1RF0C

Crystal structure of fragment d of gammae132a fibrinogen
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLAAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 85
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf0C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf0C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf0C03
1RF1B 2J1GA 1FZBC 2HPCC 1FZGC 2Z4EC 2H43C 1Z3SA 1N73A 4EPUA 2JHKF 2Q9IB 1JC9A 1FZEB 1FZFB 2J61B 4JYOX 4NYTA 1RE3A 3GHGA 1Z3UA 1N86C 3FIBA 1LWUA 2A45G 3GHGB 1RE3B 2JHHC 2J3GA 2FFDC 2OYHB 1FZEA 1RE4B 2FIBA 2Q9IA 1N86A 2J0YA 1T3UA 2OYIB 2Z4EA 1M1JB 1W2EA 1RF1A 1LWUB 1FZAC 2GY7A 1RF0C 3BVHB 1N73C 3E1IC 2JHIF 2H43A 2XNXA 2HLOB 2HODC 4R9JA 1LT9B 3BVHA 3H32B 1FZCA 1M1JA 4M7FA 2Z4EB 2OYIA 2J3UA 1FZCB 1FIDA 1LTJC 3H32A 3HUSC 1JY2P 2J0HA 1JY3P 1FZAA 2J2PA 1RF1C 1FZFC 2OYHA 2J3FD 1FIBA 1FICA 2HLOA 2XNXB 2H43B 4ZFGA 2FFDB 3E1IA 1RE4C 2D39A 2Q9IC 1FZBB 2HPCB 1FZGB 2JHLF 2J0GA 2J61A 2JHMF 1LWUC 2J60A 1N86B 2J3FA 1RE4A 1FZEC 2FFDA 2HLOC 4JZCA 2J5ZA 2J64A 2OYHC 1RF0B 3HUSA 1RE3C 3GHGC 4R9TA 2HODB 1FZGA 2HPCA 1FZCC 1FZBA 1LTJB 1FZFA 2J3OA 2A45H 1FZDA 3BVHC 1LT9A 2A45I 1N73B 1LTJA 3E1IB 3H32C 4M7HA 2HODA 1JY3N 2WNPF 2OYIC 2XNXC 1JY2N 1M1JC 1JY2O 3HUSB 1JY3O 1LT9C 1FZAB 1RF0A
chains in the Genus database with same CATH superfamily
1VF5B 2OYOA 2WPRA 1FDOA 3G3ZA 2C9NY 3GG2A 3GHGA 3G71P 1N86C 2WT7B 3FIBA 3ABVC 2Z5IA 2FXPA 3NTNA 4PJ0H 3H1IJ 3BCCG 4IFFA 1VQLP 3AEDC 3SFEC 3A5TA 2ZT9B 4RJTA 4XA4A 1FZAC 1RF0C 2XV5A 3USSA 3CCQP 5GTIH 3SWFA 4H0LC 3VMZA 2K37A 4WVZA 1SQVE 1VDFA 3VYIA 1NTME 2A06G 3AEFC 4OGQC 3R4YA 4U7JA 3VOPA 4YXDC 2XNXB 2JKVA 4IL6E 3RBXA 2QVAA 3B8EB 1SQBE 1SQPJ 1KB9I 1Z56A 2J3FA 2K3RA 1RH5B 1KC8Q 1NTZG 2O3JA 3F5HA 2Q7CA 1M57D 1SQPE 5CMZA 1H8AA 1CW5A 3BVHC 1LT9A 1VL2A 3H1HD 4PJ0E 5CCGD 5CJ4A 3JSVC 4ZNCA 2FXMA 2WSCJ 2ZXXA 1FZFB 4JYOX 2KS1A 1LP1B 2GM4A 2BEZF 3AE7C 1GL2A 1PPJD 3CL3D 1VQ4P 4JQ0D 1YQ3C 1JOCA 1OVRA 3E1RA 4I2LC 1VQPP 5BU5A 1KD1Q 3EFFK 3CCLP 1H89A 1SQQK 1WT6A 1IZNB 1EQ7A 1L0LE 1GL2B 1XTGB 1BCCE 5APXA 5AW1B 1GU4A 5APUA 1HF9A 3A0BH 5K5GB 2YXQB 4GOFA 4PV1B 1RQUA 5CBNA 4YXWH 4ZFGA 3KZIH 4ZKPA 3OJAB 1J1DB 4DZOA 3WUTA 2YO3A 1ZV8A 2IZ1A 3WUUA 3L75G 2J61A 2J60A 4BRYB 1NTKG 3MTUE 1U57A 1IC2A 2C9LY 1SQQJ 2N1TB 3ITKA 1AA0A 1Y9BA 1VPCA 3CX5E 1WMKA 1FZBA 1PGPA 1M8OB 1OWAA 1EC5A 2O1KA 2FYNC 3CX5I 3L73G 2IPPA 3H1JG 3PJSK 3H1LD 3L72G 1PZQA 4NYTA 3CC2P 2QJPC 4OGQB 2KIKA 5B5EH 2FBWC 2FFDC 2E75C 5H2FE 2LR2A 2XU6A 2J0YA 1KILD 3JC22 1T3UA 3L71J 3RK2D 4LGDE 3H1KD 3QWOC 3TGUD 1L0NK 1IK9A 1FJKA 5KLIB 3AE6C 4R9JA 2Q3IA 3VMYA 3VN0A 4Z1MH 2M5AA 2Q6QA 3HRNA 3QH9A 2FYUG 1FE6A 2W90A 5AW9B 2KOGA 1HTLC 1FZAA 4ASWA 3U1AA 4EIJA 3L74E 2P67A 3TF5A 1NOHA 2IBZG 3CC4P 1PL5A 2E5YA 2R32A 1Y8AA 2Q1KA 2POHA 1MKMA 4D6TJ 1L0LD 5KLIC 4WY4C 5AW6B 1ZW0A 1BCCD 1GK6A 2W6BA 1OZHA 1SVFA 1YBKA 3L71E 2A45I 1P84E 4R4LA 1JB0J 2QJYC 3H1ID 4L76A 3A0HH 3B5ND 1YJ9P 5KLVE 1FZBC 4IFDK 4A7PA 1Z3SA 1G1JA 1FDMA 3R2PA 1AVYA 1ZXGA 2O01H 2C0WA 3MIWA 4TLFA 2Q3EA 1DD4A 3BATA 1J2JB 2YMYA 3CWBJ 2YKQA 1E5WA 2E5TA 3K5BA 1LP1A 2Y9ZA 1NTZE 2KYVA 3TGUG 2UWJE 3V2RA 1PP9G 1IFPA 3L70E 4R4MA 1SFCD 1NTZJ 2ZYGA 1NTMD 1BE3E 2H43A 4Y99C 1AFOA 3P8CE 3L70J 2IFNA 1LT9B 5AW3B 2I1JA 2JWAA 1N7SA 2ZXEB 3V2PA 3L37A 3H1JJ 2G3AA 1KQFB 3F89A 2O01N 1RF1C 3LW5H 1RE4C 2WZ7A 1QL2A 2NPSC 2H8PD 4H13C 5AVSB 1SQVD 4NPFX 3KQGA 1BDDA 4ZKUA 4Y99B 3TGUE 1YHQP 4GDOA 2OTKE 1L4AD 1SQVK 3H1IG 3B5NC 1RHZB 2JP3A 1NTKJ 1FZFA 1L0LJ 4N6JA 2WSSH 4PD4D 1N73B 1T3JA 2K88A 1OFCX 5AVUB 1AVOA 3Q5SA 2LXBA 5DJTB 4D6TD 3MZWB 3RK2B 5APTA 5KJ7D 3P8MC 2OTLP 2N9YB 1ZR2A 3HD7B 3V6IA 1VQ6P 3HE5B 1LT1A 1KFMA 1H0TA 3GHGB 2JHHC 2WPQA 1L0ND 2M8RA 2JDIH 1KYOI 3L75E 1AJYA 1RY3A 1PGJA 2QRXA 3L70G 3CPWO 1FJPA 3H1KE 3L73D 1GDTA 2XNXA 5APQA 2QM8A 1SQVG 2B88A 2FKWB 3RL0C 1JCCA 2FYZA 5E79H 2J3UA 2IX7C 1KB9E 1SQBK 2J2PA 1VF5D 1NTKK 3WMM0 3CXHH 2ZFCA 2R3CA 1EDJA 1NTZD 1FZBB 1PPJE 3G6EP 3Q5PA 1K73Q 1OIPA 3H1JE 5AW7B 3Q1MA 1TU3F 1OVVA 1IFDA 1EZVE 2KSEA 5AW4B 2OYHC 1ZRTD 2PRRA 5CCHA 2PGDA 2FYUD 2K9YA 1GD2E 3IFMA 2QE7H 3W68A 1X22A 1FZDA 1SQPG 3H32C 4HJGH 2LKMA 1JY3O 1CI6A 2QA4P 5KLVG 2N1TA 2H43C 3KDPB 3CMEP 2OTJP 1FOSE 1M1KQ 2KZIA 3HTKA 2W6AA 3LW5J 1HJBA 3BRVB 1A02J 1R5SA 1GMJA 2YNYA 2CPSA 3D70A 3TDKA 2W6JH 1Y47A 1SQXD 2RMZA 4JBZA 3RK3D 4EYYQ 1AV1A 2KS1B 3P8CD 2HODC 2KLVA 2YKOA 1W5CE 1SQXK 3SSUA 3V4WA 2H88C 1M1JA 3L74D 4TT3H 1L0NJ 2P7JA 3D71A 2QJKC 1S5LX 2R3SA 2L91A 3C8VA 1YJWP 1JM0A 1E79H 1HWTC 2H43B 1QVFO 2BCCE 3M91A 5L8RJ 1JMMA 3LIDA 1VF5C 1URQC 4WY4A 2P1JA 4PD4I 2WSEH 2ZT9C 5CCGC 2J5ZA 2J64A 5TJHA 5GTHE 3L4FA 3N4XA 3H1IE 2AXTE 4PD4E 5KLVD 5KJ7A 4JYBA 1KB9D 2M3EA 4EDFA 2OYIC 2XZRA 3TGUJ 2A06D 5TISH 1LJ2A 3O6QB 1NAYA 4IFMA 4H0LB 3CWBG 2O1JA 4U3FD 4EPUA 1MV8A 1XTCC 5CCHC 1ZLLA 4N78E 1NU1G 3PTZA 2B9BA 5DJUB 2D2CD 1G1IA 1L0NE 1HGVA 1YTZI 4I7ZB 2E43A 2E74C 1FZEA 1SFCC 2KUBA 1DD3A 1Q7YQ 2OYIB 1UIXA 3H6PA 2KXPB 1ZN5A 2KNCA 2WT7A 1YTZT 1HGZA 4H44C 4HYTB 4HKZH 3WU2H 1KV4A 3Q2YA 4WB4A 3B5NA 2AXTH 2J58A 1GK4A 1YI2P 3L74J 1BE3D 2JHLF 3NMDA 3U1CA 3CCVP 1N86B 1X8YA 1JMBA 4H44B 4JF7A 2ZYDA 2GUVA 4AQRD 4LC1A 4IOIH 1YIJP 2ZVNB 1LTTC 5AVYB 3S1KA 3NXSA 1NU1D 2WPSA 3MD0A 2KZJA 4M7HA 1SQQD 1JY3N 3CLQA 1NYHA 1N7SC 3L74G 3H1HJ 1Q81Q 4MN4C 1N2DC 2ZVOB 1ZMEC 5CHXA 5AVRB 2RN0A 3A2AA 3B71A 2JHKF 1IFJA 1P84I 1S5LE 1H88A 2W27A 3L75D 5B66E 3AE1C 3A0BE 2HYNA 1VQMP 1NKZB 1URQB 1BCCG 3TNUB 3VP9A 1M90Q 3FWNA 1BE3G 3Q5RA 3BCCJ 2YMKA 2FY8A 2WTYA 4RKUJ 5CCGA 2M3BA 2R5BA 3BRTB 1BSNA 1HUCA 2QIWA 3N7NA 5KTBA 3II6A 2WSEJ 1LWUC 1YQ4C 1FU1A 2WMMA 1L0LK 2QG4A 1JNMA 2Y9YA 4UB6E 3CCMP 3AE2C 1SQBJ 1RE3C 1VQOP 3AEAC 2A45H 2W83C 1L4AB 1QX8A 3M06A 1JY2N 1KMIZ 3HUSB 4EOTA 1NHLA 2I1KA 2J1GA 2JEEA 3A7OA 1EZVD 5BU8B 2ZYAA 3U59A 1KZUB 2V7QJ 4N78D 1BGYG 1D7MA 1RE3A 1VQ5P 2Y0CA 1SQXE 1PGOA 2KK7A 2FIBA 3KYQA 4YPCA 1ZRTE 2DW3A 1IFIA 1CSBA 3IR9A 2N1TC 1SQQE 1GL2D 5CCHD 4WY4D 2Z4EB 1RQVA 5CJ0A 4K35A 2P2UA 2OYHA 2VRSA 2E74D 4GT1A 2QJYB 5KLVJ 3E1IA 4ZMDA 1U7JA 1FDIA 2K1AA 4UB8E 5AW0B 1OW8A 2QJPB 2RH0A 1IK7A 1M56D 1KB9H 2HLOC 1NKNA 1PP9J 2FXOA 5AVXB 2P10A 1S9KE 3RL0B 3HE5A 1OW6A 2ZT9D 1VQNP 3MUDC 2QEXP 1EDKA 3RK3E 5APSA 4N3YB 1FOSF 2PFXA 3M9HA 1S1CX 4U3FE 1RF1B 2HPCC 1FZGC 4GKGA 2Z4EC 1URQD 2WITA 1BGYJ 1JC9A 3NFQA 1SLQA 5AVQB 3H1HE 1MZ9A 1Z3UA 1P84D 2IFMA 3AE8C 2XDJA 1QEXA 3V4QA 1MFTA 1KILB 4JYCA 4YTPC 2IYOA 2OQQA 3L36A 4CPGA 2ZAEB 1PV3A 1LWUB 2SPZA 4D6TG 2IYPA 3T97A 1T2KD 1X0TA 1S5LH 3KXDA 4WBAA 3P32A 2YXRB 1NTMG 2A06E 2IZ0A 1LTSC 5B66H 1DX7A 4H13D 2AEJA 3VP8A 2J3FD 1NU1J 1R5LA 3HD7C 1MFZA 3MUDA 3V5BA 2FYUE 2D39A 3CCUP 4OGQD 4M3LA 3TNUA 1URQA 2QSIA 3H1LJ 4PD4H 1RE4A 1SFCA 1FZEC 3SFDC 2IBZE 1JCDA 2ITAA 4OWFA 1OX3A 2B89A 3L35A 2QJKB 2IDBA 3LIEA 3HE4A 3GW6A 1J1EB 1LT9C 3L72J 1A02F 1HBWA 2RKLA 3EQ2A 2KI7B 3I56P 1HH0A 1VQ7P 1IJDB 2N9BA 3BCCD 1KQSO 3P7KA 1P84H 1T6AA 3VTPC 4H13B 1SP4A 4XFJA 1N86A 1NTZK 1KQLA 2W8ZA 5M1BA 4W7YA 3ZDMA 1FS0E 3CXHE 1YITP 1H0TB 4O9BA 3BVHB 1EZVG 2JHIF 1NWQA 3JCUH 1SQPK 1PP9E 3KPEA 3H1LG 2R44A 1S3JA 1LGHB 2WWWA 2Y0DA 3AEBC 3G9RA 2M5AB 4AYCA 2J0HA 3E7KA 1EXIA 3B4SA 2HFED 3RBZA 1JY3P 1LTGC 3O8ZA 1WRGA 4RESB 1DEEG 3CCEP 2E42A 3WU2E 2HPCB 1FZGB 1Q90D 4H0LD 2H7HA 1USEA 2N1TD 1VQ9P 2E74B 2GA1A 1SQXG 1JTHB 2YIUC 2J3OA 3VMAA 3EFGA 1NVOA 3T97B 2XNXC 3O6QA 4DJGA 1AQ5A 3HE4B 3M0AA 2AXCA 3FGAD 4K3AA 4NPEA 2IBZD 1G2CB 2A45G 5BVZA 1N7LA 1K8AQ 1LTBC 1X79B 2OGUA 5C39A 1QGKB 3PLNA 3D6YA 1SQVJ 1LTAC 1N7SB 5APVA 1JUNA 2WSCH 3CMAP 5KAFE 2B87A 1NH4A 3IAOA 2Z5HA 3H32B 4HH2A 4I6MC 3GF3A 4M7FA 1NJIQ 5KKZC 1IFMA 4Y28J 1LTJC 1KFNA 3WUVA 3CWBD 1FICA 1NU1E 3A0HE 5TISE 2NPSA 3Q3DA 2J0GA 3FWLA 2E75B 1L0NG 1ZOYC 1ZP0C 2FFDA 1GW4A 1R8EA 1RF0B 2PAJA 3HTKB 2PP6A 1L0LG 1X9VA 4I7ZC 4D6TE 4HB1A 1NU1K 2HPCA 1FZGA 1LTJB 1DIPA 3KZIE 1OMIA 2BCCD 3GMAA 3TSIA 3W67A 1VQKP 1KORA 1Q2NA 5KKZB 4IL6X 1CZQA 1S9KD 1K05A 4U3FJ 1MUUA 1J1DC 4C7NA 2KNCB 1NAFA 3L72E 1RE3B 5KAFH 2J3GA 2MKVA 2BEQD 1K04A 1L4AC 1SQBG 4KT0J 1W2EA 4GOEA 4AUWA 1YYCA 1OXZA 3H1KJ 3OAKA 1PP9D 3BVHA 2JWDA 4GODA 1KYOE 1NGMB 2OYIA 4I1LA 4ASVA 4L75A 1FIDA 3TYYA 3L73E 2Y0EA 1FZFC 3M0DC 2BCCG 2FFDB 1NTMK 4WWIA 3HD7D 4DCKA 1QVGO 1BE3J 4C46A 2D2CB 1BCCJ 4OVNF 1SFCB 4IL6H 4H44D 4BRYA 1GL2C 3H1KG 1GU5A 4KJMA 4PV1D 3PRJA 4R9TA 2K9JB 2WSFJ 1SQXJ 2J5UA 1KQGB 2XNDH 1M1JC 1EZVI 4PV1C 2YO2A 2XKMA 1EDIA 2CPBA 5GTHH 3G4SP 3CX5D 3C9IA 1N73A 3OA7A 2J61B 4WY4B 2H89C 2GUSA 1KYOH 2AEMA 2LXCB 2HG5D 1LWUA 3RL0g 2FYUJ 3PHLA 1N8RQ 1PPJG 1PIXA 1VQ8P 2D2CC 3SWYA 5AW8B 1M1JB 5EFWB 1PGQA 3UIAA 4QMAA 1PFIA 2GY7A 1N73C 3RL0D 3E1IC 2WPVB 1Q86Q 2WSFH 5APWA 4XE5B 2M0BA 2BASA 4EI2A 1HVVA 4GIFA 3AEEC 1KILA 3S9OA 3H32A 5APYA 3H25A 3CWBE 1FIBA 3M9BA 1LTIC 4KHXA 3CXHD 3L72D 2FYNB 3BCCE 1FC2C 1K9MQ 2I8DA 1T2KC 1SQBD 3AEGC 4L74A 3I5CA 1AQTA 1CI6B 2HR3A 5KAIE 1NTKD 3RK3C 3BASA 4DOJA 2AEFA 1S2EA 2R5DA 1DH3A 2Q5UA 3GF7A 1IO4A 5AVTB 1FAVA 2NRGA 2K9JA 3E1IB 2IBZI 2WNPF 2KSJA 5AW5B 3M9QA 4BXLA 2JO1A 4L73A 1EDLA 2J59M 3AE9C 3PH0A 3C1LA 3CX5H 3KHUA 1M7LA 5AVWB 2CK3H 2FYUK 2Q9IB 1FZEB 5GTIE 3A3YB 1NO4A 4LLHA 1U7MA 1GZLA 1BGYD 2OYHB 1OVUA 2Q9IA 1BSHA 1S4XA 1ZR4A 2V7QH 2Z4EA 3M0DA 1QL1A 4C7NB 3H1JD 4UB8H 2JR8A 3RK3B 2HLOB 3B5NB 3HD7A 4RO0A 1FZCA 2WQYC 1S72P 3CXHI 3CI9A 1GW3A 1OW7A 1FZCB 3HUSC 5KAIH 5KLVK 3CCSP 1FBMA 1EXJA 2HLOA 2G8YA 3JCUE 3H1HG 1L4AA 2Q9IC 3AE3C 1LNQA 3MGNA 4JPZB 3OW2O 4OH8B 2JHMF 1GTWA 3AE5C 3IN6A 5AW2B 3FXEA 1KILE 5E79E 3H1LE 3V2NA 3HUSA 2JJLA 1IFNA 2HODB 1FZCC 1KN7A 1HJ0A 2KLUA 3L71G 3MP7B 1LTJA 2MJZA 3PP5A 3AECC 1JEKA 1RF0A 2V4HA 4BWNA 1YJNP 2OARA 4UB6H 3CC7P 2B87B 2NPSB 2L5GB 4C7RA 3VMXA 3L73J 2ZJSE 1NTKE 2YIUB 1RE4B 2E76C 5AVZB 3I55P 2WVRA 4W7ZA 3FXDA 1RF1A 1Q82Q 3GLMA 1KYOD 3EWKA 3D6ZA 1SQPD 4NPDA 1KTMA 2O01J 1J1EC 3FX0A 5KJ7C 1SQQG 4DT0A 2P58A 3S4RA 4W80A 2YKPA 3RK2C 2BCCJ 3AE4C 1JY2P 2E76D 3L75J 3V2QA 1G2CA 2QM7A 3L71D 1BGYE 2KB7P 1QLED 1JTHA 3IF4A 1L2PA 3CCRP 1NTMJ 1BDCA 4JZCA 1T8ZA 1SS1A 3CD6P 2NZ2A 2E76B 3RGUA 2C0XA 3L70D 1UIIA 3CCJP 2NPSD 1KILC 3GHGC 5AVVB 4B86A 1N7SD 5B5EE 3MHVA 2E75D 3SWKA 2KP8A 3TK1A 1USDA 5CBOA 1W2BO 2HODA 1JO5A 5H2FH 1JY2O 1DEBA 4U3FG 1FZAB
chains in the Genus database with same CATH topology
2I1KA 2J1GA 2JEEA 3A7OA 2WPRA 3RK2B 5APTA 5BU8B 5KJ7D 3P8MC 1CZQA 3G3ZA 2C9NY 1S9KD 3U59A 1KZUB 1ZR2A 3HD7B 4N78D 1RE3A 1MUUA 3GHGA 1J1DC 3HE5B 4C7NA 2WT7B 1KFMA 1N86C 3FIBA 1NAFA 2Z5IA 3GHGB 1RE3B 2JHHC 2WPQA 3NTNA 2J3GA 2M8RA 2FIBA 3KYQA 1L4AC 4IFFA 1RY3A 3A5TA 1IFIA 1CSBA 3IR9A 1W2EA 1FJPA 2N1TC 4XA4A 1FZAC 1RF0C 2XV5A 4AUWA 1YYCA 1OXZA 1GL2D 1GDTA 2XNXA 3OAKA 2QM8A 5APQA 3SWFA 5CCHD 3VMZA 1VDFA 2FKWB 3BVHA 3VYIA 4WY4D 3RL0C 1JCCA 2Z4EB 2FYZA 2OYIA 4I1LA 2J3UA 2IX7C 1FIDA 5CJ0A 1SQBK 3TYYA 2J2PA 2P2UA 3VOPA 1FZFC 2OYHA 3M0DC 2VRSA 1NTKK 4GT1A 2XNXB 3WMM0 2FFDB 2ZFCA 1NTMK 3E1IA 2R3CA 3HD7D 1FZBB 5AW0B 3B8EB 5AW7B 1Z56A 2J3FA 4C46A 2HLOC 2Q7CA 1IFDA 5AW4B 1NKNA 2OYHC 1SFCB 5AVXB 5CCHA 1S9KE 3RL0B 3HE5A 5CMZA 1GL2C 1GD2E 1GU5A 4R9TA 1H8AA 3IFMA 1CW5A 5APSA 1FZDA 3BVHC 1LT9A 3H32C 4N3YB 1FOSF 1M1JC 2LKMA 3M9HA 5CCGD 5CJ4A 2YO2A 1JY3O 1CI6A 2XKMA 2CPBA 1RF1B 2N1TA 2HPCC 1FZGC 4GKGA 2FXMA 2Z4EC 2H43C 3KDPB 1URQD 3C9IA 1FOSE 2WITA 1N73A 1JC9A 3NFQA 1SLQA 1FZFB 3OA7A 5AVQB 4WY4B 2J61B 4JYOX 1MZ9A 2GM4A 2GUSA 1GL2A 1Z3UA 3HTKA 3CL3D 2HG5D 2W6AA 1LWUA 1HJBA 1JOCA 3BRVB 4EOTA 1A02J 4I2LC 2IFMA 2XDJA 5BU5A 2YNYA 3V4QA 2CPSA 1H89A 1KILB 3SWYA 4JYCA 1SQQK 5AW8B 1M1JB 3L36A 1WT6A 3UIAA 1EQ7A 1PFIA 1LWUB 2GY7A 1N73C 3RL0D 1GL2B 3E1IC 3RK3D 2WSFH 5APWA 3T97A 3P8CD 1XTGB 1T2KD 2HODC 2KLVA 2YKOA 4WBAA 1SQXK 5APXA 4XE5B 5AW1B 1GU4A 3P32A 3V4WA 2BASA 5APUA 1LTSC 1HVVA 1M1JA 4GIFA 1DX7A 1KILA 3H32A 2P7JA 5APYA 3VP8A 2J3FD 1FIBA 3M9BA 1LTIC 3HD7C 4KHXA 1MFZA 3MUDA 1HWTC 4ZFGA 2H43B 4ZKPA 3V5BA 3M91A 3OJAB 2D39A 1J1DB 4DZOA 4M3LA 1JMMA 2YO3A 1ZV8A 3LIDA 3TNUA 1URQA 1URQC 4WY4A 2J61A 2P1JA 2J60A 1T2KC 2WSEH 1RE4A 1SFCA 1FZEC 3MTUE 1IC2A 1JCDA 2C9LY 5CCGC 2J5ZA 2J64A 2N1TB 3I5CA 1CI6B 1VPCA 3RK3C 3BASA 3L4FA 4DOJA 3N4XA 2R5DA 1DH3A 2Q5UA 1FZBA 3L35A 1IO4A 5AVTB 1FAVA 5KJ7A 4JYBA 3E1IB 2WNPF 1OWAA 2OYIC 2KSJA 3LIEA 5AW5B 2XZRA 3HE4A 3M9QA 2O1KA 1J1EB 1LT9C 1A02F 2J59M 1HBWA 3EQ2A 4IFMA 1M7LA 5AVWB 2O1JA 2FYUK 4EPUA 2IPPA 2Q9IB 1MV8A 1XTCC 5CCHC 1FZEB 1HH0A 1ZLLA 4NYTA 3A3YB 1NO4A 4LLHA 1IJDB 2N9BA 4N78E 3P7KA 1G1IA 2E43A 1GZLA 1HGVA 1YTZI 2FFDC 3VTPC 2OYHB 1FZEA 1SFCC 1SP4A 2Q9IA 2XU6A 1N86A 2J0YA 1NTZK 1KQLA 1KILD 4W7YA 1T3UA 1ZR4A 2OYIB 2Z4EA 3RK2D 3H6PA 3M0DA 1QL1A 4LGDE 1ZN5A 4O9BA 3BVHB 2WT7A 1YTZT 4C7NB 1L0NK 3RK3B 1IK9A 1HGZA 1FJKA 2JHIF 1NWQA 1SQPK 2HLOB 3KPEA 3B5NB 3HD7A 4HYTB 4R9JA 2Q3IA 3VMYA 3VN0A 1LGHB 2WWWA 1FZCA 3HRNA 3CI9A 1GW3A 1FZCB 4AYCA 2J0HA 3HUSC 5KLVK 5AW9B 2KOGA 2HFED 1FBMA 1HTLC 1FZAA 1JY3P 4WB4A 3U1AA 1LTGC 4EIJA 3B5NA 2HLOA 2P67A 2J58A 3O8ZA 1GK4A 1NOHA 1WRGA 1L4AA 4RESB 2Q9IC 3MGNA 2E42A 2HPCB 1FZGB 2JHLF 2R32A 3NMDA 4OH8B 2JHMF 3U1CA 1GTWA 1N86B 1X8YA 2POHA 4WY4C 5AW2B 2H7HA 4JF7A 2N1TD 2GUVA 5AW6B 3V2NA 4AQRD 3HUSA 4LC1A 1GK6A 2JJLA 2W6BA 1JTHB 1LTTC 5AVYB 1IFNA 3NXSA 1SVFA 2HODB 1FZCC 2WPSA 2J3OA 3MD0A 2A45I 3EFGA 1LTJA 4M7HA 2MJZA 1JY3N 3CLQA 3PP5A 2XNXC 1N7SC 3B5ND 1RF0A 1AQ5A 1N2DC 1FZBC 3HE4B 5CHXA 5AVRB 3M0AA 4IFDK 3A2AA 2OARA 1Z3SA 1G1JA 1FDMA 3R2PA 2JHKF 1IFJA 2O01H 2NPSB 2C0WA 2L5GB 3MIWA 1H88A 2W27A 3BATA 4C7RA 1J2JB 2YMYA 3VMXA 1G2CB 2YKQA 2A45G 1E5WA 5BVZA 1N7LA 1LTBC 1RE4B 1X79B 2KYVA 2HYNA 5AVZB 3V2RA 1LTAC 1N7SB 1NKZB 1URQB 5APVA 1JUNA 4W7ZA 1SFCD 1RF1A 3TNUB 3VP9A 2WSCH 2H43A 4Y99C 1AFOA 3P8CE 1NH4A 2IFNA 1J1EC 5KJ7C 1LT9B 5AW3B 2Z5HA 2I1JA 3H32B 4HH2A 4I6MC 1N7SA 4M7FA 4W80A 2ZXEB 2YKPA 3V2PA 1IFMA 3L37A 3RK2C 2WTYA 1LTJC 1JY2P 1KFNA 1RF1C 5CCGA 2M3BA 1FICA 2R5BA 3BRTB 3LW5H 3V2QA 1HUCA 1G2CA 1RE4C 2QM7A 2WZ7A 3N7NA 1QL2A 5KTBA 2KB7P 3II6A 2NPSC 2H8PD 2J0GA 2NPSA 1JTHA 1LWUC 5AVSB 1FU1A 1L0LK 3KQGA 2FFDA 4ZKUA 4Y99B 1GW4A 1JNMA 4JZCA 1T8ZA 1RF0B 2C0XA 2PAJA 3HTKB 2PP6A 2NPSD 1L4AD 1SQVK 1KILC 1RE3C 3GHGC 5AVVB 1X9VA 4B86A 3B5NC 1NU1K 1FZGA 2HPCA 1N7SD 1LTJB 1FZFA 4N6JA 2A45H 2KP8A 3TK1A 1N73B 1L4AB 1T3JA 2HODA 3M06A 1JO5A 1JY2N 3TSIA 1JY2O 1DEBA 3HUSB 5AVUB 1FZAB 1NHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF1 B;  2J1G A;  1FZB C;  2HPC C;  1FZG C;  2Z4E C;  2H43 C;  1Z3S A;  1N73 A;  4EPU A;  2JHK F;  2Q9I B;  1JC9 A;  1FZE B;  1FZF B;  2J61 B;  4JYO X;  4NYT A;  1RE3 A;  3GHG A;  1Z3U A;  1N86 C;  3FIB A;  1LWU A;  2A45 G;  3GHG B;  1RE3 B;  2JHH C;  2J3G A;  2FFD C;  2OYH B;  1FZE A;  1RE4 B;  2FIB A;  2Q9I A;  1N86 A;  2J0Y A;  1T3U A;  2OYI B;  2Z4E A;  1M1J B;  1W2E A;  1RF1 A;  1LWU B;  1FZA C;  2GY7 A;  1RF0 C;  3BVH B;  1N73 C;  3E1I C;  2JHI F;  2H43 A;  2XNX A;  2HLO B;  2HOD C;  4R9J A;  1LT9 B;  3BVH A;  3H32 B;  1FZC A;  1M1J A;  4M7F A;  2Z4E B;  2OYI A;  2J3U A;  1FZC B;  1FID A;  1LTJ C;  3H32 A;  3HUS C;  1JY2 P;  2J0H A;  1JY3 P;  1FZA A;  2J2P A;  1RF1 C;  1FZF C;  2OYH A;  2J3F D;  1FIB A;  1FIC A;  2HLO A;  2XNX B;  2H43 B;  4ZFG A;  2FFD B;  3E1I A;  1RE4 C;  2D39 A;  2Q9I C;  1FZB B;  2HPC B;  1FZG B;  2JHL F;  2J0G A;  2J61 A;  2JHM F;  1LWU C;  2J60 A;  1N86 B;  2J3F A;  1RE4 A;  1FZE C;  2FFD A;  2HLO C;  4JZC A;  2J5Z A;  2J64 A;  2OYH C;  1RF0 B;  3HUS A;  1RE3 C;  3GHG C;  4R9T A;  2HOD B;  1FZG A;  2HPC A;  1FZC C;  1FZB A;  1LTJ B;  1FZF A;  2J3O A;  2A45 H;  1FZD A;  3BVH C;  1LT9 A;  2A45 I;  1N73 B;  1LTJ A;  3E1I B;  3H32 C;  4M7H A;  2HOD A;  1JY3 N;  2WNP F;  2OYI C;  2XNX C;  1JY2 N;  1M1J C;  1JY2 O;  3HUS B;  1JY3 O;  1LT9 C;  1FZA B;  1RF0 A; 
#chains in the Genus database with same CATH topology
 1VF5 B;  2OYO A;  2WPR A;  1FDO A;  3G3Z A;  2C9N Y;  3GG2 A;  3GHG A;  3G71 P;  1N86 C;  2WT7 B;  3FIB A;  3ABV C;  2Z5I A;  2FXP A;  3NTN A;  4PJ0 H;  3H1I J;  3BCC G;  4IFF A;  1VQL P;  3AED C;  3SFE C;  3A5T A;  2ZT9 B;  4RJT A;  4XA4 A;  1FZA C;  1RF0 C;  2XV5 A;  3USS A;  3CCQ P;  5GTI H;  3SWF A;  4H0L C;  3VMZ A;  2K37 A;  4WVZ A;  1SQV E;  1VDF A;  3VYI A;  1NTM E;  2A06 G;  3AEF C;  4OGQ C;  3R4Y A;  4U7J A;  3VOP A;  4YXD C;  2XNX B;  2JKV A;  4IL6 E;  3RBX A;  2QVA A;  3B8E B;  1SQB E;  1SQP J;  1KB9 I;  1Z56 A;  2J3F A;  2K3R A;  1RH5 B;  1KC8 Q;  1NTZ G;  2O3J A;  3F5H A;  2Q7C A;  1M57 D;  1SQP E;  5CMZ A;  1H8A A;  1CW5 A;  3BVH C;  1LT9 A;  1VL2 A;  3H1H D;  4PJ0 E;  5CCG D;  5CJ4 A;  3JSV C;  4ZNC A;  2FXM A;  2WSC J;  2ZXX A;  1FZF B;  4JYO X;  2KS1 A;  1LP1 B;  2GM4 A;  2BEZ F;  3AE7 C;  1GL2 A;  1PPJ D;  3CL3 D;  1VQ4 P;  4JQ0 D;  1YQ3 C;  1JOC A;  1OVR A;  3E1R A;  4I2L C;  1VQP P;  5BU5 A;  1KD1 Q;  3EFF K;  3CCL P;  1H89 A;  1SQQ K;  1WT6 A;  1IZN B;  1EQ7 A;  1L0L E;  1GL2 B;  1XTG B;  1BCC E;  5APX A;  5AW1 B;  1GU4 A;  5APU A;  1HF9 A;  3A0B H;  5K5G B;  2YXQ B;  4GOF A;  4PV1 B;  1RQU A;  5CBN A;  4YXW H;  4ZFG A;  3KZI H;  4ZKP A;  3OJA B;  1J1D B;  4DZO A;  3WUT A;  2YO3 A;  1ZV8 A;  2IZ1 A;  3WUU A;  3L75 G;  2J61 A;  2J60 A;  4BRY B;  1NTK G;  3MTU E;  1U57 A;  1IC2 A;  2C9L Y;  1SQQ J;  2N1T B;  3ITK A;  1AA0 A;  1Y9B A;  1VPC A;  3CX5 E;  1WMK A;  1FZB A;  1PGP A;  1M8O B;  1OWA A;  1EC5 A;  2O1K A;  2FYN C;  3CX5 I;  3L73 G;  2IPP A;  3H1J G;  3PJS K;  3H1L D;  3L72 G;  1PZQ A;  4NYT A;  3CC2 P;  2QJP C;  4OGQ B;  2KIK A;  5B5E H;  2FBW C;  2FFD C;  2E75 C;  5H2F E;  2LR2 A;  2XU6 A;  2J0Y A;  1KIL D;  3JC2 2;  1T3U A;  3L71 J;  3RK2 D;  4LGD E;  3H1K D;  3QWO C;  3TGU D;  1L0N K;  1IK9 A;  1FJK A;  5KLI B;  3AE6 C;  4R9J A;  2Q3I A;  3VMY A;  3VN0 A;  4Z1M H;  2M5A A;  2Q6Q A;  3HRN A;  3QH9 A;  2FYU G;  1FE6 A;  2W90 A;  5AW9 B;  2KOG A;  1HTL C;  1FZA A;  4ASW A;  3U1A A;  4EIJ A;  3L74 E;  2P67 A;  3TF5 A;  1NOH A;  2IBZ G;  3CC4 P;  1PL5 A;  2E5Y A;  2R32 A;  1Y8A A;  2Q1K A;  2POH A;  1MKM A;  4D6T J;  1L0L D;  5KLI C;  4WY4 C;  5AW6 B;  1ZW0 A;  1BCC D;  1GK6 A;  2W6B A;  1OZH A;  1SVF A;  1YBK A;  3L71 E;  2A45 I;  1P84 E;  4R4L A;  1JB0 J;  2QJY C;  3H1I D;  4L76 A;  3A0H H;  3B5N D;  1YJ9 P;  5KLV E;  1FZB C;  4IFD K;  4A7P A;  1Z3S A;  1G1J A;  1FDM A;  3R2P A;  1AVY A;  1ZXG A;  2O01 H;  2C0W A;  3MIW A;  4TLF A;  2Q3E A;  1DD4 A;  3BAT A;  1J2J B;  2YMY A;  3CWB J;  2YKQ A;  1E5W A;  2E5T A;  3K5B A;  1LP1 A;  2Y9Z A;  1NTZ E;  2KYV A;  3TGU G;  2UWJ E;  3V2R A;  1PP9 G;  1IFP A;  3L70 E;  4R4M A;  1SFC D;  1NTZ J;  2ZYG A;  1NTM D;  1BE3 E;  2H43 A;  4Y99 C;  1AFO A;  3P8C E;  3L70 J;  2IFN A;  1LT9 B;  5AW3 B;  2I1J A;  2JWA A;  1N7S A;  2ZXE B;  3V2P A;  3L37 A;  3H1J J;  2G3A A;  1KQF B;  3F89 A;  2O01 N;  1RF1 C;  3LW5 H;  1RE4 C;  2WZ7 A;  1QL2 A;  2NPS C;  2H8P D;  4H13 C;  5AVS B;  1SQV D;  4NPF X;  3KQG A;  1BDD A;  4ZKU A;  4Y99 B;  3TGU E;  1YHQ P;  4GDO A;  2OTK E;  1L4A D;  1SQV K;  3H1I G;  3B5N C;  1RHZ B;  2JP3 A;  1NTK J;  1FZF A;  1L0L J;  4N6J A;  2WSS H;  4PD4 D;  1N73 B;  1T3J A;  2K88 A;  1OFC X;  5AVU B;  1AVO A;  3Q5S A;  2LXB A;  5DJT B;  4D6T D;  3MZW B;  3RK2 B;  5APT A;  5KJ7 D;  3P8M C;  2OTL P;  2N9Y B;  1ZR2 A;  3HD7 B;  3V6I A;  1VQ6 P;  3HE5 B;  1LT1 A;  1KFM A;  1H0T A;  3GHG B;  2JHH C;  2WPQ A;  1L0N D;  2M8R A;  2JDI H;  1KYO I;  3L75 E;  1AJY A;  1RY3 A;  1PGJ A;  2QRX A;  3L70 G;  3CPW O;  1FJP A;  3H1K E;  3L73 D;  1GDT A;  2XNX A;  5APQ A;  2QM8 A;  1SQV G;  2B88 A;  2FKW B;  3RL0 C;  1JCC A;  2FYZ A;  5E79 H;  2J3U A;  2IX7 C;  1KB9 E;  1SQB K;  2J2P A;  1VF5 D;  1NTK K;  3WMM 0;  3CXH H;  2ZFC A;  2R3C A;  1EDJ A;  1NTZ D;  1FZB B;  1PPJ E;  3G6E P;  3Q5P A;  1K73 Q;  1OIP A;  3H1J E;  5AW7 B;  3Q1M A;  1TU3 F;  1OVV A;  1IFD A;  1EZV E;  2KSE A;  5AW4 B;  2OYH C;  1ZRT D;  2PRR A;  5CCH A;  2PGD A;  2FYU D;  2K9Y A;  1GD2 E;  3IFM A;  2QE7 H;  3W68 A;  1X22 A;  1FZD A;  1SQP G;  3H32 C;  4HJG H;  2LKM A;  1JY3 O;  1CI6 A;  2QA4 P;  5KLV G;  2N1T A;  2H43 C;  3KDP B;  3CME P;  2OTJ P;  1FOS E;  1M1K Q;  2KZI A;  3HTK A;  2W6A A;  3LW5 J;  1HJB A;  3BRV B;  1A02 J;  1R5S A;  1GMJ A;  2YNY A;  2CPS A;  3D70 A;  3TDK A;  2W6J H;  1Y47 A;  1SQX D;  2RMZ A;  4JBZ A;  3RK3 D;  4EYY Q;  1AV1 A;  2KS1 B;  3P8C D;  2HOD C;  2KLV A;  2YKO A;  1W5C E;  1SQX K;  3SSU A;  3V4W A;  2H88 C;  1M1J A;  3L74 D;  4TT3 H;  1L0N J;  2P7J A;  3D71 A;  2QJK C;  1S5L X;  2R3S A;  2L91 A;  3C8V A;  1YJW P;  1JM0 A;  1E79 H;  1HWT C;  2H43 B;  1QVF O;  2BCC E;  3M91 A;  5L8R J;  1JMM A;  3LID A;  1VF5 C;  1URQ C;  4WY4 A;  2P1J A;  4PD4 I;  2WSE H;  2ZT9 C;  5CCG C;  2J5Z A;  2J64 A;  5TJH A;  5GTH E;  3L4F A;  3N4X A;  3H1I E;  2AXT E;  4PD4 E;  5KLV D;  5KJ7 A;  4JYB A;  1KB9 D;  2M3E A;  4EDF A;  2OYI C;  2XZR A;  3TGU J;  2A06 D;  5TIS H;  1LJ2 A;  3O6Q B;  1NAY A;  4IFM A;  4H0L B;  3CWB G;  2O1J A;  4U3F D;  4EPU A;  1MV8 A;  1XTC C;  5CCH C;  1ZLL A;  4N78 E;  1NU1 G;  3PTZ A;  2B9B A;  5DJU B;  2D2C D;  1G1I A;  1L0N E;  1HGV A;  1YTZ I;  4I7Z B;  2E43 A;  2E74 C;  1FZE A;  1SFC C;  2KUB A;  1DD3 A;  1Q7Y Q;  2OYI B;  1UIX A;  3H6P A;  2KXP B;  1ZN5 A;  2KNC A;  2WT7 A;  1YTZ T;  1HGZ A;  4H44 C;  4HYT B;  4HKZ H;  3WU2 H;  1KV4 A;  3Q2Y A;  4WB4 A;  3B5N A;  2AXT H;  2J58 A;  1GK4 A;  1YI2 P;  3L74 J;  1BE3 D;  2JHL F;  3NMD A;  3U1C A;  3CCV P;  1N86 B;  1X8Y A;  1JMB A;  4H44 B;  4JF7 A;  2ZYD A;  2GUV A;  4AQR D;  4LC1 A;  4IOI H;  1YIJ P;  2ZVN B;  1LTT C;  5AVY B;  3S1K A;  3NXS A;  1NU1 D;  2WPS A;  3MD0 A;  2KZJ A;  4M7H A;  1SQQ D;  1JY3 N;  3CLQ A;  1NYH A;  1N7S C;  3L74 G;  3H1H J;  1Q81 Q;  4MN4 C;  1N2D C;  2ZVO B;  1ZME C;  5CHX A;  5AVR B;  2RN0 A;  3A2A A;  3B71 A;  2JHK F;  1IFJ A;  1P84 I;  1S5L E;  1H88 A;  2W27 A;  3L75 D;  5B66 E;  3AE1 C;  3A0B E;  2HYN A;  1VQM P;  1NKZ B;  1URQ B;  1BCC G;  3TNU B;  3VP9 A;  1M90 Q;  3FWN A;  1BE3 G;  3Q5R A;  3BCC J;  2YMK A;  2FY8 A;  2WTY A;  4RKU J;  5CCG A;  2M3B A;  2R5B A;  3BRT B;  1BSN A;  1HUC A;  2QIW A;  3N7N A;  5KTB A;  3II6 A;  2WSE J;  1LWU C;  1YQ4 C;  1FU1 A;  2WMM A;  1L0L K;  2QG4 A;  1JNM A;  2Y9Y A;  4UB6 E;  3CCM P;  3AE2 C;  1SQB J;  1RE3 C;  1VQO P;  3AEA C;  2A45 H;  2W83 C;  1L4A B;  1QX8 A;  3M06 A;  1JY2 N;  1KMI Z;  3HUS B;  4EOT A;  1NHL A;  2I1K A;  2J1G A;  2JEE A;  3A7O A;  1EZV D;  5BU8 B;  2ZYA A;  3U59 A;  1KZU B;  2V7Q J;  4N78 D;  1BGY G;  1D7M A;  1RE3 A;  1VQ5 P;  2Y0C A;  1SQX E;  1PGO A;  2KK7 A;  2FIB A;  3KYQ A;  4YPC A;  1ZRT E;  2DW3 A;  1IFI A;  1CSB A;  3IR9 A;  2N1T C;  1SQQ E;  1GL2 D;  5CCH D;  4WY4 D;  2Z4E B;  1RQV A;  5CJ0 A;  4K35 A;  2P2U A;  2OYH A;  2VRS A;  2E74 D;  4GT1 A;  2QJY B;  5KLV J;  3E1I A;  4ZMD A;  1U7J A;  1FDI A;  2K1A A;  4UB8 E;  5AW0 B;  1OW8 A;  2QJP B;  2RH0 A;  1IK7 A;  1M56 D;  1KB9 H;  2HLO C;  1NKN A;  1PP9 J;  2FXO A;  5AVX B;  2P10 A;  1S9K E;  3RL0 B;  3HE5 A;  1OW6 A;  2ZT9 D;  1VQN P;  3MUD C;  2QEX P;  1EDK A;  3RK3 E;  5APS A;  4N3Y B;  1FOS F;  2PFX A;  3M9H A;  1S1C X;  4U3F E;  1RF1 B;  2HPC C;  1FZG C;  4GKG A;  2Z4E C;  1URQ D;  2WIT A;  1BGY J;  1JC9 A;  3NFQ A;  1SLQ A;  5AVQ B;  3H1H E;  1MZ9 A;  1Z3U A;  1P84 D;  2IFM A;  3AE8 C;  2XDJ A;  1QEX A;  3V4Q A;  1MFT A;  1KIL B;  4JYC A;  4YTP C;  2IYO A;  2OQQ A;  3L36 A;  4CPG A;  2ZAE B;  1PV3 A;  1LWU B;  2SPZ A;  4D6T G;  2IYP A;  3T97 A;  1T2K D;  1X0T A;  1S5L H;  3KXD A;  4WBA A;  3P32 A;  2YXR B;  1NTM G;  2A06 E;  2IZ0 A;  1LTS C;  5B66 H;  1DX7 A;  4H13 D;  2AEJ A;  3VP8 A;  2J3F D;  1NU1 J;  1R5L A;  3HD7 C;  1MFZ A;  3MUD A;  3V5B A;  2FYU E;  2D39 A;  3CCU P;  4OGQ D;  4M3L A;  3TNU A;  1URQ A;  2QSI A;  3H1L J;  4PD4 H;  1RE4 A;  1SFC A;  1FZE C;  3SFD C;  2IBZ E;  1JCD A;  2ITA A;  4OWF A;  1OX3 A;  2B89 A;  3L35 A;  2QJK B;  2IDB A;  3LIE A;  3HE4 A;  3GW6 A;  1J1E B;  1LT9 C;  3L72 J;  1A02 F;  1HBW A;  2RKL A;  3EQ2 A;  2KI7 B;  3I56 P;  1HH0 A;  1VQ7 P;  1IJD B;  2N9B A;  3BCC D;  1KQS O;  3P7K A;  1P84 H;  1T6A A;  3VTP C;  4H13 B;  1SP4 A;  4XFJ A;  1N86 A;  1NTZ K;  1KQL A;  2W8Z A;  5M1B A;  4W7Y A;  3ZDM A;  1FS0 E;  3CXH E;  1YIT P;  1H0T B;  4O9B A;  3BVH B;  1EZV G;  2JHI F;  1NWQ A;  3JCU H;  1SQP K;  1PP9 E;  3KPE A;  3H1L G;  2R44 A;  1S3J A;  1LGH B;  2WWW A;  2Y0D A;  3AEB C;  3G9R A;  2M5A B;  4AYC A;  2J0H A;  3E7K A;  1EXI A;  3B4S A;  2HFE D;  3RBZ A;  1JY3 P;  1LTG C;  3O8Z A;  1WRG A;  4RES B;  1DEE G;  3CCE P;  2E42 A;  3WU2 E;  2HPC B;  1FZG B;  1Q90 D;  4H0L D;  2H7H A;  1USE A;  2N1T D;  1VQ9 P;  2E74 B;  2GA1 A;  1SQX G;  1JTH B;  2YIU C;  2J3O A;  3VMA A;  3EFG A;  1NVO A;  3T97 B;  2XNX C;  3O6Q A;  4DJG A;  1AQ5 A;  3HE4 B;  3M0A A;  2AXC A;  3FGA D;  4K3A A;  4NPE A;  2IBZ D;  1G2C B;  2A45 G;  5BVZ A;  1N7L A;  1K8A Q;  1LTB C;  1X79 B;  2OGU A;  5C39 A;  1QGK B;  3PLN A;  3D6Y A;  1SQV J;  1LTA C;  1N7S B;  5APV A;  1JUN A;  2WSC H;  3CMA P;  5KAF E;  2B87 A;  1NH4 A;  3IAO A;  2Z5H A;  3H32 B;  4HH2 A;  4I6M C;  3GF3 A;  4M7F A;  1NJI Q;  5KKZ C;  1IFM A;  4Y28 J;  1LTJ C;  1KFN A;  3WUV A;  3CWB D;  1FIC A;  1NU1 E;  3A0H E;  5TIS E;  2NPS A;  3Q3D A;  2J0G A;  3FWL A;  2E75 B;  1L0N G;  1ZOY C;  1ZP0 C;  2FFD A;  1GW4 A;  1R8E A;  1RF0 B;  2PAJ A;  3HTK B;  2PP6 A;  1L0L G;  1X9V A;  4I7Z C;  4D6T E;  4HB1 A;  1NU1 K;  2HPC A;  1FZG A;  1LTJ B;  1DIP A;  3KZI E;  1OMI A;  2BCC D;  3GMA A;  3TSI A;  3W67 A;  1VQK P;  1KOR A;  1Q2N A;  5KKZ B;  4IL6 X;  1CZQ A;  1S9K D;  1K05 A;  4U3F J;  1MUU A;  1J1D C;  4C7N A;  2KNC B;  1NAF A;  3L72 E;  1RE3 B;  5KAF H;  2J3G A;  2MKV A;  2BEQ D;  1K04 A;  1L4A C;  1SQB G;  4KT0 J;  1W2E A;  4GOE A;  4AUW A;  1YYC A;  1OXZ A;  3H1K J;  3OAK A;  1PP9 D;  3BVH A;  2JWD A;  4GOD A;  1KYO E;  1NGM B;  2OYI A;  4I1L A;  4ASV A;  4L75 A;  1FID A;  3TYY A;  3L73 E;  2Y0E A;  1FZF C;  3M0D C;  2BCC G;  2FFD B;  1NTM K;  4WWI A;  3HD7 D;  4DCK A;  1QVG O;  1BE3 J;  4C46 A;  2D2C B;  1BCC J;  4OVN F;  1SFC B;  4IL6 H;  4H44 D;  4BRY A;  1GL2 C;  3H1K G;  1GU5 A;  4KJM A;  4PV1 D;  3PRJ A;  4R9T A;  2K9J B;  2WSF J;  1SQX J;  2J5U A;  1KQG B;  2XND H;  1M1J C;  1EZV I;  4PV1 C;  2YO2 A;  2XKM A;  1EDI A;  2CPB A;  5GTH H;  3G4S P;  3CX5 D;  3C9I A;  1N73 A;  3OA7 A;  2J61 B;  4WY4 B;  2H89 C;  2GUS A;  1KYO H;  2AEM A;  2LXC B;  2HG5 D;  1LWU A;  3RL0 g;  2FYU J;  3PHL A;  1N8R Q;  1PPJ G;  1PIX A;  1VQ8 P;  2D2C C;  3SWY A;  5AW8 B;  1M1J B;  5EFW B;  1PGQ A;  3UIA A;  4QMA A;  1PFI A;  2GY7 A;  1N73 C;  3RL0 D;  3E1I C;  2WPV B;  1Q86 Q;  2WSF H;  5APW A;  4XE5 B;  2M0B A;  2BAS A;  4EI2 A;  1HVV A;  4GIF A;  3AEE C;  1KIL A;  3S9O A;  3H32 A;  5APY A;  3H25 A;  3CWB E;  1FIB A;  3M9B A;  1LTI C;  4KHX A;  3CXH D;  3L72 D;  2FYN B;  3BCC E;  1FC2 C;  1K9M Q;  2I8D A;  1T2K C;  1SQB D;  3AEG C;  4L74 A;  3I5C A;  1AQT A;  1CI6 B;  2HR3 A;  5KAI E;  1NTK D;  3RK3 C;  3BAS A;  4DOJ A;  2AEF A;  1S2E A;  2R5D A;  1DH3 A;  2Q5U A;  3GF7 A;  1IO4 A;  5AVT B;  1FAV A;  2NRG A;  2K9J A;  3E1I B;  2IBZ I;  2WNP F;  2KSJ A;  5AW5 B;  3M9Q A;  4BXL A;  2JO1 A;  4L73 A;  1EDL A;  2J59 M;  3AE9 C;  3PH0 A;  3C1L A;  3CX5 H;  3KHU A;  1M7L A;  5AVW B;  2CK3 H;  2FYU K;  2Q9I B;  1FZE B;  5GTI E;  3A3Y B;  1NO4 A;  4LLH A;  1U7M A;  1GZL A;  1BGY D;  2OYH B;  1OVU A;  2Q9I A;  1BSH A;  1S4X A;  1ZR4 A;  2V7Q H;  2Z4E A;  3M0D A;  1QL1 A;  4C7N B;  3H1J D;  4UB8 H;  2JR8 A;  3RK3 B;  2HLO B;  3B5N B;  3HD7 A;  4RO0 A;  1FZC A;  2WQY C;  1S72 P;  3CXH I;  3CI9 A;  1GW3 A;  1OW7 A;  1FZC B;  3HUS C;  5KAI H;  5KLV K;  3CCS P;  1FBM A;  1EXJ A;  2HLO A;  2G8Y A;  3JCU E;  3H1H G;  1L4A A;  2Q9I C;  3AE3 C;  1LNQ A;  3MGN A;  4JPZ B;  3OW2 O;  4OH8 B;  2JHM F;  1GTW A;  3AE5 C;  3IN6 A;  5AW2 B;  3FXE A;  1KIL E;  5E79 E;  3H1L E;  3V2N A;  3HUS A;  2JJL A;  1IFN A;  2HOD B;  1FZC C;  1KN7 A;  1HJ0 A;  2KLU A;  3L71 G;  3MP7 B;  1LTJ A;  2MJZ A;  3PP5 A;  3AEC C;  1JEK A;  1RF0 A;  2V4H A;  4BWN A;  1YJN P;  2OAR A;  4UB6 H;  3CC7 P;  2B87 B;  2NPS B;  2L5G B;  4C7R A;  3VMX A;  3L73 J;  2ZJS E;  1NTK E;  2YIU B;  1RE4 B;  2E76 C;  5AVZ B;  3I55 P;  2WVR A;  4W7Z A;  3FXD A;  1RF1 A;  1Q82 Q;  3GLM A;  1KYO D;  3EWK A;  3D6Z A;  1SQP D;  4NPD A;  1KTM A;  2O01 J;  1J1E C;  3FX0 A;  5KJ7 C;  1SQQ G;  4DT0 A;  2P58 A;  3S4R A;  4W80 A;  2YKP A;  3RK2 C;  2BCC J;  3AE4 C;  1JY2 P;  2E76 D;  3L75 J;  3V2Q A;  1G2C A;  2QM7 A;  3L71 D;  1BGY E;  2KB7 P;  1QLE D;  1JTH A;  3IF4 A;  1L2P A;  3CCR P;  1NTM J;  1BDC A;  4JZC A;  1T8Z A;  1SS1 A;  3CD6 P;  2NZ2 A;  2E76 B;  3RGU A;  2C0X A;  3L70 D;  1UII A;  3CCJ P;  2NPS D;  1KIL C;  3GHG C;  5AVV B;  4B86 A;  1N7S D;  5B5E E;  3MHV A;  2E75 D;  3SWK A;  2KP8 A;  3TK1 A;  1USD A;  5CBO A;  1W2B O;  2HOD A;  1JO5 A;  5H2F H;  1JY2 O;  1DEB A;  4U3F G;  1FZA B; 
#chains in the Genus database with same CATH homology
 2I1K A;  2J1G A;  2JEE A;  3A7O A;  2WPR A;  3RK2 B;  5APT A;  5BU8 B;  5KJ7 D;  3P8M C;  1CZQ A;  3G3Z A;  2C9N Y;  1S9K D;  3U59 A;  1KZU B;  1ZR2 A;  3HD7 B;  4N78 D;  1RE3 A;  1MUU A;  3GHG A;  1J1D C;  3HE5 B;  4C7N A;  2WT7 B;  1KFM A;  1N86 C;  3FIB A;  1NAF A;  2Z5I A;  3GHG B;  1RE3 B;  2JHH C;  2WPQ A;  3NTN A;  2J3G A;  2M8R A;  2FIB A;  3KYQ A;  1L4A C;  4IFF A;  1RY3 A;  3A5T A;  1IFI A;  1CSB A;  3IR9 A;  1W2E A;  1FJP A;  2N1T C;  4XA4 A;  1FZA C;  1RF0 C;  2XV5 A;  4AUW A;  1YYC A;  1OXZ A;  1GL2 D;  1GDT A;  2XNX A;  3OAK A;  2QM8 A;  5APQ A;  3SWF A;  5CCH D;  3VMZ A;  1VDF A;  2FKW B;  3BVH A;  3VYI A;  4WY4 D;  3RL0 C;  1JCC A;  2Z4E B;  2FYZ A;  2OYI A;  4I1L A;  2J3U A;  2IX7 C;  1FID A;  5CJ0 A;  1SQB K;  3TYY A;  2J2P A;  2P2U A;  3VOP A;  1FZF C;  2OYH A;  3M0D C;  2VRS A;  1NTK K;  4GT1 A;  2XNX B;  3WMM 0;  2FFD B;  2ZFC A;  1NTM K;  3E1I A;  2R3C A;  3HD7 D;  1FZB B;  5AW0 B;  3B8E B;  5AW7 B;  1Z56 A;  2J3F A;  4C46 A;  2HLO C;  2Q7C A;  1IFD A;  5AW4 B;  1NKN A;  2OYH C;  1SFC B;  5AVX B;  5CCH A;  1S9K E;  3RL0 B;  3HE5 A;  5CMZ A;  1GL2 C;  1GD2 E;  1GU5 A;  4R9T A;  1H8A A;  3IFM A;  1CW5 A;  5APS A;  1FZD A;  3BVH C;  1LT9 A;  3H32 C;  4N3Y B;  1FOS F;  1M1J C;  2LKM A;  3M9H A;  5CCG D;  5CJ4 A;  2YO2 A;  1JY3 O;  1CI6 A;  2XKM A;  2CPB A;  1RF1 B;  2N1T A;  2HPC C;  1FZG C;  4GKG A;  2FXM A;  2Z4E C;  2H43 C;  3KDP B;  1URQ D;  3C9I A;  1FOS E;  2WIT A;  1N73 A;  1JC9 A;  3NFQ A;  1SLQ A;  1FZF B;  3OA7 A;  5AVQ B;  4WY4 B;  2J61 B;  4JYO X;  1MZ9 A;  2GM4 A;  2GUS A;  1GL2 A;  1Z3U A;  3HTK A;  3CL3 D;  2HG5 D;  2W6A A;  1LWU A;  1HJB A;  1JOC A;  3BRV B;  4EOT A;  1A02 J;  4I2L C;  2IFM A;  2XDJ A;  5BU5 A;  2YNY A;  3V4Q A;  2CPS A;  1H89 A;  1KIL B;  3SWY A;  4JYC A;  1SQQ K;  5AW8 B;  1M1J B;  3L36 A;  1WT6 A;  3UIA A;  1EQ7 A;  1PFI A;  1LWU B;  2GY7 A;  1N73 C;  3RL0 D;  1GL2 B;  3E1I C;  3RK3 D;  2WSF H;  5APW A;  3T97 A;  3P8C D;  1XTG B;  1T2K D;  2HOD C;  2KLV A;  2YKO A;  4WBA A;  1SQX K;  5APX A;  4XE5 B;  5AW1 B;  1GU4 A;  3P32 A;  3V4W A;  2BAS A;  5APU A;  1LTS C;  1HVV A;  1M1J A;  4GIF A;  1DX7 A;  1KIL A;  3H32 A;  2P7J A;  5APY A;  3VP8 A;  2J3F D;  1FIB A;  3M9B A;  1LTI C;  3HD7 C;  4KHX A;  1MFZ A;  3MUD A;  1HWT C;  4ZFG A;  2H43 B;  4ZKP A;  3V5B A;  3M91 A;  3OJA B;  2D39 A;  1J1D B;  4DZO A;  4M3L A;  1JMM A;  2YO3 A;  1ZV8 A;  3LID A;  3TNU A;  1URQ A;  1URQ C;  4WY4 A;  2J61 A;  2P1J A;  2J60 A;  1T2K C;  2WSE H;  1RE4 A;  1SFC A;  1FZE C;  3MTU E;  1IC2 A;  1JCD A;  2C9L Y;  5CCG C;  2J5Z A;  2J64 A;  2N1T B;  3I5C A;  1CI6 B;  1VPC A;  3RK3 C;  3BAS A;  3L4F A;  4DOJ A;  3N4X A;  2R5D A;  1DH3 A;  2Q5U A;  1FZB A;  3L35 A;  1IO4 A;  5AVT B;  1FAV A;  5KJ7 A;  4JYB A;  3E1I B;  2WNP F;  1OWA A;  2OYI C;  2KSJ A;  3LIE A;  5AW5 B;  2XZR A;  3HE4 A;  3M9Q A;  2O1K A;  1J1E B;  1LT9 C;  1A02 F;  2J59 M;  1HBW A;  3EQ2 A;  4IFM A;  1M7L A;  5AVW B;  2O1J A;  2FYU K;  4EPU A;  2IPP A;  2Q9I B;  1MV8 A;  1XTC C;  5CCH C;  1FZE B;  1HH0 A;  1ZLL A;  4NYT A;  3A3Y B;  1NO4 A;  4LLH A;  1IJD B;  2N9B A;  4N78 E;  3P7K A;  1G1I A;  2E43 A;  1GZL A;  1HGV A;  1YTZ I;  2FFD C;  3VTP C;  2OYH B;  1FZE A;  1SFC C;  1SP4 A;  2Q9I A;  2XU6 A;  1N86 A;  2J0Y A;  1NTZ K;  1KQL A;  1KIL D;  4W7Y A;  1T3U A;  1ZR4 A;  2OYI B;  2Z4E A;  3RK2 D;  3H6P A;  3M0D A;  1QL1 A;  4LGD E;  1ZN5 A;  4O9B A;  3BVH B;  2WT7 A;  1YTZ T;  4C7N B;  1L0N K;  3RK3 B;  1IK9 A;  1HGZ A;  1FJK A;  2JHI F;  1NWQ A;  1SQP K;  2HLO B;  3KPE A;  3B5N B;  3HD7 A;  4HYT B;  4R9J A;  2Q3I A;  3VMY A;  3VN0 A;  1LGH B;  2WWW A;  1FZC A;  3HRN A;  3CI9 A;  1GW3 A;  1FZC B;  4AYC A;  2J0H A;  3HUS C;  5KLV K;  5AW9 B;  2KOG A;  2HFE D;  1FBM A;  1HTL C;  1FZA A;  1JY3 P;  4WB4 A;  3U1A A;  1LTG C;  4EIJ A;  3B5N A;  2HLO A;  2P67 A;  2J58 A;  3O8Z A;  1GK4 A;  1NOH A;  1WRG A;  1L4A A;  4RES B;  2Q9I C;  3MGN A;  2E42 A;  2HPC B;  1FZG B;  2JHL F;  2R32 A;  3NMD A;  4OH8 B;  2JHM F;  3U1C A;  1GTW A;  1N86 B;  1X8Y A;  2POH A;  4WY4 C;  5AW2 B;  2H7H A;  4JF7 A;  2N1T D;  2GUV A;  5AW6 B;  3V2N A;  4AQR D;  3HUS A;  4LC1 A;  1GK6 A;  2JJL A;  2W6B A;  1JTH B;  1LTT C;  5AVY B;  1IFN A;  3NXS A;  1SVF A;  2HOD B;  1FZC C;  2WPS A;  2J3O A;  3MD0 A;  2A45 I;  3EFG A;  1LTJ A;  4M7H A;  2MJZ A;  1JY3 N;  3CLQ A;  3PP5 A;  2XNX C;  1N7S C;  3B5N D;  1RF0 A;  1AQ5 A;  1N2D C;  1FZB C;  3HE4 B;  5CHX A;  5AVR B;  3M0A A;  4IFD K;  3A2A A;  2OAR A;  1Z3S A;  1G1J A;  1FDM A;  3R2P A;  2JHK F;  1IFJ A;  2O01 H;  2NPS B;  2C0W A;  2L5G B;  3MIW A;  1H88 A;  2W27 A;  3BAT A;  4C7R A;  1J2J B;  2YMY A;  3VMX A;  1G2C B;  2YKQ A;  2A45 G;  1E5W A;  5BVZ A;  1N7L A;  1LTB C;  1RE4 B;  1X79 B;  2KYV A;  2HYN A;  5AVZ B;  3V2R A;  1LTA C;  1N7S B;  1NKZ B;  1URQ B;  5APV A;  1JUN A;  4W7Z A;  1SFC D;  1RF1 A;  3TNU B;  3VP9 A;  2WSC H;  2H43 A;  4Y99 C;  1AFO A;  3P8C E;  1NH4 A;  2IFN A;  1J1E C;  5KJ7 C;  1LT9 B;  5AW3 B;  2Z5H A;  2I1J A;  3H32 B;  4HH2 A;  4I6M C;  1N7S A;  4M7F A;  4W80 A;  2ZXE B;  2YKP A;  3V2P A;  1IFM A;  3L37 A;  3RK2 C;  2WTY A;  1LTJ C;  1JY2 P;  1KFN A;  1RF1 C;  5CCG A;  2M3B A;  1FIC A;  2R5B A;  3BRT B;  3LW5 H;  3V2Q A;  1HUC A;  1G2C A;  1RE4 C;  2QM7 A;  2WZ7 A;  3N7N A;  1QL2 A;  5KTB A;  2KB7 P;  3II6 A;  2NPS C;  2H8P D;  2J0G A;  2NPS A;  1JTH A;  1LWU C;  5AVS B;  1FU1 A;  1L0L K;  3KQG A;  2FFD A;  4ZKU A;  4Y99 B;  1GW4 A;  1JNM A;  4JZC A;  1T8Z A;  1RF0 B;  2C0X A;  2PAJ A;  3HTK B;  2PP6 A;  2NPS D;  1L4A D;  1SQV K;  1KIL C;  1RE3 C;  3GHG C;  5AVV B;  1X9V A;  4B86 A;  3B5N C;  1NU1 K;  1FZG A;  2HPC A;  1N7S D;  1LTJ B;  1FZF A;  4N6J A;  2A45 H;  2KP8 A;  3TK1 A;  1N73 B;  1L4A B;  1T3J A;  2HOD A;  3M06 A;  1JO5 A;  1JY2 N;  3TSI A;  1JY2 O;  1DEB A;  3HUS B;  5AVU B;  1FZA B;  1NHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...