1 G;  3BCC G;  4NPD A;  2KYV A;  4BRY A;  3JCU E;  4R9J A;  5AVZ B;  3GG2 A;  2HOD A;  4NYT A;  1M8O B;  5KAI E;  3VMZ A;  4L73 A;  3GLM A;  3BCC D;  4IFM A;  1Z3S A;  2D39 A;  1LNQ A;  2P7J A;  4U7J A;  1T2K D;  3RGU A;  4GOE A;  5AW3 B;  2HPC C;  3IR9 A;  1JMM A;  1AFO A;  1OW6 A;  2E75 D;  1WRG A;  2HG5 D;  3HTK B;  1KB9 H;  3CL3 D;  1Q2N A;  4H0L B;  1XTG B;  1M1J B;  4WWI A;  2E5T A;  2FYU G;  2O3J A;  3SWY A;  1KYO E;  1A02 F;  3SWK A;  2J64 A;  1Y47 A;  1QX8 A;  5C39 A;  1BE3 G;  3F89 A;  2FBW C;  3O6Q B;  3L37 A;  5KAF H;  2UWJ E;  2OYI A;  1VQP P;  3A2A A;  3TGU J;  5AW8 B;  5KLI C;  1ZOY C;  3GF3 A;  1J1E C;  2KOG A;  1IFM A;  2KS1 A;  1Q82 Q;  1RQU A;  3RK3 C;  2N1T D;  2YKP A;  1BSN A;  3FXE A;  4DZO A;  3ABV C;  3AE3 C;  2A06 G;  4PD4 I;  3A0B E;  3MUD A;  5CCG D;  2ZJS E;  2WSE J;  2V7Q J;  3EQ2 A;  2R32 A;  1L2P A;  2W6J H;  4D6T J;  3KDP B;  1GU5 A;  2NZ2 A;  2E42 A;  1YYC A;  1NTM E;  3CC7 P;  1PPJ E;  3RL0 B;  1RF1 C;  4OH8 B;  1YI2 P;  4C7N A;  4GIF A;  2QRX A;  2A06 D;  2JP3 A;  1KTM A;  5AW6 B;  1IC2 A;  3V4Q A;  1CI6 A;  1LTB C;  1URQ A;  5B5E E;  1DH3 A;  2O1K A;  4D6T D;  3E1I C;  2J3G A;  3V2R A;  3MUD C;  3HE5 A;  2J3O A;  2L91 A;  1NTK E;  2GA1 A;  3I56 P;  2H43 C;  1FOS F;  1BGY G;  3CCM P;  3P8M C;  1PP9 J;  2B87 A;  1MZ9 A;  2B88 A;  1NTK D;  1HUC A;  4NPE A;  5KLV D;  2IBZ E;  1HBW A;  2A45 G;  1P84 H;  1T8Z A;  3KHU A;  4XE5 B;  1G2C A;  1S9K E;  2O01 H;  2RKL A;  4M3L A;  1LP1 A;  1HVV A;  1E5W A;  4DT0 A;  1ZN5 A;  2QJK B;  3AEA C;  4HKZ H;  2YXQ B;  1X79 B;  2Z4E C;  5E79 H;  3TK1 A;  1U57 A;  1L4A D;  3CXH E;  1HH0 A;  3M0D A;  3C1L A;  1VF5 D;  2AXT H;  2JJL A;  2NPS A;  3L74 D;  1M57 D;  2Y0C A;  1OZH A;  4H0L D;  1SQX K;  5TIS H;  4YXW H;  4RES B;  1Q90 D;  5L8R J;  3G4S P;  3HD7 A;  3H1I G;  3IN6 A;  2AXC A;  4U3F D;  1X9V A;  3AE8 C;  1FID A;  2P58 A;  1LTA C;  1IFJ A;  5APV A;  1FZG B;  4YTP C;  5CCG A;  2J1G A;  3M91 A;  2J2P A;  1SVF A;  1SQV E;  3FWN A;  4BRY B;  2WTY A;  3H1H J;  2FYU J;  1S72 P;  3B5N B;  5CHX A;  1U7J A;  5KKZ B;  2Q1K A;  4L74 A;  2PP6 A;  3KZI H;  2I8D A;  4CPG A;  1HF9 A;  1GL2 C;  1UIX A;  1N7S A;  4IL6 H;  1PGP A;  1CSB A;  3O8Z A;  3HE4 B;  4Y28 J;  1SFC A;  4Y99 B;  1NTK J;  4B86 A;  1DD3 A;  3TYY A;  2E74 B;  3AE4 C;  1N86 A;  1QL2 A;  1OX3 A;  1NTZ D;  3P32 A;  5AW9 B;  3R4Y A;  3P8C D;  1MFT A;  2Q9I A;  4C7R A;  1OFC X;  2E5Y A;  2IZ0 A;  2W27 A;  3H32 C;  1LT9 B;  2IPP A;  1X8Y A;  2Q9I C;  3TNU A;  3BCC J;  2E74 C;  3F5H A;  5TJH A;  1KIL A;  2GUS A;  4L76 A;  3CC2 P;  3KZI E;  2J3F A;  3HUS B;  1HGV A;  1LTJ A;  3D70 A;  4W80 A;  3BAS A;  5AVQ B;  1KIL C;  2Q3E A;  2Q6Q A;  1L0N K;  2Z4E B;  2H88 C;  3FX0 A;  3V6I A;  3G6E P;  1GL2 A;  3SSU A;  1ZR2 A;  1LWU B;  3CCE P;  2J60 A;  1SQP J;  3BVH B;  2N9B A;  1FZA A;  3PRJ A;  1ZXG A;  3IF4 A;  3RL0 C;  3KXD A;  4H0L C;  2R3S A;  1VQL P;  1VF5 B;  1FS0 E;  3AE5 C;  2J58 A;  1SQQ K;  2D2C B;  3CCU P;  3AE1 C;  4KJM A;  4Y99 C;  1N7S B;  2FYU D;  3EWK A;  2WSC J;  2E76 C;  3A0H E;  2JHM F;  2DW3 A;  3KPE A; 
#chains in the Genus database with same CATH homology
 1N73 B;  1RF0 B;  1M7L A;  3GHG A;  3HD7 C;  4HYT B;  5AW5 B;  5KLV K;  3LW5 H;  4C46 A;  2JEE A;  4WB4 A;  5CJ0 A;  1JUN A;  1YTZ I;  3A7O A;  1JCD A;  3B8E B;  1FIB A;  2CPS A;  3V4W A;  3N4X A;  1M1J A;  1URQ D;  1JY3 N;  3HE4 A;  2WZ7 A;  2ZFC A;  4I6M C;  4WBA A;  1RF0 C;  5AVV B;  3HD7 D;  3HUS C;  4C7N B;  1Z56 A;  4N3Y B;  1GU4 A;  2J0H A;  1NH4 A;  1FZC B;  2KYV A;  2ZXE B;  1LTT C;  3B5N D;  1Z3U A;  1FZG C;  4R9J A;  1GL2 D;  1SQP K;  4I2L C;  5AVZ B;  1SFC B;  4GT1 A;  2W6A A;  2HOD A;  2XNX A;  4NYT A;  3H32 B;  1HGZ A;  2R5D A;  2LKM A;  3VMZ A;  2PAJ A;  1T2K C;  2FFD A;  2NPS B;  4IFM A;  1Z3S A;  2D39 A;  3RL0 D;  5CCH D;  3CLQ A;  1RE4 A;  4I1L A;  2P7J A;  3BVH C;  4JYC A;  1T2K D;  3T97 A;  2NPS C;  5AW3 B;  1KIL B;  2HPC C;  2IFM A;  1JMM A;  3IR9 A;  5APW A;  5AW1 B;  1AFO A;  2YMY A;  1WRG A;  3M0D C;  2HG5 D;  1CZQ A;  3HTK B;  3CL3 D;  2Z5I A;  2Q7C A;  3V2Q A;  3SWF A;  1JNM A;  2OYH A;  1XTG B;  1M1J B;  3B5N C;  5APY A;  1FZE B;  1FBM A;  3HTK A;  2Z4E A;  3II6 A;  2H8P D;  2H43 A;  5AW4 B;  4LC1 A;  3V5B A;  1L4A A;  3NXS A;  5BVZ A;  1VPC A;  1HJB A;  3SWY A;  4JYO X;  2QM7 A;  1A02 F;  2J64 A;  3U1C A;  3GHG B;  1LT9 C;  1FDM A;  1J1D C;  3E1I A;  3BAT A;  3M9H A;  1URQ C;  2GY7 A;  4EOT A;  2N1T C;  3L37 A;  1RE3 A;  1FJK A;  2I1J A;  1JY2 P;  2OYI A;  3A2A A;  3VOP A;  1NO4 A;  4XA4 A;  5AW8 B;  3OA7 A;  1JCC A;  4AUW A;  1J1E C;  2KOG A;  5AVS B;  4M7H A;  1IFM A;  1GW3 A;  4LLH A;  5CJ4 A;  2P2U A;  4N78 D;  3RK3 C;  1N73 C;  1QL1 A;  1S9K D;  2M8R A;  2N1T D;  1NTM K;  2YKP A;  1NOH A;  3RK2 C;  1FJP A;  4DZO A;  2J3F D;  3VTP C;  3RK2 B;  3NFQ A;  1SFC D;  3MUD A;  1FZC A;  3L35 A;  5CCG D;  1OXZ A;  4AYC A;  1YTZ T;  3EQ2 A;  2R32 A;  2XDJ A;  3TSI A;  3KDP B;  4JYB A;  1GU5 A;  1FZB B;  3U1A A;  5KJ7 A;  2GM4 A;  3CI9 A;  2E42 A;  2HLO A;  1YYC A;  2HYN A;  1AQ5 A;  2XNX B;  4HH2 A;  1N73 A;  1H88 A;  1GW4 A;  3RL0 B;  2C9L Y;  1RF1 C;  4OH8 B;  3HRN A;  3BRT B;  2KSJ A;  3VMY A;  4C7N A;  4GIF A;  1RF1 A;  5AVX B;  5AW6 B;  2WNP F;  2R3C A;  5CMZ A;  1IC2 A;  2HLO C;  3R2P A;  3V4Q A;  5KJ7 C;  1RE3 C;  2N1T A;  1CI6 A;  1LTB C;  1N7S D;  3V2N A;  1J1D B;  1FU1 A;  1URQ A;  2Q9I B;  1DH3 A;  2WWW A;  2O1K A;  2VRS A;  1J2J B;  1MFZ A;  3E1I C;  2J3G A;  3V2R A;  1FZC C;  4DOJ A;  3LIE A;  1LT9 A;  3HE5 A;  4IFD K;  2J3O A;  2JHK F;  1G1J A;  4JZC A;  2IFN A;  4ZKU A;  1KQL A;  1JY2 O;  2H43 C;  1NTZ K;  2WSE H;  1PFI A;  3M06 A;  1FOS F;  4R9T A;  2OYH C;  2GUV A;  5APX A;  2A45 H;  3P8M C;  2OYI B;  1MZ9 A;  1HUC A;  3P8C E;  3V2P A;  2J0G A;  1IO4 A;  1SLQ A;  1WT6 A;  1J1E B;  2QM8 A;  2HPC A;  2OYI C;  2A45 G;  1HBW A;  2WSC H;  2J0Y A;  3BVH A;  3L4F A;  1T8Z A;  2FIB A;  4GKG A;  1RE4 C;  1GK4 A;  1H89 A;  4XE5 B;  1FZD A;  1G2C A;  1S9K E;  2O01 H;  1GL2 B;  2Q5U A;  2KLV A;  3G3Z A;  1NHL A;  2L5G B;  4M3L A;  2JHH C;  2HOD B;  4EIJ A;  1HVV A;  2XNX C;  2CPB A;  1IJD B;  3RK2 D;  1L4A C;  3MGN A;  1E5W A;  1LTI C;  2KB7 P;  1HTL C;  1ZN5 A;  1X79 B;  4W7Z A;  2Z4E C;  3B5N A;  3RK3 D;  3TK1 A;  2Z5H A;  3OJA B;  1L4A D;  2XV5 A;  3C9I A;  1LTJ B;  1HH0 A;  3M0D A;  1RY3 A;  2JJL A;  3HUS A;  1FOS E;  4WY4 D;  2NPS A;  1RF0 A;  3IFM A;  1KFN A;  1EQ7 A;  1SQX K;  1H8A A;  2FFD C;  3KQG A;  2MJZ A;  2FKW B;  2XZR A;  1LTS C;  2YKO A;  4RES B;  3OAK A;  1MUU A;  2HOD C;  3HD7 A;  4O9B A;  2JHI F;  1NKN A;  1X9V A;  1IFN A;  5AVU B;  2FYZ A;  2J5Z A;  1FZG A;  3E1I B;  2FXM A;  1GZL A;  1FID A;  3A3Y B;  1LTA C;  1FZF A;  1IFJ A;  5APV A;  2WPR A;  1FZG B;  1N2D C;  2O1J A;  2FYU K;  1IK9 A;  1FIC A;  2HLO B;  3HD7 B;  2HFE D;  5AW2 B;  5CCG A;  3VN0 A;  2J1G A;  2YNY A;  4KHX A;  3M91 A;  1LWU A;  1M1J C;  2J2P A;  2C0X A;  3A5T A;  1SVF A;  1RF1 B;  2WTY A;  2W6B A;  1CI6 B;  1VDF A;  2M3B A;  2R5B A;  4N6J A;  5KJ7 D;  3NTN A;  3B5N B;  1FZE C;  5CHX A;  1G1I A;  1JY3 P;  5CCH A;  2YO3 A;  1JTH B;  1DX7 A;  1JOC A;  1NWQ A;  3KYQ A;  2KP8 A;  5AVR B;  3GHG C;  3HE5 B;  2PP6 A;  5AW7 B;  5BU8 B;  2FFD B;  2WPS A;  1IFI A;  4ZKP A;  1GD2 E;  1GL2 C;  3NMD A;  4LGD E;  5APS A;  2J61 A;  1N7S A;  2WSF H;  1FZB A;  1CSB A;  3M9B A;  3HE4 B;  3O8Z A;  1NKZ B;  3WMM 0;  2OAR A;  1SFC A;  3L36 A;  4Y99 B;  1SP4 A;  1LTG C;  3RK3 B;  3VYI A;  1LTJ C;  2J61 B;  5APU A;  1JO5 A;  4WY4 A;  4B86 A;  2J59 M;  5APT A;  3PP5 A;  2Q3I A;  4M7F A;  1NU1 K;  4W7Y A;  1ZLL A;  3TYY A;  3FIB A;  3VP9 A;  1DEB A;  3MIW A;  1N86 A;  1GTW A;  1LGH B;  1QL2 A;  1CW5 A;  2YO2 A;  2BAS A;  1HWT C;  3P32 A;  1A02 J;  3LID A;  1NTK K;  5AW9 B;  1JC9 A;  1FZA C;  3UIA A;  3P8C D;  2Q9I A;  1GDT A;  2C9N Y;  4C7R A;  2W27 A;  1SQB K;  1KFM A;  1N7L A;  3H32 A;  3H32 C;  4IFF A;  5AW0 B;  4EPU A;  1LT9 B;  1W2E A;  2IPP A;  2H7H A;  1X8Y A;  2Q9I C;  3TNU A;  3P7K A;  5APQ A;  1URQ B;  1RE3 B;  3EFG A;  1KIL A;  2WIT A;  3U59 A;  2GUS A;  2XU6 A;  1GK6 A;  1OWA A;  2H43 B;  2J3F A;  3HUS B;  2OYH B;  1HGV A;  3VP8 A;  1LTJ A;  1MV8 A;  1T3U A;  3H6P A;  4W80 A;  3BAS A;  1FZA B;  5AVQ B;  1KIL C;  2HPC B;  1JY3 O;  1ZR4 A;  2N1T B;  1N7S C;  1L0N K;  2Z4E B;  3VMX A;  1JY2 N;  3I5C A;  1L0L K;  1GL2 A;  4AQR D;  1ZR2 A;  2J3U A;  2POH A;  1LWU B;  2IX7 C;  2E43 A;  2J60 A;  2YKQ A;  3BVH B;  3MTU E;  2NPS D;  2N9B A;  1FZA A;  3BRV B;  1G2C B;  1NAF A;  3M0A A;  1T3J A;  3RL0 C;  5CCH C;  1FZE A;  1N86 C;  1RE4 B;  1FZF B;  3TNU B;  1KIL D;  1ZV8 A;  4JF7 A;  1JTH A;  1L4A B;  1SQV K;  3M9Q A;  3N7N A;  1LWU C;  1IFD A;  2P1J A;  5BU5 A;  2WT7 B;  4WY4 C;  2WPQ A;  5AVY B;  5CCG C;  2I1K A;  5AVT B;  2JHL F;  1SFC C;  2P67 A;  4WY4 B;  5KTB A;  1FAV A;  5AVW B;  2XKM A;  1KZU B;  2WT7 A;  2J58 A;  1FZB C;  1SQQ K;  4ZFG A;  4Y99 C;  2A45 I;  1FZF C;  1N7S B;  1N86 B;  4N78 E;  3MD0 A;  2C0W A;  2JHM F;  1XTC C;  3KPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...