1RF0C

Crystal structure of fragment d of gammae132a fibrinogen
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLAAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf0C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf0C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf0C03
2HODA 2H43C 3BVHC 1FIBA 2H43B 3H32C 4M7FA 3BVHB 1LT9C 3GHGC 2HLOA 1M1JC 3H32B 1JY3O 2HODC 1LT9B 3GHGB 1M1JB 1Z3UA 2HODB 4R9JA 2Z4EC 2HLOC 1RE3A 2WNPF 2D39A 2HLOB 2Z4EB 1FZBC 3FIBA 1N73A 4JYOX 1Z3SA 1T3UA 1FZBB 4JZCA 2Q9IC 1FZFA 1FZAC 1FZGC 2OYHA 1LTJA 2HPCA 2J61A 1FZAB 1FZGB 1FZCA 1N73C 1RF1C 2JHHC 4ZFGA 1JY3N 1RF0A 1N73B 2J3UA 1RF1B 2J3FA 4R9TA 2J3FD 1FZCC 4M7HA 2JHLF 1JY2O 2J3GA 1RF0C 1FZCB 2A45H 2GY7A 2J0YA 1RF0B 1JY3P 3E1IA 2J1GA 1RE3C 1JC9A 1RE3B 2OYIA 1FICA 4NYTA 1RE4A 1FZFC 2J3OA 1LTJC 2OYHC 1JY2N 2HPCC 1FZFB 2FFDA 1LTJB 2OYHB 2J0HA 4EPUA 2XNXA 2HPCB 1FZDA 2J61B 1RE4C 1RE4B 2FFDC 1LWUA 3BVHA 2J5ZA 2FFDB 3H32A 1JY2P 1LT9A 1M1JA 1N86A 1LWUC 2JHKF 2JHMF 1W2EA 2FIBA 2J0GA 1LWUB 3E1IC 3HUSA 2Z4EA 2J60A 3E1IB 1N86C 2A45G 1FZEA 1N86B 1FZBA 3HUSC 2J64A 2OYIC 1FIDA 3HUSB 2Q9IA 1FZAA 2OYIB 1FZGA 1FZEC 2J2PA 1FZEB 2H43A 2A45I 1RF1A 2XNXC 2JHIF 2XNXB 3GHGA 2Q9IB
chains in the Genus database with same CATH superfamily
5AW4B 2KYVA 5CCHD 2JJLA 1R5SA 2XZRA 2QJYC 5B66E 4R4MA 4U7JA 4N6JA 4XE5B 2D39A 2IFNA 3S1KA 1SQQJ 2Q9IC 1M1KQ 2R5DA 1FZCA 4ZFGA 5KLVE 2Q1KA 1YHQP 1NTKG 3H1IJ 2J3FD 5CCHC 2P1JA 2WTYA 1PGJA 1S3JA 2A45H 1EXIA 5KAIH 1OMIA 4KJMA 3RK3E 5BU5A 1AJYA 1RE3C 3TNUA 1JC9A 3EFFK 1SQQG 2ZYGA 5BU8B 3B5NA 3TGUD 3ZDMA 2WWWA 5H2FH 4U3FE 2KSEA 1LTJB 4EPUA 1M8OB 1PP9E 1CZQA 3EQ2A 2Q5UA 1RE4B 1J1EB 1M57D 3MD0A 2V7QH 1Q7YQ 3EWKA 4ZMDA 1SQVJ 3E1IB 3MP7B 3CCLP 1KD1Q 2ZVOB 3CWBJ 1JM0A 4AUWA 1EZVE 1FIDA 2J2PA 5K5GB 3CPWO 2O1JA 4OGQC 3O6QB 2XNXB 1YTZI 1Y47A 2E76C 3A3YB 3CCEP 1IFIA 2IBZG 3IR9A 3GHGB 4IL6H 3KQGA 3L73G 1VPCA 3SWKA 1JOCA 5AW6B 1NTME 1L0LE 1HUCA 1L4AD 1KILE 1PPJD 1HWTC 3H1HE 2HPCA 1FZAB 2GUSA 2NPSD 3SSUA 1RF1B 1Y9BA 1YBKA 3HE5A 2R32A 1JY2O 4W80A 2J3GA 1FZCB 1RHZB 2J0YA 2M5AA 2ZYAA 3AE9C 2K9JA 3V4QA 2J1GA 3E1RA 2OYIA 1FS0E 3B5NB 4K3AA 1AVYA 2FFDC 4IOIH 1DX7A 1BE3J 1M1JA 1S1CX 2W6BA 1S4XA 2JWDA 1L0NG 2WSEJ 1ZR4A 1NAFA 1LJ2A 5AW8B 4C46A 3VYIA 2WT7B 3M9QA 5B5EE 2IYOA 3H25A 3CCRP 2WITA 4JYBA 1BE3G 1SQBD 1LTTC 3P32A 2E75D 2OQQA 3D6YA 3BVHB 5TJHA 3CC7P 2LR2A 2LKMA 4H0LB 1WMKA 2LXBA 2HYNA 2Z4EB 2WPVB 1QL2A 2IBZI 3VTPC 2BCCG 1NTZK 2FKWB 1FZGC 4WVZA 2G8YA 2JHHC 1NU1K 2QE7H 3VP9A 1LGHB 3L75E 2E75C 1QGKB 1MUUA 3OJAB 2FYUJ 3CX5D 2FXMA 3HE4B 1J1DC 2OTJP 3CX5H 3PH0A 3CMAP 2GA1A 1KFNA 2QA4P 3L70D 1JB0J 3VN0A 1GTWA 1FZFB 3TSIA 4RKUJ 1N7SB 4ASWA 3GF3A 2FYUG 2YO2A 3Q5PA 5BVZA 1URQA 3AE2C 1MKMA 4R4LA 1AV1A 3TGUJ 4K35A 3RK3B 1LNQA 1JTHA 3B8EB 1QVFO 2A45G 3CC4P 3HUSC 2ZT9D 2PRRA 1CSBA 3PLNA 5AVWB 1LTGC 3VP8A 1PZQA 1SQPD 2Z5HA 3CLQA 5KAFE 1E79H 2PP6A 3IAOA 5APXA 2M8RA 5APUA 3TGUG 1JUNA 1BCCJ 4WBAA 3RGUA 2KK7A 3SWFA 1N8RQ 4C7NB 3HD7D 4DJGA 3H1JJ 4H13C 1KYOD 3FWLA 4UB8E 4PV1D 4IFDK 5AVXB 1KYOH 2J61A 1N73C 1S5LE 1OFCX 4PD4I 1JY3N 1VQ8P 2L91A 3H1ID 1RF0C 3RL0D 1X8YA 3JCUH 2XDJA 3G3ZA 1M90Q 3F89A 3H1JG 2YKPA 3HD7C 2D2CC 3A0BE 1JEKA 4PV1C 3H1LJ 4UB6H 5KLVK 1ZN5A 4AYCA 1SFCB 3AECC 1GL2A 2WPQA 4KT0J 2XV5A 2YIUB 3RL0C 2E74D 4Z1MH 1RY3A 1T8ZA 4HKZH 4EYYQ 3V4WA 1IFJA 5GTHE 1VF5B 1N2DC 1SQVD 4MN4C 1KB9E 2IBZD 2Q3EA 1JO5A 4I2LC 3BCCJ 1HJ0A 3CCMP 1Y8AA 3CWBD 2Q9IA 1FZEC 3FGAD 5GTIE 2A45I 1URQD 1NU1J 3RBZA 5CCHA 2H43C 1PGQA 1LT1A 1S2EA 1Q2NA 1LT9C 1WT6A 3A0HH 2KI7B 2KP8A 3I5CA 1FE6A 2N1TD 1RE3A 3BCCG 3H1KJ 5DJTB 4D6TE 5APQA 1NGMB 3RK2C 2QJPB 4I7ZB 1OW6A 3P8CD 1KILC 1NTZE 2J3FA 1UIXA 2ZAEB 2QG4A 2CK3H 1XTCC 5APSA 1HF9A 1BGYJ 1NTMK 1L0LK 1X79B 2N1TC 1USDA 4N78E 2IPPA 2FXOA 3T97A 1SQBG 1IO4A 5E79E 1NKZB 1QX8A 1KFMA 2OYHB 1YIJP 1SQXJ 3G71P 4W7ZA 3TYYA 3U1CA 3Q2YA 4L74A 1BGYG 2H89C 2AXTH 2E42A 3L70J 3KXDA 1LWUC 1K05A 4L75A 1NJIQ 1BE3D 3KDPB 2Q6QA 2A06D 3S4RA 1GL2D 2P58A 3BRVB 2QJKB 3VMAA 1SQXG 1LTBC 4PJ0E 2VRSA 2N9BA 1PL5A 4WY4B 2Q9IB 1IFNA 3A2AA 3L70G 4GDOA 3H32B 3A5TA 4C7RA 2HODC 3L71E 1VQPP 1Z56A 1KZUB 5CCGC 3VOPA 1OWAA 3O8ZA 1FZBC 3GMAA 5AVZB 4JZCA 2C9NY 2NPSA 4ZKPA 1L0NK 5KKZC 5APTA 3KHUA 2JHLF 2E5YA 2HR3A 3KPEA 3L72E 4GOEA 2FYUD 4CPGA 1SQPG 4YXDC 5KTBA 4U3FJ 1HBWA 4QMAA 2HG5D 1PP9J 1ZP0C 2ZYDA 3A7OA 3AEGC 3Q5SA 3AE1C 3VMYA 3FX0A 1G1JA 2JP3A 1VQKP 4XA4A 4Y99C 1S5LX 3CXHD 3N4XA 3P8MC 1HVVA 4U3FG 2J60A 1P84E 3CXHH 1NTKE 1BDCA 3H1IG 4W7YA 2ZXEB 1FZGA 4OGQD 3NTNA 4AQRD 2E76D 1QLED 1DIPA 3CX5I 5TISE 1SQQE 3PJSK 3GF7A 5AVTB 4BXLA 1BCCD 2Y0DA 1L0LJ 2JO1A 3D71A 3JSVC 3MUDC 3H1HJ 2Q3IA 1CW5A 2M0BA 4HJGH 3H1JD 4JYCA 5AW3B 3A0BH 3LIDA 4H44B 1KC8Q 1L4AB 1S9KD 1M7LA 1SQVG 4EI2A 1OW8A 2QIWA 2NPSB 3D70A 3CWBG 1PFIA 3UIAA 3U59A 5CJ0A 1A02J 3CCVP 3MTUE 1YJNP 1HH0A 1VQ5P 2DW3A 2C0XA 1HTLC 1VQNP 2AEFA 2WPRA 3W67A 3V2PA 3H1LD 1LTJC 2R3SA 1VQ4P 2H7HA 1N7LA 1YI2P 3GW6A 3L73E 1FAVA 1RE4C 4BRYA 3USSA 1J1EC 2KZIA 5AVRB 2FY8A 4L76A 4OWFA 1ZMEC 2B89A 1N86A 3CL3D 3AE6C 3AE8C 3E1IC 1VQ7P 1KYOI 1KQSO 3TNUB 4OH8B 3E7KA 1GU5A 1GK6A 3BCCD 5AW5B 2G3AA 2RMZA 4LLHA 2XNXC 3KYQA 2K1AA 1FJKA 1NU1D 2MJZA 3GHGC 2HLOA 1JY3O 3M0DC 1G1IA 2K88A 3H6PA 3CC2P 3HD7A 2KB7P 3H1KD 1FU1A 3JC22 1NH4A 1FZAC 1TU3F 2JR8A 2YMKA 3L75J 3S9OA 1VQMP 1RF1C 3TDKA 5E79H 1L0NE 2A06G 4I6MC 1FZCC 4GKGA 1NKNA 1FOSF 4N3YB 2AEMA 1BGYD 5M1BA 1EDLA 2KSJA 1EDIA 3SWYA 1ZRTD 1MV8A 2O01N 2WVRA 3B5NC 2P67A 2HPCB 3KZIE 2O01J 5KLIB 1SQXD 3HE5B 4PD4E 1LT9A 2R44A 4DOJA 5AVVB 2BCCE 2NRGA 2JHMF 3WU2E 2M5AB 1YYCA 2K9JB 4ZKUA 3L74E 1VQOP 2LXCB 1N86B 5AW9B 3OW2O 1SVFA 2OYIB 1KILA 4JF7A 1LTSC 3R2PA 3V6IA 2ZT9B 1SLQA 1IFDA 2ZFCA 1SQBK 3V2NA 3BVHC 4WB4A 5KJ7C 1M1JB 3MGNA 4H0LC 2N1TA 5EFWB 1NYHA 5B66H 2Z4EC 4H13D 1MZ9A 2WNPF 2HLOB 1RH5B 1CI6A 4JYOX 3WUUA 1OXZA 2WSSH 5AVQB 5KLVD 2KS1A 1FDOA 2W90A 5KAIE 1HGZA 2JDIH 2GY7A 4L73A 4EDFA 3WUTA 2D2CD 3RK3D 3D6ZA 3L36A 5H2FE 1DEBA 4U3FD 3TGUE 1KTMA 1AQTA 1FZFC 3HRNA 1P84H 1BCCG 2B87A 1N7SC 2M3BA 5AVSB 1PP9D 3FXDA 3VMXA 5AW2B 3L4FA 2ITAA 2W27A 3RK3C 3FXEA 2FIBA 1OVUA 4GODA 1ZOYC 3IN6A 2E74B 5CCGA 3I55P 4NPDA 4JBZA 1FZBA 1EZVD 3CCJP 3M9HA 1XTGB 3GG2A 3M91A 2YKOA 2R3CA 1NO4A 1URQB 4IL6E 1WRGA 2MKVA 3AE4C 3H1LG 4LC1A 3ITKA 1NTKK 2IFMA 3HTKA 4D6TJ 1JTHB 3RK2D 4DCKA 1KV4A 1NTMD 1L0LD 3II6A 3G9RA 1NTZJ 2IX7C 1KILD 1H0TA 3H1HD 3WMM0 2RN0A 1PPJE 2H88C 1SQQK 4WWIA 1JMBA 3NXSA 2KOGA 2WSCH 3EFGA 3GLMA 2WSFJ 3AEAC 3CXHI 2KS1B 2Z5IA 1U7JA 3QH9A 1OZHA 1HGVA 1GW3A 2QVAA 1S72P 4YTPC 1G2CA 4TLFA 1QL1A 1NU1G 1SFCC 4NYTA 1W5CE 2YNYA 2J0HA 2J61B 4B86A 1W2BO 2YIUC 4RJTA 3H1KG 2B88A 1JY2P 2YXQB 4NPEA 4EIJA 1LP1A 1VF5C 2NZ2A 3MHVA 3CCUP 2JWAA 2FYNB 1JCDA 1T2KC 1NHLA 1YQ4C 1SQVK 1QEXA 3LW5H 2KZJA 1KORA 5B5EH 1FDMA 3G4SP 1GDTA 1GL2B 3CD6P 1ZW0A 2UWJE 1X22A 2C9LY 1SQBE 3L71J 3P7KA 1YJWP 2WMMA 2QJYB 2YXRB 3IFMA 5CCGD 5AW7B 4OVNF 1AVOA 4DZOA 4I7ZC 2J58A 1PGPA 4GOFA 3R4YA 3ABVC 1Z3SA 1U57A 1LTJA 2BASA 2QRXA 2JKVA 3B71A 1H0TB 1DD4A 3L75D 4HYTB 3L72J 3V2RA 1RQVA 2OTKE 3AE7C 4M7HA 1OX3A 2BEQD 3NMDA 1KMIZ 2KIKA 2BEZF 3KZIH 3CX5E 3MIWA 1USEA 3E1IA 1ZR2A 4O9BA 2POHA 4RESB 1EC5A 5KLVJ 1RE3B 1PIXA 3L70E 1X9VA 1NAYA 1GU4A 2OYHC 2FFDA 2XNXA 1M56D 2W6AA 5APVA 1IFMA 3BATA 3Q3DA 4TT3H 1T3JA 2O01H 3M0DA 1JCCA 5KLVG 1NTKJ 3M0AA 2QEXP 3T97B 2P10A 3F5HA 2QJKC 1LP1B 1FZAA 1RF1A 4WY4C 3CMEP 1IFPA 4EOTA 1SQPE 4OGQB 3V2QA 2OGUA 3AE5C 1ZV8A 5KAFH 4BWNA 3H32C 2E76B 3PHLA 1Z3UA 5CHXA 1L2PA 1PP9G 1E5WA 3CI9A 1KYOE 1MFTA 4UB8H 3VMZA 1S5LH 2YO3A 1EZVG 4XFJA 2XKMA 1OVRA 3JCUE 3H1IE 1NTMJ 1DEEG 2FYUK 1RQUA 1A02F 3PRJA 2Y9ZA 1DD3A 1GZLA 1YQ3C 2WT7A 2YMYA 4UB6E 4GIFA 2WSCJ 2PGDA 4IL6X 1FICA 3L73J 3W68A 2FYZA 1Q90D 1NTMG 1L0LG 3BVHA 2AXCA 2FFDB 3H1HG 4GT1A 5CMZA 5KJ7A 3I56P 2I8DA 3HUSA 2Z4EA 1YTZT 1KB9D 5GTHH 3RL0g 2V4HA 1SQVE 2IBZE 1KB9H 2ZXXA 5CJ4A 3CWBE 4JPZB 3AEBC 4H44D 1QVGO 5GTIH 3PP5A 3BRTB 3N7NA 4HH2A 3LW5J 3A0HE 4M7FA 3HE4A 5DJUB 1FJPA 4R9JA 2Q7CA 1P84I 4D6TD 1VL2A 1K8AQ 1N73A 1FDIA 1FZFA 1NTZD 1R8EA 4H44C 3Q1MA 1L0NJ 3P8CE 1FZGB 1L4AC 1N7SA 1KQLA 4DT0A 1RF0A 2W8ZA 4IFMA 2NPSC 2E75B 3RBXA 1T6AA 4IFFA 1X0TA 1J1DB 4N78D 1EZVI 2WSFH 2L5GB 1EXJA 3B5ND 2WZ7A 2H8PD 1H88A 3L37A 1FZDA 1FC2C 3K5BA 2AXTE 2BCCJ 2IDBA 2J5ZA 5L8RJ 2C0WA 3QWOC 2JHKF 1IK7A 4C7NA 3L74J 3AEEC 3CCSP 1BE3E 2P2UA 2O1KA 3L75G 1FZEA 2A06E 1IC2A 2K3RA 4NPFX 2J64A 2I1KA 3CCQP 3HUSB 1UIIA 2N9YB 2H43A 3SFEC 4PJ0H 4BRYB 1AQ5A 1OVVA 5KJ7D 1Q86Q 3L74G 4H0LD 3L71D 3WUVA 3TK1A 4YPCA 1GW4A 2KLUA 3PTZA 3FIBA 1SFCA 3M9BA 2CPSA 4H13B 4A7PA 2M3EA 1IK9A 1N73B 3IF4A 1VQLP 4R9TA 3L72D 5AVUB 1FOSE 1RF0B 2Y9YA 4ASVA 1ZLLA 2FYUE 3HD7B 2QM8A 2D2CB 1FBMA 2Y0CA 1SP4A 1N7SD 2QM7A 4PV1B 4I1LA 3B4SA 3V5BA 1JY2N 2HPCC 2OARA 5KLIC 2V7QJ 2R5BA 1LWUA 3LIEA 1SQXK 2K9YA 3RL0B 1Q82Q 3C1LA 2WPSA 1P84D 3CXHE 1N86C 1NTKD 3OAKA 1LTAC 1OW7A 2OYIC 2WQYC 3FWNA 2KNCA 2ZT9C 1FZEB 2JHIF 1SQQD 2HODA 2H43B 2IZ0A 5TISH 1M1JC 1JMMA 2GUVA 1U7MA 1LT9B 1BCCE 1GD2E 2HLOC 1BSNA 2PFXA 1OIPA 1SQPK 3RK2B 2OYHA 3H1JE 1DH3A 2J59M 1KILB 1K9MQ 1S9KE 2RH0A 2KLVA 1EQ7A 2W83C 4HB1A 2O3JA 2IZ1A 3C9IA 2JEEA 4KHXA 1AA0A 2CPBA 1AFOA 1PPJG 2N1TB 1SFCD 5CBNA 1H8AA 5C39A 1MFZA 1CI6B 1NWQA 2J3OA 1VQ6P 2FXPA 1D7MA 4ZNCA 3H1LE 3L73D 1IJDB 4WY4A 2RKLA 1BSHA 2J5UA 4D6TG 2QSIA 3H32A 1VF5D 2B9BA 1NTZG 2E74C 1T2KD 1LWUB 1Q81Q 3Q5RA 1BDDA 1VDFA 3AE3C 4Y28J 1ZXGA 3TF5A 4YXWH 2P7JA 1JNMA 1PGOA 1H89A 1GK4A 3NFQA 2FBWC 1KQGB 1PV3A 3BCCE 3SFDC 1SQBJ 2B87B 3U1AA 2K37A 2XNDH 2KNCB 2KUBA 2XU6A 1GMJA 1YJ9P 1URQC 1FIBA 3G6EP 1NU1E 5AW0B 3MUDA 2HODB 1NVOA 5APWA 2GM4A 2E43A 2Y0EA 3AEDC 1SS1A 1T3UA 4LGDE 1FZBB 1R5LA 3H1KE 1KN7A 1EDKA 4M3LA 2ZJSE 2OYOA 5AW1B 2YKQA 3BASA 1L0ND 2J3UA 5KKZB 2I1JA 2W6JH 1K04A 1HJBA 4RO0A 1JY3P 1YITP 1KB9I 2HFED 2QJPC 1BGYE 3HTKB 2AEJA 2PAJA 3C8VA 3L35A 1ZRTE 3L71G 1RE4A 3MZWB 5APYA 1KQFB 2WSEH 3M06A 4PD4D 1VQ9P 2SPZA 2BCCD 1SQXE 4JQ0D 2OTLP 4PD4H 1IZNB 1W2EA 2J0GA 1LTIC 4Y99B 2FYNC 2E5TA 3WU2H 3L74D 1K73Q 3OA7A 3AEFC 2KXPB 3L72G 1G2CB 2ZVNB 3O6QA 2IYPA 4WY4D 1SQPJ 1GL2C 1L4AA 1EDJA 1J2JB 5CBOA 5AVYB 1NOHA 3GHGA
chains in the Genus database with same CATH topology
1SQBK 5CCHA 3N7NA 2H43C 3V2NA 5AW4B 4HH2A 3BVHC 2KYVA 5CCHD 2JJLA 4M7FA 3HE4A 2XZRA 1LT9C 1FJPA 1WT6A 4WB4A 2KP8A 5KJ7C 1M1JB 3MGNA 3I5CA 4R9JA 2N1TA 2Q7CA 2Z4EC 2N1TD 1RE3A 1MZ9A 4N6JA 4XE5B 2WNPF 2D39A 2IFNA 2HLOB 5APQA 1CI6A 3RK2C 1N73A 4JYOX 1OXZA 5AVQB 3P8CD 1FZFA 2Q9IC 1KILC 3P8CE 2R5DA 1FZGB 1L4AC 1N7SA 1FZCA 1KQLA 4ZFGA 1RF0A 4IFMA 2J3FA 2J3FD 2NPSC 5CCHC 2P1JA 2WTYA 1XTCC 5APSA 1HGZA 2A45H 2GY7A 4IFFA 3RK3D 1NTMK 1L0LK 1J1DB 1X79B 2N1TC 4N78D 5BU5A 3L36A 1RE3C 3TNUA 4N78E 2IPPA 2WSFH 1JC9A 3T97A 5BU8B 2L5GB 1IO4A 3B5NA 3B5ND 1NKZB 1DEBA 2WZ7A 2H8PD 2WWWA 1FZFC 3HRNA 1H88A 1KFMA 1N7SC 1LTJB 2M3BA 5AVSB 2OYHB 4EPUA 3L37A 1FZDA 3VMXA 1CZQA 3EQ2A 4W7ZA 3TYYA 2Q5UA 3U1CA 1RE4B 1J1EB 5AW2B 2J5ZA 3L4FA 2E42A 2C0WA 2W27A 3RK3C 1LWUC 2JHKF 3MD0A 4C7NA 2FIBA 3KDPB 2P2UA 2O1KA 3E1IB 5CCGA 1FZEA 1FZBA 1IC2A 4AUWA 2J64A 1GL2D 2I1KA 3BRVB 3HUSB 1FIDA 3M9HA 1XTGB 2J2PA 1LTBC 3M91A 2H43A 2VRSA 2N9BA 2O1JA 4WY4B 2XNXB 1YTZI 2YKOA 2Q9IB 1IFNA 3A2AA 2R3CA 1AQ5A 5KJ7D 1NO4A 3A3YB 1URQB 1IFIA 1WRGA 3H32B 3A5TA 4C7RA 2HODC 3IR9A 3GHGB 4LC1A 1NTKK 1Z56A 2IFMA 3KQGA 3HTKA 3TK1A 1VPCA 1KZUB 1GW4A 1JTHB 5CCGC 3RK2D 1JOCA 3VOPA 1OWAA 3II6A 5AW6B 3O8ZA 1FZBC 3FIBA 2IX7C 1KILD 1SFCA 3M9BA 1HUCA 2CPSA 1L4AD 5AVZB 4JZCA 3WMM0 1HWTC 2C9NY 2HPCA 1FZAB 1SQQK 2NPSA 4ZKPA 2GUSA 2NPSD 1L0NK 1IK9A 1N73B 1RF1B 5APTA 4R9TA 3HE5A 3NXSA 2R32A 2JHLF 1JY2O 2KOGA 4W80A 5AVUB 1FZCB 2WSCH 3EFGA 3KPEA 2J3GA 2J0YA 1FOSE 1RF0B 2Z5IA 1ZLLA 3V4QA 2J1GA 1HGVA 1GW3A 3HD7B 2QM8A 1G2CA 1FBMA 5KTBA 1QL1A 1SP4A 1SFCC 2OYIA 1HBWA 4NYTA 1N7SD 2QM7A 2HG5D 4I1LA 3V5BA 1JY2N 2HPCC 2YNYA 3A7OA 2J0HA 2J61B 3B5NB 4B86A 2OARA 2R5BA 3VMYA 2FFDC 1LWUA 3LIEA 1G1JA 1SQXK 1DX7A 1JY2P 3RL0B 1M1JA 2W6BA 4XA4A 4Y99C 4EIJA 3P8MC 2WPSA 3N4XA 1HVVA 2J60A 1ZR4A 1JCDA 1N86C 1NAFA 5AW8B 3OAKA 1NHLA 4C46A 1SQVK 1T2KC 1LTAC 3VYIA 2WT7B 3LW5H 3M9QA 2OYIC 4W7YA 2ZXEB 1FZGA 3NTNA 4AQRD 1FDMA 1FZEB 2WITA 1GDTA 1GL2B 4JYBA 2JHIF 2HODA 1LTTC 2C9LY 3P32A 2H43B 3BVHB 3P7KA 1M1JC 1JMMA 2GUVA 1LT9B 5AVTB 3IFMA 5CCGD 5AW7B 1GD2E 2LKMA 2HLOC 4DZOA 2HYNA 2Z4EB 2J58A 2Q3IA 1CW5A 1QL2A 3VTPC 1Z3SA 1SQPK 3RK2B 4JYCA 1NTZK 2FKWB 1FZGC 1LTJA 2OYHA 2BASA 5AW3B 1DH3A 2J59M 3LIDA 1KILB 2JHHC 1NU1K 1L4AB 1S9KD 3VP9A 4HYTB 3V2RA 1M7LA 1LGHB 1S9KE 2KLVA 1EQ7A 4M7HA 1MUUA 2NPSB 3NMDA 3OJAB 1PFIA 3U59A 3UIAA 2FXMA 2JEEA 3C9IA 4KHXA 5CJ0A 3HE4B 1A02J 3MIWA 1J1DC 2CPBA 3MTUE 3E1IA 1HH0A 1ZR2A 1AFOA 2C0XA 4O9BA 2POHA 4RESB 2N1TB 1SFCD 1HTLC 1H8AA 1KFNA 1RE3B 1MFZA 3VN0A 2WPRA 1X9VA 1CI6B 1GTWA 1GU4A 3V2PA 1NWQA 2J3OA 1LTJC 2OYHC 1FZFB 2FFDA 2H7HA 1N7LA 1IJDB 4WY4A 3TSIA 2XNXA 1N7SB 1FAVA 1RE4C 2W6AA 1J1EC 2YO2A 5BVZA 5APVA 1URQA 1IFMA 3H32A 5AVRB 3BATA 1T3JA 2O01H 1N86A 3M0DA 3CL3D 1JCCA 3RK3B 1LWUB 1T2KD 3E1IC 1JTHA 3B8EB 1VDFA 3M0AA 2A45G 3TNUB 2P7JA 1JNMA 4OH8B 3HUSC 1H89A 1GK4A 3NFQA 1GU5A 1GK6A 1FZAA 5AW5B 1CSBA 5AVWB 1LTGC 1RF1A 4WY4C 3VP8A 4LLHA 2XNXC 2Z5HA 3U1AA 3CLQA 3KYQA 4EOTA 3V2QA 1FJKA 1ZV8A 2PP6A 2XU6A 5APXA 1URQC 1FIBA 2M8RA 5APUA 2MJZA 3H32C 5AW0B 1JUNA 3GHGC 2HLOA 4WBAA 1JY3O 3MUDA 3M0DC 1Z3UA 5CHXA 1G1IA 2HODB 5APWA 3H6PA 3SWFA 2GM4A 2E43A 4C7NB 3HD7A 1E5WA 3HD7D 2KB7P 3CI9A 1T3UA 4LGDE 1FZBB 1FU1A 1NH4A 4IFDK 1FZAC 4M3LA 5AVXB 3VMZA 2J61A 5AW1B 2YKQA 1N73C 1RF1C 3BASA 1JY3N 2J3UA 4I6MC 2YO3A 1FZCC 2I1JA 2XKMA 1RF0C 1NKNA 4GKGA 1HJBA 3RL0D 1X8YA 1FOSF 4N3YB 1JY3P 2HFED 2FYUK 2XDJA 3G3ZA 1A02F 1GZLA 2YKPA 3HD7C 2KSJA 3HTKB 2WT7A 2YMYA 2PAJA 4GIFA 3SWYA 5KLVK 1FICA 3L35A 1MV8A 1ZN5A 4AYCA 1SFCB 1RE4A 1GL2A 2WPQA 3B5NC 2P67A 5APYA 2HPCB 2FYZA 2WSEH 2XV5A 3M06A 3BVHA 3HE5B 3RL0C 2FFDB 1LT9A 4DOJA 5AVVB 4GT1A 1RY3A 1T8ZA 5CMZA 5KJ7A 2JHMF 1W2EA 2J0GA 3V4WA 1IFJA 1LTIC 4Y99B 1YYCA 3HUSA 2Z4EA 1YTZT 1N2DC 4ZKUA 3OA7A 1N86B 1JO5A 1G2CB 4I2LC 5AW9B 1SVFA 2Q9IA 4WY4D 5CJ4A 2OYIB 1FZEC 1KILA 4JF7A 1LTSC 1GL2C 1L4AA 3R2PA 1J2JB 2A45I 5AVYB 1NOHA 1SLQA 1IFDA 1URQD 2ZFCA 3PP5A 3GHGA 3BRTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOD A;  2H43 C;  3BVH C;  1FIB A;  2H43 B;  3H32 C;  4M7F A;  3BVH B;  1LT9 C;  3GHG C;  2HLO A;  1M1J C;  3H32 B;  1JY3 O;  2HOD C;  1LT9 B;  3GHG B;  1M1J B;  1Z3U A;  2HOD B;  4R9J A;  2Z4E C;  2HLO C;  1RE3 A;  2WNP F;  2D39 A;  2HLO B;  2Z4E B;  1FZB C;  3FIB A;  1N73 A;  4JYO X;  1Z3S A;  1T3U A;  1FZB B;  4JZC A;  2Q9I C;  1FZF A;  1FZA C;  1FZG C;  2OYH A;  1LTJ A;  2HPC A;  2J61 A;  1FZA B;  1FZG B;  1FZC A;  1N73 C;  1RF1 C;  2JHH C;  4ZFG A;  1JY3 N;  1RF0 A;  1N73 B;  2J3U A;  1RF1 B;  2J3F A;  4R9T A;  2J3F D;  1FZC C;  4M7H A;  2JHL F;  1JY2 O;  2J3G A;  1RF0 C;  1FZC B;  2A45 H;  2GY7 A;  2J0Y A;  1RF0 B;  1JY3 P;  3E1I A;  2J1G A;  1RE3 C;  1JC9 A;  1RE3 B;  2OYI A;  1FIC A;  4NYT A;  1RE4 A;  1FZF C;  2J3O A;  1LTJ C;  2OYH C;  1JY2 N;  2HPC C;  1FZF B;  2FFD A;  1LTJ B;  2OYH B;  2J0H A;  4EPU A;  2XNX A;  2HPC B;  1FZD A;  2J61 B;  1RE4 C;  1RE4 B;  2FFD C;  1LWU A;  3BVH A;  2J5Z A;  2FFD B;  3H32 A;  1JY2 P;  1LT9 A;  1M1J A;  1N86 A;  1LWU C;  2JHK F;  2JHM F;  1W2E A;  2FIB A;  2J0G A;  1LWU B;  3E1I C;  3HUS A;  2Z4E A;  2J60 A;  3E1I B;  1N86 C;  2A45 G;  1FZE A;  1N86 B;  1FZB A;  3HUS C;  2J64 A;  2OYI C;  1FID A;  3HUS B;  2Q9I A;  1FZA A;  2OYI B;  1FZG A;  1FZE C;  2J2P A;  1FZE B;  2H43 A;  2A45 I;  1RF1 A;  2XNX C;  2JHI F;  2XNX B;  3GHG A;  2Q9I B; 
#chains in the Genus database with same CATH topology
 5AW4 B;  2KYV A;  5CCH D;  2JJL A;  1R5S A;  2XZR A;  2QJY C;  5B66 E;  4R4M A;  4U7J A;  4N6J A;  4XE5 B;  2D39 A;  2IFN A;  3S1K A;  1SQQ J;  2Q9I C;  1M1K Q;  2R5D A;  1FZC A;  4ZFG A;  5KLV E;  2Q1K A;  1YHQ P;  1NTK G;  3H1I J;  2J3F D;  5CCH C;  2P1J A;  2WTY A;  1PGJ A;  1S3J A;  2A45 H;  1EXI A;  5KAI H;  1OMI A;  4KJM A;  3RK3 E;  5BU5 A;  1AJY A;  1RE3 C;  3TNU A;  1JC9 A;  3EFF K;  1SQQ G;  2ZYG A;  5BU8 B;  3B5N A;  3TGU D;  3ZDM A;  2WWW A;  5H2F H;  4U3F E;  2KSE A;  1LTJ B;  4EPU A;  1M8O B;  1PP9 E;  1CZQ A;  3EQ2 A;  2Q5U A;  1RE4 B;  1J1E B;  1M57 D;  3MD0 A;  2V7Q H;  1Q7Y Q;  3EWK A;  4ZMD A;  1SQV J;  3E1I B;  3MP7 B;  3CCL P;  1KD1 Q;  2ZVO B;  3CWB J;  1JM0 A;  4AUW A;  1EZV E;  1FID A;  2J2P A;  5K5G B;  3CPW O;  2O1J A;  4OGQ C;  3O6Q B;  2XNX B;  1YTZ I;  1Y47 A;  2E76 C;  3A3Y B;  3CCE P;  1IFI A;  2IBZ G;  3IR9 A;  3GHG B;  4IL6 H;  3KQG A;  3L73 G;  1VPC A;  3SWK A;  1JOC A;  5AW6 B;  1NTM E;  1L0L E;  1HUC A;  1L4A D;  1KIL E;  1PPJ D;  1HWT C;  3H1H E;  2HPC A;  1FZA B;  2GUS A;  2NPS D;  3SSU A;  1RF1 B;  1Y9B A;  1YBK A;  3HE5 A;  2R32 A;  1JY2 O;  4W80 A;  2J3G A;  1FZC B;  1RHZ B;  2J0Y A;  2M5A A;  2ZYA A;  3AE9 C;  2K9J A;  3V4Q A;  2J1G A;  3E1R A;  2OYI A;  1FS0 E;  3B5N B;  4K3A A;  1AVY A;  2FFD C;  4IOI H;  1DX7 A;  1BE3 J;  1M1J A;  1S1C X;  2W6B A;  1S4X A;  2JWD A;  1L0N G;  2WSE J;  1ZR4 A;  1NAF A;  1LJ2 A;  5AW8 B;  4C46 A;  3VYI A;  2WT7 B;  3M9Q A;  5B5E E;  2IYO A;  3H25 A;  3CCR P;  2WIT A;  4JYB A;  1BE3 G;  1SQB D;  1LTT C;  3P32 A;  2E75 D;  2OQQ A;  3D6Y A;  3BVH B;  5TJH A;  3CC7 P;  2LR2 A;  2LKM A;  4H0L B;  1WMK A;  2LXB A;  2HYN A;  2Z4E B;  2WPV B;  1QL2 A;  2IBZ I;  3VTP C;  2BCC G;  1NTZ K;  2FKW B;  1FZG C;  4WVZ A;  2G8Y A;  2JHH C;  1NU1 K;  2QE7 H;  3VP9 A;  1LGH B;  3L75 E;  2E75 C;  1QGK B;  1MUU A;  3OJA B;  2FYU J;  3CX5 D;  2FXM A;  3HE4 B;  1J1D C;  2OTJ P;  3CX5 H;  3PH0 A;  3CMA P;  2GA1 A;  1KFN A;  2QA4 P;  3L70 D;  1JB0 J;  3VN0 A;  1GTW A;  1FZF B;  3TSI A;  4RKU J;  1N7S B;  4ASW A;  3GF3 A;  2FYU G;  2YO2 A;  3Q5P A;  5BVZ A;  1URQ A;  3AE2 C;  1MKM A;  4R4L A;  1AV1 A;  3TGU J;  4K35 A;  3RK3 B;  1LNQ A;  1JTH A;  3B8E B;  1QVF O;  2A45 G;  3CC4 P;  3HUS C;  2ZT9 D;  2PRR A;  1CSB A;  3PLN A;  5AVW B;  1LTG C;  3VP8 A;  1PZQ A;  1SQP D;  2Z5H A;  3CLQ A;  5KAF E;  1E79 H;  2PP6 A;  3IAO A;  5APX A;  2M8R A;  5APU A;  3TGU G;  1JUN A;  1BCC J;  4WBA A;  3RGU A;  2KK7 A;  3SWF A;  1N8R Q;  4C7N B;  3HD7 D;  4DJG A;  3H1J J;  4H13 C;  1KYO D;  3FWL A;  4UB8 E;  4PV1 D;  4IFD K;  5AVX B;  1KYO H;  2J61 A;  1N73 C;  1S5L E;  1OFC X;  4PD4 I;  1JY3 N;  1VQ8 P;  2L91 A;  3H1I D;  1RF0 C;  3RL0 D;  1X8Y A;  3JCU H;  2XDJ A;  3G3Z A;  1M90 Q;  3F89 A;  3H1J G;  2YKP A;  3HD7 C;  2D2C C;  3A0B E;  1JEK A;  4PV1 C;  3H1L J;  4UB6 H;  5KLV K;  1ZN5 A;  4AYC A;  1SFC B;  3AEC C;  1GL2 A;  2WPQ A;  4KT0 J;  2XV5 A;  2YIU B;  3RL0 C;  2E74 D;  4Z1M H;  1RY3 A;  1T8Z A;  4HKZ H;  4EYY Q;  3V4W A;  1IFJ A;  5GTH E;  1VF5 B;  1N2D C;  1SQV D;  4MN4 C;  1KB9 E;  2IBZ D;  2Q3E A;  1JO5 A;  4I2L C;  3BCC J;  1HJ0 A;  3CCM P;  1Y8A A;  3CWB D;  2Q9I A;  1FZE C;  3FGA D;  5GTI E;  2A45 I;  1URQ D;  1NU1 J;  3RBZ A;  5CCH A;  2H43 C;  1PGQ A;  1LT1 A;  1S2E A;  1Q2N A;  1LT9 C;  1WT6 A;  3A0H H;  2KI7 B;  2KP8 A;  3I5C A;  1FE6 A;  2N1T D;  1RE3 A;  3BCC G;  3H1K J;  5DJT B;  4D6T E;  5APQ A;  1NGM B;  3RK2 C;  2QJP B;  4I7Z B;  1OW6 A;  3P8C D;  1KIL C;  1NTZ E;  2J3F A;  1UIX A;  2ZAE B;  2QG4 A;  2CK3 H;  1XTC C;  5APS A;  1HF9 A;  1BGY J;  1NTM K;  1L0L K;  1X79 B;  2N1T C;  1USD A;  4N78 E;  2IPP A;  2FXO A;  3T97 A;  1SQB G;  1IO4 A;  5E79 E;  1NKZ B;  1QX8 A;  1KFM A;  2OYH B;  1YIJ P;  1SQX J;  3G71 P;  4W7Z A;  3TYY A;  3U1C A;  3Q2Y A;  4L74 A;  1BGY G;  2H89 C;  2AXT H;  2E42 A;  3L70 J;  3KXD A;  1LWU C;  1K05 A;  4L75 A;  1NJI Q;  1BE3 D;  3KDP B;  2Q6Q A;  2A06 D;  3S4R A;  1GL2 D;  2P58 A;  3BRV B;  2QJK B;  3VMA A;  1SQX G;  1LTB C;  4PJ0 E;  2VRS A;  2N9B A;  1PL5 A;  4WY4 B;  2Q9I B;  1IFN A;  3A2A A;  3L70 G;  4GDO A;  3H32 B;  3A5T A;  4C7R A;  2HOD C;  3L71 E;  1VQP P;  1Z56 A;  1KZU B;  5CCG C;  3VOP A;  1OWA A;  3O8Z A;  1FZB C;  3GMA A;  5AVZ B;  4JZC A;  2C9N Y;  2NPS A;  4ZKP A;  1L0N K;  5KKZ C;  5APT A;  3KHU A;  2JHL F;  2E5Y A;  2HR3 A;  3KPE A;  3L72 E;  4GOE A;  2FYU D;  4CPG A;  1SQP G;  4YXD C;  5KTB A;  4U3F J;  1HBW A;  4QMA A;  2HG5 D;  1PP9 J;  1ZP0 C;  2ZYD A;  3A7O A;  3AEG C;  3Q5S A;  3AE1 C;  3VMY A;  3FX0 A;  1G1J A;  2JP3 A;  1VQK P;  4XA4 A;  4Y99 C;  1S5L X;  3CXH D;  3N4X A;  3P8M C;  1HVV A;  4U3F G;  2J60 A;  1P84 E;  3CXH H;  1NTK E;  1BDC A;  3H1I G;  4W7Y A;  2ZXE B;  1FZG A;  4OGQ D;  3NTN A;  4AQR D;  2E76 D;  1QLE D;  1DIP A;  3CX5 I;  5TIS E;  1SQQ E;  3PJS K;  3GF7 A;  5AVT B;  4BXL A;  1BCC D;  2Y0D A;  1L0L J;  2JO1 A;  3D71 A;  3JSV C;  3MUD C;  3H1H J;  2Q3I A;  1CW5 A;  2M0B A;  4HJG H;  3H1J D;  4JYC A;  5AW3 B;  3A0B H;  3LID A;  4H44 B;  1KC8 Q;  1L4A B;  1S9K D;  1M7L A;  1SQV G;  4EI2 A;  1OW8 A;  2QIW A;  2NPS B;  3D70 A;  3CWB G;  1PFI A;  3UIA A;  3U59 A;  5CJ0 A;  1A02 J;  3CCV P;  3MTU E;  1YJN P;  1HH0 A;  1VQ5 P;  2DW3 A;  2C0X A;  1HTL C;  1VQN P;  2AEF A;  2WPR A;  3W67 A;  3V2P A;  3H1L D;  1LTJ C;  2R3S A;  1VQ4 P;  2H7H A;  1N7L A;  1YI2 P;  3GW6 A;  3L73 E;  1FAV A;  1RE4 C;  4BRY A;  3USS A;  1J1E C;  2KZI A;  5AVR B;  2FY8 A;  4L76 A;  4OWF A;  1ZME C;  2B89 A;  1N86 A;  3CL3 D;  3AE6 C;  3AE8 C;  3E1I C;  1VQ7 P;  1KYO I;  1KQS O;  3TNU B;  4OH8 B;  3E7K A;  1GU5 A;  1GK6 A;  3BCC D;  5AW5 B;  2G3A A;  2RMZ A;  4LLH A;  2XNX C;  3KYQ A;  2K1A A;  1FJK A;  1NU1 D;  2MJZ A;  3GHG C;  2HLO A;  1JY3 O;  3M0D C;  1G1I A;  2K88 A;  3H6P A;  3CC2 P;  3HD7 A;  2KB7 P;  3H1K D;  1FU1 A;  3JC2 2;  1NH4 A;  1FZA C;  1TU3 F;  2JR8 A;  2YMK A;  3L75 J;  3S9O A;  1VQM P;  1RF1 C;  3TDK A;  5E79 H;  1L0N E;  2A06 G;  4I6M C;  1FZC C;  4GKG A;  1NKN A;  1FOS F;  4N3Y B;  2AEM A;  1BGY D;  5M1B A;  1EDL A;  2KSJ A;  1EDI A;  3SWY A;  1ZRT D;  1MV8 A;  2O01 N;  2WVR A;  3B5N C;  2P67 A;  2HPC B;  3KZI E;  2O01 J;  5KLI B;  1SQX D;  3HE5 B;  4PD4 E;  1LT9 A;  2R44 A;  4DOJ A;  5AVV B;  2BCC E;  2NRG A;  2JHM F;  3WU2 E;  2M5A B;  1YYC A;  2K9J B;  4ZKU A;  3L74 E;  1VQO P;  2LXC B;  1N86 B;  5AW9 B;  3OW2 O;  1SVF A;  2OYI B;  1KIL A;  4JF7 A;  1LTS C;  3R2P A;  3V6I A;  2ZT9 B;  1SLQ A;  1IFD A;  2ZFC A;  1SQB K;  3V2N A;  3BVH C;  4WB4 A;  5KJ7 C;  1M1J B;  3MGN A;  4H0L C;  2N1T A;  5EFW B;  1NYH A;  5B66 H;  2Z4E C;  4H13 D;  1MZ9 A;  2WNP F;  2HLO B;  1RH5 B;  1CI6 A;  4JYO X;  3WUU A;  1OXZ A;  2WSS H;  5AVQ B;  5KLV D;  2KS1 A;  1FDO A;  2W90 A;  5KAI E;  1HGZ A;  2JDI H;  2GY7 A;  4L73 A;  4EDF A;  3WUT A;  2D2C D;  3RK3 D;  3D6Z A;  3L36 A;  5H2F E;  1DEB A;  4U3F D;  3TGU E;  1KTM A;  1AQT A;  1FZF C;  3HRN A;  1P84 H;  1BCC G;  2B87 A;  1N7S C;  2M3B A;  5AVS B;  1PP9 D;  3FXD A;  3VMX A;  5AW2 B;  3L4F A;  2ITA A;  2W27 A;  3RK3 C;  3FXE A;  2FIB A;  1OVU A;  4GOD A;  1ZOY C;  3IN6 A;  2E74 B;  5CCG A;  3I55 P;  4NPD A;  4JBZ A;  1FZB A;  1EZV D;  3CCJ P;  3M9H A;  1XTG B;  3GG2 A;  3M91 A;  2YKO A;  2R3C A;  1NO4 A;  1URQ B;  4IL6 E;  1WRG A;  2MKV A;  3AE4 C;  3H1L G;  4LC1 A;  3ITK A;  1NTK K;  2IFM A;  3HTK A;  4D6T J;  1JTH B;  3RK2 D;  4DCK A;  1KV4 A;  1NTM D;  1L0L D;  3II6 A;  3G9R A;  1NTZ J;  2IX7 C;  1KIL D;  1H0T A;  3H1H D;  3WMM 0;  2RN0 A;  1PPJ E;  2H88 C;  1SQQ K;  4WWI A;  1JMB A;  3NXS A;  2KOG A;  2WSC H;  3EFG A;  3GLM A;  2WSF J;  3AEA C;  3CXH I;  2KS1 B;  2Z5I A;  1U7J A;  3QH9 A;  1OZH A;  1HGV A;  1GW3 A;  2QVA A;  1S72 P;  4YTP C;  1G2C A;  4TLF A;  1QL1 A;  1NU1 G;  1SFC C;  4NYT A;  1W5C E;  2YNY A;  2J0H A;  2J61 B;  4B86 A;  1W2B O;  2YIU C;  4RJT A;  3H1K G;  2B88 A;  1JY2 P;  2YXQ B;  4NPE A;  4EIJ A;  1LP1 A;  1VF5 C;  2NZ2 A;  3MHV A;  3CCU P;  2JWA A;  2FYN B;  1JCD A;  1T2K C;  1NHL A;  1YQ4 C;  1SQV K;  1QEX A;  3LW5 H;  2KZJ A;  1KOR A;  5B5E H;  1FDM A;  3G4S P;  1GDT A;  1GL2 B;  3CD6 P;  1ZW0 A;  2UWJ E;  1X22 A;  2C9L Y;  1SQB E;  3L71 J;  3P7K A;  1YJW P;  2WMM A;  2QJY B;  2YXR B;  3IFM A;  5CCG D;  5AW7 B;  4OVN F;  1AVO A;  4DZO A;  4I7Z C;  2J58 A;  1PGP A;  4GOF A;  3R4Y A;  3ABV C;  1Z3S A;  1U57 A;  1LTJ A;  2BAS A;  2QRX A;  2JKV A;  3B71 A;  1H0T B;  1DD4 A;  3L75 D;  4HYT B;  3L72 J;  3V2R A;  1RQV A;  2OTK E;  3AE7 C;  4M7H A;  1OX3 A;  2BEQ D;  3NMD A;  1KMI Z;  2KIK A;  2BEZ F;  3KZI H;  3CX5 E;  3MIW A;  1USE A;  3E1I A;  1ZR2 A;  4O9B A;  2POH A;  4RES B;  1EC5 A;  5KLV J;  1RE3 B;  1PIX A;  3L70 E;  1X9V A;  1NAY A;  1GU4 A;  2OYH C;  2FFD A;  2XNX A;  1M56 D;  2W6A A;  5APV A;  1IFM A;  3BAT A;  3Q3D A;  4TT3 H;  1T3J A;  2O01 H;  3M0D A;  1JCC A;  5KLV G;  1NTK J;  3M0A A;  2QEX P;  3T97 B;  2P10 A;  3F5H A;  2QJK C;  1LP1 B;  1FZA A;  1RF1 A;  4WY4 C;  3CME P;  1IFP A;  4EOT A;  1SQP E;  4OGQ B;  3V2Q A;  2OGU A;  3AE5 C;  1ZV8 A;  5KAF H;  4BWN A;  3H32 C;  2E76 B;  3PHL A;  1Z3U A;  5CHX A;  1L2P A;  1PP9 G;  1E5W A;  3CI9 A;  1KYO E;  1MFT A;  4UB8 H;  3VMZ A;  1S5L H;  2YO3 A;  1EZV G;  4XFJ A;  2XKM A;  1OVR A;  3JCU E;  3H1I E;  1NTM J;  1DEE G;  2FYU K;  1RQU A;  1A02 F;  3PRJ A;  2Y9Z A;  1DD3 A;  1GZL A;  1YQ3 C;  2WT7 A;  2YMY A;  4UB6 E;  4GIF A;  2WSC J;  2PGD A;  4IL6 X;  1FIC A;  3L73 J;  3W68 A;  2FYZ A;  1Q90 D;  1NTM G;  1L0L G;  3BVH A;  2AXC A;  2FFD B;  3H1H G;  4GT1 A;  5CMZ A;  5KJ7 A;  3I56 P;  2I8D A;  3HUS A;  2Z4E A;  1YTZ T;  1KB9 D;  5GTH H;  3RL0 g;  2V4H A;  1SQV E;  2IBZ E;  1KB9 H;  2ZXX A;  5CJ4 A;  3CWB E;  4JPZ B;  3AEB C;  4H44 D;  1QVG O;  5GTI H;  3PP5 A;  3BRT B;  3N7N A;  4HH2 A;  3LW5 J;  3A0H E;  4M7F A;  3HE4 A;  5DJU B;  1FJP A;  4R9J A;  2Q7C A;  1P84 I;  4D6T D;  1VL2 A;  1K8A Q;  1N73 A;  1FDI A;  1FZF A;  1NTZ D;  1R8E A;  4H44 C;  3Q1M A;  1L0N J;  3P8C E;  1FZG B;  1L4A C;  1N7S A;  1KQL A;  4DT0 A;  1RF0 A;  2W8Z A;  4IFM A;  2NPS C;  2E75 B;  3RBX A;  1T6A A;  4IFF A;  1X0T A;  1J1D B;  4N78 D;  1EZV I;  2WSF H;  2L5G B;  1EXJ A;  3B5N D;  2WZ7 A;  2H8P D;  1H88 A;  3L37 A;  1FZD A;  1FC2 C;  3K5B A;  2AXT E;  2BCC J;  2IDB A;  2J5Z A;  5L8R J;  2C0W A;  3QWO C;  2JHK F;  1IK7 A;  4C7N A;  3L74 J;  3AEE C;  3CCS P;  1BE3 E;  2P2U A;  2O1K A;  3L75 G;  1FZE A;  2A06 E;  1IC2 A;  2K3R A;  4NPF X;  2J64 A;  2I1K A;  3CCQ P;  3HUS B;  1UII A;  2N9Y B;  2H43 A;  3SFE C;  4PJ0 H;  4BRY B;  1AQ5 A;  1OVV A;  5KJ7 D;  1Q86 Q;  3L74 G;  4H0L D;  3L71 D;  3WUV A;  3TK1 A;  4YPC A;  1GW4 A;  2KLU A;  3PTZ A;  3FIB A;  1SFC A;  3M9B A;  2CPS A;  4H13 B;  4A7P A;  2M3E A;  1IK9 A;  1N73 B;  3IF4 A;  1VQL P;  4R9T A;  3L72 D;  5AVU B;  1FOS E;  1RF0 B;  2Y9Y A;  4ASV A;  1ZLL A;  2FYU E;  3HD7 B;  2QM8 A;  2D2C B;  1FBM A;  2Y0C A;  1SP4 A;  1N7S D;  2QM7 A;  4PV1 B;  4I1L A;  3B4S A;  3V5B A;  1JY2 N;  2HPC C;  2OAR A;  5KLI C;  2V7Q J;  2R5B A;  1LWU A;  3LIE A;  1SQX K;  2K9Y A;  3RL0 B;  1Q82 Q;  3C1L A;  2WPS A;  1P84 D;  3CXH E;  1N86 C;  1NTK D;  3OAK A;  1LTA C;  1OW7 A;  2OYI C;  2WQY C;  3FWN A;  2KNC A;  2ZT9 C;  1FZE B;  2JHI F;  1SQQ D;  2HOD A;  2H43 B;  2IZ0 A;  5TIS H;  1M1J C;  1JMM A;  2GUV A;  1U7M A;  1LT9 B;  1BCC E;  1GD2 E;  2HLO C;  1BSN A;  2PFX A;  1OIP A;  1SQP K;  3RK2 B;  2OYH A;  3H1J E;  1DH3 A;  2J59 M;  1KIL B;  1K9M Q;  1S9K E;  2RH0 A;  2KLV A;  1EQ7 A;  2W83 C;  4HB1 A;  2O3J A;  2IZ1 A;  3C9I A;  2JEE A;  4KHX A;  1AA0 A;  2CPB A;  1AFO A;  1PPJ G;  2N1T B;  1SFC D;  5CBN A;  1H8A A;  5C39 A;  1MFZ A;  1CI6 B;  1NWQ A;  2J3O A;  1VQ6 P;  2FXP A;  1D7M A;  4ZNC A;  3H1L E;  3L73 D;  1IJD B;  4WY4 A;  2RKL A;  1BSH A;  2J5U A;  4D6T G;  2QSI A;  3H32 A;  1VF5 D;  2B9B A;  1NTZ G;  2E74 C;  1T2K D;  1LWU B;  1Q81 Q;  3Q5R A;  1BDD A;  1VDF A;  3AE3 C;  4Y28 J;  1ZXG A;  3TF5 A;  4YXW H;  2P7J A;  1JNM A;  1PGO A;  1H89 A;  1GK4 A;  3NFQ A;  2FBW C;  1KQG B;  1PV3 A;  3BCC E;  3SFD C;  1SQB J;  2B87 B;  3U1A A;  2K37 A;  2XND H;  2KNC B;  2KUB A;  2XU6 A;  1GMJ A;  1YJ9 P;  1URQ C;  1FIB A;  3G6E P;  1NU1 E;  5AW0 B;  3MUD A;  2HOD B;  1NVO A;  5APW A;  2GM4 A;  2E43 A;  2Y0E A;  3AED C;  1SS1 A;  1T3U A;  4LGD E;  1FZB B;  1R5L A;  3H1K E;  1KN7 A;  1EDK A;  4M3L A;  2ZJS E;  2OYO A;  5AW1 B;  2YKQ A;  3BAS A;  1L0N D;  2J3U A;  5KKZ B;  2I1J A;  2W6J H;  1K04 A;  1HJB A;  4RO0 A;  1JY3 P;  1YIT P;  1KB9 I;  2HFE D;  2QJP C;  1BGY E;  3HTK B;  2AEJ A;  2PAJ A;  3C8V A;  3L35 A;  1ZRT E;  3L71 G;  1RE4 A;  3MZW B;  5APY A;  1KQF B;  2WSE H;  3M06 A;  4PD4 D;  1VQ9 P;  2SPZ A;  2BCC D;  1SQX E;  4JQ0 D;  2OTL P;  4PD4 H;  1IZN B;  1W2E A;  2J0G A;  1LTI C;  4Y99 B;  2FYN C;  2E5T A;  3WU2 H;  3L74 D;  1K73 Q;  3OA7 A;  3AEF C;  2KXP B;  3L72 G;  1G2C B;  2ZVN B;  3O6Q A;  2IYP A;  4WY4 D;  1SQP J;  1GL2 C;  1L4A A;  1EDJ A;  1J2J B;  5CBO A;  5AVY B;  1NOH A;  3GHG A; 
#chains in the Genus database with same CATH homology
 1SQB K;  5CCH A;  3N7N A;  2H43 C;  3V2N A;  5AW4 B;  4HH2 A;  3BVH C;  2KYV A;  5CCH D;  2JJL A;  4M7F A;  3HE4 A;  2XZR A;  1LT9 C;  1FJP A;  1WT6 A;  4WB4 A;  2KP8 A;  5KJ7 C;  1M1J B;  3MGN A;  3I5C A;  4R9J A;  2N1T A;  2Q7C A;  2Z4E C;  2N1T D;  1RE3 A;  1MZ9 A;  4N6J A;  4XE5 B;  2WNP F;  2D39 A;  2IFN A;  2HLO B;  5APQ A;  1CI6 A;  3RK2 C;  1N73 A;  4JYO X;  1OXZ A;  5AVQ B;  3P8C D;  1FZF A;  2Q9I C;  1KIL C;  3P8C E;  2R5D A;  1FZG B;  1L4A C;  1N7S A;  1FZC A;  1KQL A;  4ZFG A;  1RF0 A;  4IFM A;  2J3F A;  2J3F D;  2NPS C;  5CCH C;  2P1J A;  2WTY A;  1XTC C;  5APS A;  1HGZ A;  2A45 H;  2GY7 A;  4IFF A;  3RK3 D;  1NTM K;  1L0L K;  1J1D B;  1X79 B;  2N1T C;  4N78 D;  5BU5 A;  3L36 A;  1RE3 C;  3TNU A;  4N78 E;  2IPP A;  2WSF H;  1JC9 A;  3T97 A;  5BU8 B;  2L5G B;  1IO4 A;  3B5N A;  3B5N D;  1NKZ B;  1DEB A;  2WZ7 A;  2H8P D;  2WWW A;  1FZF C;  3HRN A;  1H88 A;  1KFM A;  1N7S C;  1LTJ B;  2M3B A;  5AVS B;  2OYH B;  4EPU A;  3L37 A;  1FZD A;  3VMX A;  1CZQ A;  3EQ2 A;  4W7Z A;  3TYY A;  2Q5U A;  3U1C A;  1RE4 B;  1J1E B;  5AW2 B;  2J5Z A;  3L4F A;  2E42 A;  2C0W A;  2W27 A;  3RK3 C;  1LWU C;  2JHK F;  3MD0 A;  4C7N A;  2FIB A;  3KDP B;  2P2U A;  2O1K A;  3E1I B;  5CCG A;  1FZE A;  1FZB A;  1IC2 A;  4AUW A;  2J64 A;  1GL2 D;  2I1K A;  3BRV B;  3HUS B;  1FID A;  3M9H A;  1XTG B;  2J2P A;  1LTB C;  3M91 A;  2H43 A;  2VRS A;  2N9B A;  2O1J A;  4WY4 B;  2XNX B;  1YTZ I;  2YKO A;  2Q9I B;  1IFN A;  3A2A A;  2R3C A;  1AQ5 A;  5KJ7 D;  1NO4 A;  3A3Y B;  1URQ B;  1IFI A;  1WRG A;  3H32 B;  3A5T A;  4C7R A;  2HOD C;  3IR9 A;  3GHG B;  4LC1 A;  1NTK K;  1Z56 A;  2IFM A;  3KQG A;  3HTK A;  3TK1 A;  1VPC A;  1KZU B;  1GW4 A;  1JTH B;  5CCG C;  3RK2 D;  1JOC A;  3VOP A;  1OWA A;  3II6 A;  5AW6 B;  3O8Z A;  1FZB C;  3FIB A;  2IX7 C;  1KIL D;  1SFC A;  3M9B A;  1HUC A;  2CPS A;  1L4A D;  5AVZ B;  4JZC A;  3WMM 0;  1HWT C;  2C9N Y;  2HPC A;  1FZA B;  1SQQ K;  2NPS A;  4ZKP A;  2GUS A;  2NPS D;  1L0N K;  1IK9 A;  1N73 B;  1RF1 B;  5APT A;  4R9T A;  3HE5 A;  3NXS A;  2R32 A;  2JHL F;  1JY2 O;  2KOG A;  4W80 A;  5AVU B;  1FZC B;  2WSC H;  3EFG A;  3KPE A;  2J3G A;  2J0Y A;  1FOS E;  1RF0 B;  2Z5I A;  1ZLL A;  3V4Q A;  2J1G A;  1HGV A;  1GW3 A;  3HD7 B;  2QM8 A;  1G2C A;  1FBM A;  5KTB A;  1QL1 A;  1SP4 A;  1SFC C;  2OYI A;  1HBW A;  4NYT A;  1N7S D;  2QM7 A;  2HG5 D;  4I1L A;  3V5B A;  1JY2 N;  2HPC C;  2YNY A;  3A7O A;  2J0H A;  2J61 B;  3B5N B;  4B86 A;  2OAR A;  2R5B A;  3VMY A;  2FFD C;  1LWU A;  3LIE A;  1G1J A;  1SQX K;  1DX7 A;  1JY2 P;  3RL0 B;  1M1J A;  2W6B A;  4XA4 A;  4Y99 C;  4EIJ A;  3P8M C;  2WPS A;  3N4X A;  1HVV A;  2J60 A;  1ZR4 A;  1JCD A;  1N86 C;  1NAF A;  5AW8 B;  3OAK A;  1NHL A;  4C46 A;  1SQV K;  1T2K C;  1LTA C;  3VYI A;  2WT7 B;  3LW5 H;  3M9Q A;  2OYI C;  4W7Y A;  2ZXE B;  1FZG A;  3NTN A;  4AQR D;  1FDM A;  1FZE B;  2WIT A;  1GDT A;  1GL2 B;  4JYB A;  2JHI F;  2HOD A;  1LTT C;  2C9L Y;  3P32 A;  2H43 B;  3BVH B;  3P7K A;  1M1J C;  1JMM A;  2GUV A;  1LT9 B;  5AVT B;  3IFM A;  5CCG D;  5AW7 B;  1GD2 E;  2LKM A;  2HLO C;  4DZO A;  2HYN A;  2Z4E B;  2J58 A;  2Q3I A;  1CW5 A;  1QL2 A;  3VTP C;  1Z3S A;  1SQP K;  3RK2 B;  4JYC A;  1NTZ K;  2FKW B;  1FZG C;  1LTJ A;  2OYH A;  2BAS A;  5AW3 B;  1DH3 A;  2J59 M;  3LID A;  1KIL B;  2JHH C;  1NU1 K;  1L4A B;  1S9K D;  3VP9 A;  4HYT B;  3V2R A;  1M7L A;  1LGH B;  1S9K E;  2KLV A;  1EQ7 A;  4M7H A;  1MUU A;  2NPS B;  3NMD A;  3OJA B;  1PFI A;  3U59 A;  3UIA A;  2FXM A;  2JEE A;  3C9I A;  4KHX A;  5CJ0 A;  3HE4 B;  1A02 J;  3MIW A;  1J1D C;  2CPB A;  3MTU E;  3E1I A;  1HH0 A;  1ZR2 A;  1AFO A;  2C0X A;  4O9B A;  2POH A;  4RES B;  2N1T B;  1SFC D;  1HTL C;  1H8A A;  1KFN A;  1RE3 B;  1MFZ A;  3VN0 A;  2WPR A;  1X9V A;  1CI6 B;  1GTW A;  1GU4 A;  3V2P A;  1NWQ A;  2J3O A;  1LTJ C;  2OYH C;  1FZF B;  2FFD A;  2H7H A;  1N7L A;  1IJD B;  4WY4 A;  3TSI A;  2XNX A;  1N7S B;  1FAV A;  1RE4 C;  2W6A A;  1J1E C;  2YO2 A;  5BVZ A;  5APV A;  1URQ A;  1IFM A;  3H32 A;  5AVR B;  3BAT A;  1T3J A;  2O01 H;  1N86 A;  3M0D A;  3CL3 D;  1JCC A;  3RK3 B;  1LWU B;  1T2K D;  3E1I C;  1JTH A;  3B8E B;  1VDF A;  3M0A A;  2A45 G;  3TNU B;  2P7J A;  1JNM A;  4OH8 B;  3HUS C;  1H89 A;  1GK4 A;  3NFQ A;  1GU5 A;  1GK6 A;  1FZA A;  5AW5 B;  1CSB A;  5AVW B;  1LTG C;  1RF1 A;  4WY4 C;  3VP8 A;  4LLH A;  2XNX C;  2Z5H A;  3U1A A;  3CLQ A;  3KYQ A;  4EOT A;  3V2Q A;  1FJK A;  1ZV8 A;  2PP6 A;  2XU6 A;  5APX A;  1URQ C;  1FIB A;  2M8R A;  5APU A;  2MJZ A;  3H32 C;  5AW0 B;  1JUN A;  3GHG C;  2HLO A;  4WBA A;  1JY3 O;  3MUD A;  3M0D C;  1Z3U A;  5CHX A;  1G1I A;  2HOD B;  5APW A;  3H6P A;  3SWF A;  2GM4 A;  2E43 A;  4C7N B;  3HD7 A;  1E5W A;  3HD7 D;  2KB7 P;  3CI9 A;  1T3U A;  4LGD E;  1FZB B;  1FU1 A;  1NH4 A;  4IFD K;  1FZA C;  4M3L A;  5AVX B;  3VMZ A;  2J61 A;  5AW1 B;  2YKQ A;  1N73 C;  1RF1 C;  3BAS A;  1JY3 N;  2J3U A;  4I6M C;  2YO3 A;  1FZC C;  2I1J A;  2XKM A;  1RF0 C;  1NKN A;  4GKG A;  1HJB A;  3RL0 D;  1X8Y A;  1FOS F;  4N3Y B;  1JY3 P;  2HFE D;  2FYU K;  2XDJ A;  3G3Z A;  1A02 F;  1GZL A;  2YKP A;  3HD7 C;  2KSJ A;  3HTK B;  2WT7 A;  2YMY A;  2PAJ A;  4GIF A;  3SWY A;  5KLV K;  1FIC A;  3L35 A;  1MV8 A;  1ZN5 A;  4AYC A;  1SFC B;  1RE4 A;  1GL2 A;  2WPQ A;  3B5N C;  2P67 A;  5APY A;  2HPC B;  2FYZ A;  2WSE H;  2XV5 A;  3M06 A;  3BVH A;  3HE5 B;  3RL0 C;  2FFD B;  1LT9 A;  4DOJ A;  5AVV B;  4GT1 A;  1RY3 A;  1T8Z A;  5CMZ A;  5KJ7 A;  2JHM F;  1W2E A;  2J0G A;  3V4W A;  1IFJ A;  1LTI C;  4Y99 B;  1YYC A;  3HUS A;  2Z4E A;  1YTZ T;  1N2D C;  4ZKU A;  3OA7 A;  1N86 B;  1JO5 A;  1G2C B;  4I2L C;  5AW9 B;  1SVF A;  2Q9I A;  4WY4 D;  5CJ4 A;  2OYI B;  1FZE C;  1KIL A;  4JF7 A;  1LTS C;  1GL2 C;  1L4A A;  3R2P A;  1J2J B;  2A45 I;  5AVY B;  1NOH A;  1SLQ A;  1IFD A;  1URQ D;  2ZFC A;  3PP5 A;  3GHG A;  3BRT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...