1M1JC

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
390
structure length
390
Chain Sequence
TRENCCILDERFGSYCPTTCGIADFFNKYRLTTDGELLEIEGLLQQATNSTGSIEYLIQHIKTIYPSEKQTLPQSIEQLTQKSKKIIEEIIRYENTILAHENTIQQLTDMHIMNSNKITQLKQKIAQLESHCQEPCKDTAEIQETTGRDCQDIANKGARKSGLYFIKPQKAKQSFLVYCEIDTYGNGWTVLQRRLDGSEDFRRNWVQYKEGFGHLSPDDTTEFWLGNEKIHLITTQSTLPYALRIELEDWSGKKGTADYAVFKVGTEEDKYRLTYAYFIGGEAGDAFDGFNFGDDPSDKSYTYHNGMRFSTFDNDNDNFEGNCAEQDGSGWWMNRCHAGHLNGPYYIGGVYSRDTGTNSYDNGIIWATWRDRWYSMKKTTMKIIPFNRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha subunit
total genus 125
structure length 390
sequence length 390
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
C PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1m1jC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1m1jC02
2J61B 1RE3A 2Q9IA 2A45I 1FZCB 1RF0B 4M7FA 2JHKF 4R9TA 1FZBA 1M1JA 3GHGC 1FZCC 2OYHA 1JY2N 1FZEC 1FZAC 2J3OA 2J60A 3HUSA 2J3GA 2H43A 1JY3N 2J3FA 1Z3UA 3BVHB 1N73A 1Z3SA 2Z4EA 2JHMF 3H32B 1FZBB 1M1JB 1N86B 2J3FD 4M7HA 2HPCB 3GHGB 1FZDA 1RE4A 1N73C 2J64A 1FIBA 1RF0C 2H43B 1FZFC 1JY2O 2HLOA 1JC9A 3H32A 1N86A 1RE3B 2HPCA 2J1GA 1FZCA 2Q9IB 2J0GA 1RE4B 1W2EA 1FICA 1LTJB 1FZGB 2OYIC 1RF1C 2WNPF 1FZFA 2OYHB 1RF1B 2FFDA 1LWUB 2FFDC 1LTJC 4JYOX 3E1IC 1LT9B 3FIBA 3HUSB 2OYIA 2J3UA 2GY7A 1FIDA 2FIBA 2XNXC 3BVHA 2J0YA 2J2PA 4ZFGA 2XNXB 2Z4EB 1FZGA 1JY3O 2HODB 1FZFB 4NYTA 2H43C 2J5ZA 3HUSC 1LWUA 2HLOC 1LT9A 2OYIB 1RF0A 2OYHC 2HLOB 2JHLF 1FZBC 4EPUA 1RE4C 2D39A 2HODA 2HODC 2JHIF 2Z4EC 1RE3C 1LTJA 2J0HA 1FZAA 1FZEA 1LT9C 3E1IB 2A45H 1N73B 1RF1A 1LWUC 2FFDB 2J61A 1M1JC 3GHGA 2A45G 1FZGC 1JY3P 2JHHC 4JZCA 2HPCC 1N86C 1T3UA 3BVHC 3H32C 2XNXA 1JY2P 4R9JA 1FZAB 2Q9IC 1FZEB 3E1IA
chains in the Genus database with same CATH superfamily
3P8CE 5KJ7D 2XKMA 4H13C 2UWJE 2E76D 2GUVA 1YJ9P 2R5DA 3NMDA 4WVZA 2WSEH 3M9BA 3JC22 1KB9D 2Y9YA 3AEBC 1KB9I 1OVVA 5L8RJ 3FWLA 1KB9H 2QRXA 2H43B 4H44C 1JNMA 3L73G 1QL1A 4OVNF 5CHXA 3L75D 2WPRA 4U3FG 4N6JA 2GA1A 3H1KJ 3H1HE 4D6TD 2WSFH 3HUSB 2G3AA 3L73J 2XNXB 2L91A 2P7JA 1DD4A 3AE5C 3C9IA 1JY3O 4C7RA 1KV4A 2H43C 3TNUB 3P8CD 3W67A 2H88C 2KNCB 3L36A 5AW6B 3AE9C 1SQVK 4EPUA 2WPSA 2IYOA 1YYCA 2G8YA 3H1IG 1K8AQ 2N9YB 1PPJE 4WB4A 3CI9A 1VQ8P 1LWUC 1KILC 2P67A 3AE7C 3HE5B 1JY3P 1NTZK 1FAVA 3R2PA 1PZQA 3E1IA 2WZ7A 1N7SC 3CWBD 2J61B 3K5BA 5KLVK 3RK3E 3QH9A 1SFCD 4HJGH 3CPWO 1EXJA 2YIUB 5KLVE 1KFMA 3HUSA 4WWIA 2FXOA 4W7ZA 1Z3SA 1P84H 2Q5UA 3SSUA 1LP1A 2BEQD 3TNUA 1N73C 4Y99B 2PAJA 2RN0A 1XTGB 3VP8A 4IFDK 3H32A 2YNYA 3CD6P 1JCCA 1IO4A 2KI7B 4OGQB 4XFJA 4EYYQ 3KXDA 2CK3H 3TDKA 2OYIC 1U57A 1U7JA 3H1JD 3BCCD 1BE3G 1PGQA 2Z4EB 2ZYDA 2M5AB 2JO1A 1Y47A 3AEEC 1LT9A 3H1HD 1T6AA 2OYHC 1Q82Q 2OARA 3S1KA 1FC2C 3IFMA 2ZFCA 1PPJD 2VRSA 1BDCA 1M1JC 3AEDC 2A45G 1VQLP 5APSA 1SFCC 3H1LE 4QMAA 5AW3B 1RE3A 2WSCH 3H1LG 2RH0A 4R9TA 3JCUE 3FXDA 1S5LX 4YTPC 1JY2N 3L70J 1FZEC 4Y28J 3OJAB 1ZR4A 2O1KA 1VF5D 3MZWB 5CBNA 4ZNCA 5E79H 2Z4EA 1MZ9A 2M5AA 3LIEA 1SQXK 2YO3A 2DW3A 1HTLC 1L0NK 2QEXP 1L0LD 1ZMEC 1PPJG 1EZVD 4ASWA 1SQXE 3L70E 1S4XA 1IK7A 3EFFK 3KPEA 3V6IA 3TGUD 4Z1MH 1BE3D 1YIJP 2FYUE 2JJLA 1J1DB 1NAYA 1ZOYC 4JYBA 5CBOA 5KLVJ 1ZRTE 2JHLF 3BRTB 1G1JA 1U7MA 2KLVA 3OAKA 1L2PA 2Z4EC 1LT1A 3BASA 4TT3H 1FZEA 4L75A 4HB1A 1FS0E 2Q1KA 1EDJA 2Y0CA 4OGQC 1VQKP 1VQMP 2HPCC 2IFNA 3RBXA 1SQXG 1EXIA 5KTBA 4EDFA 1FU1A 3M9QA 3HD7A 1SFCA 4JF7A 5KAIH 4N78E 1M1JA 3WUTA 3L70D 4BXLA 1L0LK 3L74D 3RL0D 2XU6A 2E74C 1JOCA 4U3FE 5B5EE 3KYQA 3A5TA 2BCCE 1NTKD 2PRRA 3VYIA 1L0LG 1KQSO 1LP1B 1NU1J 2AXTE 1SQPG 2BASA 4OWFA 2YKQA 1RE4B 4WY4D 3H1KE 1R5LA 1BGYJ 2KZJA 2WNPF 3HD7C 3BCCJ 1LWUB 1KN7A 2O3JA 1KQLA 1Z56A 4LC1A 2OYIA 2GY7A 2R32A 1G2CA 1IJDB 2BEZF 2HFED 4DJGA 3MTUE 1FOSF 1GW3A 1E79H 3HD7B 1SQVD 1NU1E 3AECC 3QWOC 1QL2A 1GD2E 1AVYA 2HR3A 2W6AA 1IC2A 4NPFX 3E7KA 1NTZJ 1J2JB 1DEBA 1RF1A 3HE4A 5APTA 1YTZT 1LJ2A 1AJYA 4JZCA 4WY4B 4AYCA 4ASVA 1JMMA 3L71G 3SFDC 3PTZA 1M90Q 4XE5B 1SVFA 1KYOD 3L37A 5E79E 3MHVA 3JSVC 3FGAD 5AVZB 1NGMB 2M0BA 1NTZE 1USDA 3TSIA 1SQVG 4I1LA 3CL3D 3BVHB 1GW4A 3D6ZA 2R44A 5KAFE 2Q6QA 5K5GB 3RL0B 2FYUG 3M91A 3F89A 5AW4B 1LTGC 1NTKG 1NU1D 2KSEA 1L0NE 2FXPA 1NKZB 2P10A 1PP9E 1DD3A 2B88A 1KD1Q 3N7NA 1OZHA 3P8MC 1RF1B 3H1JJ 3Q2YA 2O1JA 1N2DC 4WY4A 2J2PA 5B66E 2B89A 1YITP 1YTZI 3O8ZA 1VQ6P 3B5ND 1DIPA 1VPCA 1UIIA 2IPPA 1URQC 2OYOA 2QM8A 5M1BA 1LT9C 1YQ3C 2XDJA 1IK9A 4H44D 3C1LA 2ZXEB 3A3YB 5CCHD 1SLQA 3CXHE 3V4WA 2LXBA 3L71D 1FZEB 1S9KE 1SQQG 2J5UA 2WTYA 3D6YA 4PJ0E 3L75G 5B5EH 3SWFA 3A0HE 3GHGC 1NTMK 1S5LH 2N1TA 2IFMA 3RGUA 2WSSH 1URQD 3CCQP 1N73A 4H13D 1SQBK 1NOHA 4UB8H 1UIXA 4GKGA 2KP8A 3AE1C 3RK2D 1URQB 3EQ2A 3W68A 1GMJA 1JC9A 4K3AA 5AVXB 1G1IA 4HKZH 1N86A 3GMAA 2KIKA 1AA0A 1VQOP 4PD4H 1FZGB 3CX5D 3Q5RA 1HJBA 3TGUJ 1LTJC 1BGYD 3E1IC 3CCLP 4JBZA 2J3UA 3LW5H 2W83C 1M56D 3Q5SA 1GK6A 4W7YA 1MFTA 3L71J 4NYTA 2NPSD 3CWBG 4IL6E 1LWUA 3CCEP 5KLIC 2K1AA 5AVWB 2OYIB 5BVZA 3CCJP 1VQPP 1LTIC 2HG5D 3S9OA 2Q3IA 1VQ5P 1FZAA 4RESB 5AVSB 4TLFA 2PP6A 3A2AA 2FFDB 1OX3A 3RL0g 5TISH 2YMKA 1SQBG 1IFPA 4WBAA 2Q9IC 3PJSK 5DJUB 1RF0B 2RMZA 2IBZE 4GOFA 4DZOA 3KHUA 1VF5B 1Q81Q 3FX0A 2LR2A 4D6TG 1Q2NA 2R3CA 1FDOA 3L74J 4KHXA 3CC7P 1BSNA 5CJ0A 3B71A 3H25A 4JQ0D 5CJ4A 3LIDA 2O01N 1NTZG 5KAFH 4I7ZC 1MUUA 2WVRA 1OXZA 1T8ZA 3CXHD 1T2KD 1H88A 2HODB 4W80A 1HF9A 1SQXJ 4EOTA 3PRJA 2QIWA 3N4XA 1RF0A 1SQQJ 5AVTB 5GTHH 1X9VA 4JYCA 2NPSA 1KILD 3CXHH 2C9LY 5AVYB 1SQPJ 1KYOI 1ZXGA 2QA4P 1QVGO 2JKVA 3L73E 5AW7B 4MN4C 1HGVA 1W5CE 4PV1C 2WQYC 3BVHC 2GUSA 3EFGA 3MUDC 1NHLA 2E75B 4R9JA 4O9BA 2WWWA 4L76A 1D7MA 2A45I 1ZRTD 1KB9E 5DJTB 1FDMA 4EIJA 2IX7C 3D70A 1FZBA 4N78D 1NKNA 1MV8A 2M3EA 4GT1A 2J3OA 5KJ7A 4XA4A 3TF5A 3TGUE 2AXCA 1DX7A 2J3FA 2W6JH 1Q7YQ 4M7HA 3A0HH 2HPCB 1FZDA 2N1TB 1KTMA 3G3ZA 1FZFC 3H1IJ 1JY2O 1GZLA 2JR8A 1A02J 3OW2O 2OQQA 3V2PA 1IFDA 3AE2C 1FZFA 3B5NB 4ZKUA 4GOEA 4C46A 1HVVA 4PJ0H 3FIBA 2AEFA 1SS1A 2C0WA 1SQXD 4BWNA 1FZGA 3UIAA 2FYUK 3I56P 5KJ7C 1Y8AA 4BRYB 5AW1B 2QJKB 2NRGA 1FZBC 4UB6H 1RE4C 4IOIH 1LTSC 5TISE 4I7ZB 1H8AA 2FKWB 2W90A 1FE6A 2IZ1A 1PP9J 3M0AA 3U1AA 2A45H 2FXMA 1OFCX 1L0LE 3NFQA 1PFIA 4U3FJ 2I8DA 2B87A 3AEAC 3CWBJ 1FZAB 1NTMJ 2IBZI 3GW6A 2Y0DA 3MD0A 3LW5J 2KK7A 2NPSC 1DEEG 1EZVG 1L4AA 4EI2A 1FJKA 4N3YB 4JPZB 4L74A 2O01H 1T2KC 1NTKK 4L73A 2HYNA 3I55P 3ZDMA 2FYNB 1RQVA 3PH0A 4DCKA 3L72D 1L4AC 3RK2C 1J1EB 1VQ4P 1GL2C 1JMBA 4OGQD 2P1JA 4R4MA 3U1CA 1L4AD 5CCHA 1FZCA 1T3JA 1ZV8A 3H1HG 1FICA 1BCCG 3C8VA 3H1KD 1X22A 2OYHB 3L75J 2KUBA 1H89A 3O6QA 2A06D 3JCUH 3L71E 1J1EC 3RK2B 3H6PA 2AEMA 2HLOC 1L4AB 3NTNA 1HJ0A 4C7NA 4GDOA 2K9JB 3L70G 3V2NA 2H89C 3V5BA 3T97B 2IBZG 1S1CX 3D71A 1GU4A 2BCCG 4H0LB 2D2CD 3B5NC 1L0NG 5EFWB 1EDKA 2YO2A 5AW2B 2PGDA 1E5WA 1OW8A 3VMXA 1EC5A 1FZCB 3MP7B 5AW5B 1RQUA 4LLHA 1M8OB 2K3RA 2L5GB 1P84I 2KYVA 1NYHA 2WMMA 1KYOH 1K73Q 1BE3J 1FZBB 1M1JB 2ZVNB 2QJKC 1P84D 1GL2D 1KILB 3I5CA 1USEA 3KZIE 3MUDA 1AQ5A 2CPSA 2C0XA 1BCCD 3MIWA 5GTHE 2E43A 3S4RA 4DT0A 2KSJA 5KAIE 1NTMD 1LGHB 1FIDA 2JWAA 1SQQK 2A06G 4D6TJ 3BCCE 3CX5I 1SQBJ 3V2QA 1FZFB 2W6BA 1BSHA 1QGKB 2ZT9B 3PHLA 3VP9A 2N1TC 2XZRA 1OVUA 3USSA 1S5LE 3M0DA 1NU1K 3FWNA 2HODC 2JDIH 4BRYA 2GM4A 4H44B 3MGNA 1N73B 1IFMA 3EWKA 3RL0C 1LTAC 1NTME 1M7LA 2MJZA 5APYA 1QEXA 1SQPK 2IYPA 1HUCA 1NU1G 2MKVA 2E76C 1URQA 3H1ID 2N9BA 3H1IE 2B87B 1YI2P 2KS1A 3VOPA 2KZIA 4M7FA 4IFMA 2A06E 3H1HJ 2QG4A 4K35A 3L72E 4LGDE 2ZXXA 4H13B 3IR9A 4IFFA 1SQPD 2AXTH 2D2CC 4UB6E 3HD7D 1Z3UA 3L72J 1KORA 2E5TA 4WY4C 3F5HA 4IL6H 1R8EA 1N7SD 1PGPA 3CCSP 2WPVB 1SQVJ 1NVOA 2Q9IB 1CZQA 1VQ7P 5CCGA 2Z5IA 4YXWH 2FYUJ 3AE6C 2FFDA 2FFDC 4JYOX 5CCGC 1NTMG 2RKLA 2Z5HA 2KNCA 2XNXC 3CXHI 3P7KA 3WMM0 4HH2A 2K37A 2J5ZA 3NXSA 3OA7A 1SQQD 1SQVE 1N7LA 1VL2A 1SP4A 3CC2P 3O6QB 1OVRA 1RH5B 5KLIB 5CCGD 2ZYGA 3VMAA 5APXA 3GF7A 1JEKA 1LTJA 1JUNA 1VF5C 2I1JA 4U3FD 4RJTA 2E75D 2J61A 2FBWC 5H2FE 1Y9BA 3T97A 1ZLLA 2B9BA 1N86C 1T3UA 3FXEA 1KZUB 4NPDA 5AVRB 2KOGA 3KDPB 2C9NY 3BATA 5AW9B 1IFNA 4D6TE 2QVAA 1OMIA 2WSEJ 1N8RQ 3Q1MA 2KB7P 4R4LA 4I6MC 1BGYG 3G9RA 1QLED 2KXPB 2J3GA 3L74E 3V4QA 1QX8A 1K05A 2POHA 1S72P 3M0DC 2M3BA 3IF4A 2ZJSE 1FDIA 1FIBA 2QJPB 4IL6X 1YJWP 3CC4P 2J0GA 3L75E 4YPCA 3HTKA 4H0LC 3SWYA 4DOJA 3CCRP 2AEJA 1J1DC 2OTJP 1KFNA 2R3SA 3RK3B 3VN0A 1HH0A 3A0BH 1NWQA 1KYOE 4PD4I 2HLOB 2QJYC 1MKMA 1NTKJ 1H0TB 1PP9D 2QJPC 1OW6A 3KZIH 1EZVI 1JCDA 4KJMA 2Q7CA 3H1LJ 3HRNA 1RHZB 3IN6A 1S2EA 2XNXA 2I1KA 2CPBA 5B66H 3AE3C 1VQNP 2FYUD 3WUVA 5APWA 2JHKF 4A7PA 3B5NA 1BCCJ 3HTKB 1JM0A 4H0LD 2Q3EA 3G6EP 2W27A 4KT0J 2ITAA 2KS1B 3A7OA 1JB0J 3CCUP 1GDTA 2V4HA 2SPZA 3VMYA 2J64A 1S3JA 3WU2H 2V7QH 1ZW0A 3Q3DA 3GF3A 2HLOA 1YBKA 1NJIQ 3L72G 2J1GA 4CPGA 2WPQA 3AEGC 3PP5A 1RF1C 1Q90D 5KLVG 3H1JE 3L35A 2BCCJ 2XV5A 2ZVOB 3B4SA 2WT7B 2JWDA 1FJPA 3U59A 3AE4C 1M1KQ 2E42A 1IFJA 1R5SA 3V2RA 1GL2A 1DH3A 3RK3D 2YXRB 3Q5PA 2FYZA 1AVOA 2HODA 5GTIE 5H2FH 1GTWA 1L0LJ 4B86A 2JHIF 2KLUA 1RE3C 1RY3A 1M57D 1NAFA 1BGYE 1NTKE 2WITA 4Y99C 1YHQP 3WUUA 3E1RA 2IBZD 3BCCG 3TGUG 2NPSB 2JHHC 1KC8Q 2IDBA 3IAOA 2D2CB 2N1TD 2WSCJ 1AV1A 1MFZA 2IZ0A 1SQBE 3AE8C 1HGZA 3H1KG 1LTTC 1SQPE 2OYHA 1NTZD 2E76B 2J60A 4M3LA 3G4SP 1N7SB 3TYYA 2WT7A 4I2LC 3GLMA 2R5BA 1PGOA 1YJNP 1KILE 1RE4A 2QSIA 4C7NB 3AEFC 4ZMDA 2K9JA 1AQTA 1KQFB 1RE3B 2OGUA 1ZR2A 2J59M 2HPCA 2E75C 3H1JG 3VMZA 1NO4A 4PV1B 1VDFA 2BCCD 2ZT9C 1FOSE 3KQGA 2W8ZA 1L0ND 2J58A 1PV3A 2JEEA 5C39A 2YXQB 1VQ9P 4ZFGA 1OIPA 5AVVB 1KMIZ 3HUSC 2K88A 2YKOA 1WRGA 5TJHA 2D39A 5BU8B 1OWAA 2E74B 3CX5H 1FBMA 2ZT9D 1N7SA 2J0HA 2LKMA 2QM7A 2YKPA 4UB8E 1H0TA 1NH4A 3H1LD 1JY2P 1KILA 2JP3A 1QVFO 5AW0B 1X0TA 3G71P 1TU3F 5AVUB 2PFXA 1CSBA 5CCHC 1FZCC 1BCCE 1LNQA 1KQGB 1S9KD 2NZ2A 1GU5A 1LTBC 1AFOA 2H43A 1EQ7A 1JY3N 1BE3E 5CMZA 3CLQA 4AUWA 2WSFJ 1SQQE 1W2BO 1RF0C 2OTLP 4GODA 1K04A 1HWTC 3A0BE 1SFCB 5APVA 1K9MQ 1ZN5A 3WU2E 3CCMP 2E74D 1OW7A 2ZAEB 3L74G 1Q86Q 2XNDH 2Y0EA 2FIBA 3RK3C 3II6A 5KKZC 2FY8A 2H8PD 4PD4E 1X8YA 1PIXA 1ZP0C 2QE7H 3RBZA 4HYTB 2E5YA 3HE5A 3SFEC 1P84E 3R4YA 2V7QJ 1GL2B 3BRVB 4GIFA 1WT6A 2M8RA 5AW8B 3E1IB 2LXCB 1GK4A 1PP9G 1FZGC 1G2CB 1PGJA 2YMYA 3H32C 2FYNC 4U7JA 3CMEP 1BDDA 2Y9ZA 1A02F 1JO5A 2Q9IA 4AQRD 1XTCC 3VTPC 4YXDC 4RO0A 5APUA 1SQBD 1FZAC 3CMAP 3SWKA 5GTIH 2JHMF 1CI6A 1HBWA 1JTHB 2YIUC 3H32B 2J3FD 1N86B 3HE4B 3CCVP 3GHGB 2OTKE 1EDLA 3ITKA 4PD4D 2O01J 2K9YA 3M9HA 2QJYB 4NPEA 1W2EA 5APQA 1LTJB 3B8EB 2P2UA 1L0NJ 4RKUJ 1LT9B 3PLNA 3BVHA 2J0YA 5KKZB 3P32A 3M06A 2ZYAA 5KLVD 1IZNB 3ABVC 5AVQB 1EDIA 1CW5A 4PV1D 1YQ4C 2H7HA 1IFIA 1PL5A 4ZKPA 1CI6B 1JTHA 1WMKA 3GHGA 3L73D 4OH8B 1X79B 3TK1A 5BU5A 2P58A 3CX5E 1EZVE 3L4FA 3GG2A 3CWBE
chains in the Genus database with same CATH topology
3MD0A 2CPBA 1SVFA 3P8CE 5KJ7D 2NPSC 2XKMA 1L4AA 1FJKA 4N3YB 3L37A 2GUVA 5APWA 2JHKF 2R5DA 2O01H 5AVZB 3NMDA 3B5NA 2WSEH 1NTKK 3HTKB 1T2KC 3M9BA 2HYNA 2W27A 3TSIA 4I1LA 3A7OA 3CL3D 3BVHB 1GW4A 1GDTA 1L4AC 3VMYA 2J64A 3RL0B 3M91A 3RK2C 5AW4B 1LTGC 2H43B 1J1EB 1GL2C 2HLOA 2P1JA 3U1CA 1JNMA 1L4AD 2J1GA 5CCHA 1FZCA 2WPQA 1T3JA 1NKZB 1ZV8A 1QL1A 5CHXA 1FICA 3PP5A 1RF1C 2WPRA 3N7NA 4N6JA 3P8MC 2OYHB 1RF1B 3L35A 2WSFH 2O1JA 2XV5A 3HUSB 1H89A 2WT7B 1N2DC 1FJPA 4WY4A 3U59A 2J2PA 2XNXB 2E42A 2P7JA 1IFJA 3C9IA 1JY3O 4C7RA 1J1EC 3RK2B 2H43C 3TNUB 3H6PA 3V2RA 1GL2A 2HLOC 1DH3A 3P8CD 1L4AB 3NTNA 4C7NA 5AW6B 3L36A 3RK3D 1SQVK 4EPUA 2FYZA 2WPSA 2HODA 3V2NA 1GTWA 1YYCA 3V5BA 1YTZI 3O8ZA 4B86A 3B5ND 2JHIF 1RE3C 1VPCA 1RY3A 4WB4A 1NAFA 2IPPA 1URQC 2QM8A 1LT9C 3CI9A 2XDJA 1GU4A 1LWUC 1KILC 2P67A 2WITA 4Y99C 3HE5B 3B5NC 1IK9A 1JY3P 2ZXEB 2NPSB 2JHHC 3A3YB 5CCHD 1SLQA 3V4WA 2YO2A 1NTZK 5AW2B 1FAVA 1FZEB 3R2PA 3E1IA 2N1TD 1S9KE 2WZ7A 1N7SC 1MFZA 2J61B 1E5WA 3VMXA 1FZCB 5KLVK 2WTYA 5AW5B 1SFCD 1HGZA 4LLHA 1LTTC 3SWFA 3GHGC 1NTMK 2OYHA 2N1TA 2L5GB 2IFMA 1KFMA 3HUSA 4M3LA 1N7SB 2J60A 3TYYA 2WT7A 4I2LC 2KYVA 4W7ZA 1URQD 1N73A 1Z3SA 2R5BA 1SQBK 2Q5UA 1NOHA 1FZBB 1M1JB 3TNUA 4GKGA 1RE4A 1N73C 2KP8A 4Y99B 2PAJA 1GL2D 1KILB 4C7NB 3I5CA 3RK2D 1XTGB 1URQB 3VP8A 3EQ2A 1JC9A 5AVXB 4IFDK 1G1IA 3H32A 3MUDA 1AQ5A 1N86A 1RE3B 2HPCA 1ZR2A 2J59M 2YNYA 3VMZA 1JCCA 1IO4A 2CPSA 2C0XA 1NO4A 3MIWA 2OYIC 1FZGB 1VDFA 1HJBA 1FOSE 3KQGA 1LTJC 2E43A 3E1IC 2J58A 2KSJA 2JEEA 3LW5H 2J3UA 1LGHB 1FIDA 1SQQK 4ZFGA 2Z4EB 1GK6A 3V2QA 5AVVB 4W7YA 1FZFB 2W6BA 4NYTA 2NPSD 3HUSC 1LWUA 1LT9A 3VP9A 2N1TC 5AVWB 2YKOA 2OYIB 2XZRA 2OYHC 1WRGA 5BVZA 2OARA 2D39A 3M0DA 1NU1K 2HODC 5BU8B 1LTIC 1OWAA 2HG5D 2GM4A 1FBMA 3MGNA 1N7SA 2Q3IA 3IFMA 2LKMA 2J0HA 2ZFCA 1FZAA 2QM7A 4RESB 2YKPA 1N73B 2VRSA 1IFMA 5AVSB 2FFDB 2PP6A 3A2AA 3RL0C 1LTAC 1M7LA 1M1JC 2A45G 3BVHC 2MJZA 1NH4A 5APYA 1JY2P 1KILA 1SQPK 5APSA 4WBAA 1HUCA 1SFCC 2Q9IC 1URQA 5AW3B 5AW0B 1RE3A 2N9BA 2WSCH 1RF0B 5AVUB 3VOPA 1CSBA 4M7FA 4IFMA 4DZOA 4R9TA 4LGDE 5CCHC 1FZCC 3IR9A 4IFFA 1S9KD 1JY2N 1FZEC 1GU5A 1LTBC 3OJAB 1AFOA 1ZR4A 3HD7D 2H43A 2O1KA 2R3CA 1EQ7A 1JY3N 1Z3UA 4KHXA 2Z4EA 5CMZA 3CLQA 1MZ9A 4WY4C 4AUWA 3LIEA 5CJ0A 1SQXK 2YO3A 1N7SD 1HTLC 5CJ4A 1RF0C 1L0NK 3LIDA 1HWTC 1SFCB 2Q9IB 5APVA 1ZN5A 1MUUA 1CZQA 1OXZA 1T8ZA 5CCGA 2Z5IA 2FFDA 2FFDC 4JYOX 1T2KD 5CCGC 3KPEA 1H88A 2Z5HA 2FIBA 2XNXC 3RK3C 2JJLA 3II6A 3P7KA 3WMM0 2HODB 4HH2A 4W80A 4EOTA 2J5ZA 1J1DB 3NXSA 3OA7A 4JYBA 1N7LA 3N4XA 2H8PD 1RF0A 1SP4A 1X8YA 5AVTB 2JHLF 3BRTB 1G1JA 4HYTB 2KLVA 3HE5A 1X9VA 3OAKA 4JYCA 5CCGD 2Z4EC 2NPSA 1KILD 5APXA 1GL2B 3BASA 2C9LY 5AVYB 1LTJA 3BRVB 4GIFA 1WT6A 1JUNA 2M8RA 5AW8B 1FZEA 3E1IB 2I1JA 2J61A 5AW7B 1GK4A 1HGVA 3T97A 1FZGC 1ZLLA 1G2CB 2HPCC 2YMYA 1T3UA 2IFNA 1KZUB 3EFGA 2GUSA 1NHLA 1N86C 3H32C 4R9JA 5AVRB 2KOGA 3KDPB 4O9BA 5KTBA 2WWWA 2C9NY 3BATA 1FU1A 1A02F 3M9QA 1JO5A 3HD7A 1SFCA 2A45I 4AQRD 4JF7A 2Q9IA 1XTCC 5AW9B 3VTPC 1IFNA 1FDMA 4EIJA 4N78E 2IX7C 2KB7P 1FZBA 1M1JA 4N78D 4I6MC 1L0LK 5APUA 1NKNA 1MV8A 3RL0D 2XU6A 4GT1A 1FZAC 1JOCA 2J3OA 5KJ7A 2J3GA 4XA4A 1DX7A 2J3FA 3V4QA 1CI6A 2JHMF 1HBWA 1JTHB 2POHA 3H32B 2J3FD 1N86B 3HE4B 4M7HA 2HPCB 3GHGB 3M0DC 2M3BA 1FZDA 2N1TB 3KYQA 1FIBA 3A5TA 3G3ZA 1FZFC 3VYIA 1JY2O 1GZLA 1A02J 3M9HA 2BASA 2J0GA 2YKQA 1RE4B 1W2EA 4WY4D 5APQA 3V2PA 1LTJB 1IFDA 3B8EB 2P2UA 2WNPF 3HD7C 1FZFA 3B5NB 3HTKA 4ZKUA 4C46A 1LWUB 3SWYA 1KQLA 1HVVA 4DOJA 1Z56A 1LT9B 4LC1A 3FIBA 1J1DC 2OYIA 2GY7A 2R32A 1G2CA 3BVHA 2J0YA 2C0WA 1KFNA 1IJDB 1FZGA 3P32A 3RK3B 3M06A 3UIAA 2HFED 3VN0A 2FYUK 1HH0A 3MTUE 5KJ7C 1FOSF 1GW3A 5AVQB 3HD7B 1NWQA 5AW1B 2HLOB 1FZBC 1QL2A 1RE4C 1GD2E 1CW5A 1LTSC 2W6AA 1IC2A 1H8AA 2H7HA 2FKWB 1IFIA 4ZKPA 3M0AA 1J2JB 1DEBA 3U1AA 2A45H 2FXMA 1RF1A 1CI6B 1JCDA 1JTHA 3NFQA 2Q7CA 3HE4A 1PFIA 3HRNA 3GHGA 5APTA 1YTZT 4OH8B 1X79B 3TK1A 4JZCA 4WY4B 5BU5A 2XNXA 4AYCA 1JMMA 3L4FA 1FZAB 2I1KA 4XE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J61 B;  1RE3 A;  2Q9I A;  2A45 I;  1FZC B;  1RF0 B;  4M7F A;  2JHK F;  4R9T A;  1FZB A;  1M1J A;  3GHG C;  1FZC C;  2OYH A;  1JY2 N;  1FZE C;  1FZA C;  2J3O A;  2J60 A;  3HUS A;  2J3G A;  2H43 A;  1JY3 N;  2J3F A;  1Z3U A;  3BVH B;  1N73 A;  1Z3S A;  2Z4E A;  2JHM F;  3H32 B;  1FZB B;  1M1J B;  1N86 B;  2J3F D;  4M7H A;  2HPC B;  3GHG B;  1FZD A;  1RE4 A;  1N73 C;  2J64 A;  1FIB A;  1RF0 C;  2H43 B;  1FZF C;  1JY2 O;  2HLO A;  1JC9 A;  3H32 A;  1N86 A;  1RE3 B;  2HPC A;  2J1G A;  1FZC A;  2Q9I B;  2J0G A;  1RE4 B;  1W2E A;  1FIC A;  1LTJ B;  1FZG B;  2OYI C;  1RF1 C;  2WNP F;  1FZF A;  2OYH B;  1RF1 B;  2FFD A;  1LWU B;  2FFD C;  1LTJ C;  4JYO X;  3E1I C;  1LT9 B;  3FIB A;  3HUS B;  2OYI A;  2J3U A;  2GY7 A;  1FID A;  2FIB A;  2XNX C;  3BVH A;  2J0Y A;  2J2P A;  4ZFG A;  2XNX B;  2Z4E B;  1FZG A;  1JY3 O;  2HOD B;  1FZF B;  4NYT A;  2H43 C;  2J5Z A;  3HUS C;  1LWU A;  2HLO C;  1LT9 A;  2OYI B;  1RF0 A;  2OYH C;  2HLO B;  2JHL F;  1FZB C;  4EPU A;  1RE4 C;  2D39 A;  2HOD A;  2HOD C;  2JHI F;  2Z4E C;  1RE3 C;  1LTJ A;  2J0H A;  1FZA A;  1FZE A;  1LT9 C;  3E1I B;  2A45 H;  1N73 B;  1RF1 A;  1LWU C;  2FFD B;  2J61 A;  1M1J C;  3GHG A;  2A45 G;  1FZG C;  1JY3 P;  2JHH C;  4JZC A;  2HPC C;  1N86 C;  1T3U A;  3BVH C;  3H32 C;  2XNX A;  1JY2 P;  4R9J A;  1FZA B;  2Q9I C;  1FZE B;  3E1I A; 
#chains in the Genus database with same CATH topology
 3P8C E;  5KJ7 D;  2XKM A;  4H13 C;  2UWJ E;  2E76 D;  2GUV A;  1YJ9 P;  2R5D A;  3NMD A;  4WVZ A;  2WSE H;  3M9B A;  3JC2 2;  1KB9 D;  2Y9Y A;  3AEB C;  1KB9 I;  1OVV A;  5L8R J;  3FWL A;  1KB9 H;  2QRX A;  2H43 B;  4H44 C;  1JNM A;  3L73 G;  1QL1 A;  4OVN F;  5CHX A;  3L75 D;  2WPR A;  4U3F G;  4N6J A;  2GA1 A;  3H1K J;  3H1H E;  4D6T D;  2WSF H;  3HUS B;  2G3A A;  3L73 J;  2XNX B;  2L91 A;  2P7J A;  1DD4 A;  3AE5 C;  3C9I A;  1JY3 O;  4C7R A;  1KV4 A;  2H43 C;  3TNU B;  3P8C D;  3W67 A;  2H88 C;  2KNC B;  3L36 A;  5AW6 B;  3AE9 C;  1SQV K;  4EPU A;  2WPS A;  2IYO A;  1YYC A;  2G8Y A;  3H1I G;  1K8A Q;  2N9Y B;  1PPJ E;  4WB4 A;  3CI9 A;  1VQ8 P;  1LWU C;  1KIL C;  2P67 A;  3AE7 C;  3HE5 B;  1JY3 P;  1NTZ K;  1FAV A;  3R2P A;  1PZQ A;  3E1I A;  2WZ7 A;  1N7S C;  3CWB D;  2J61 B;  3K5B A;  5KLV K;  3RK3 E;  3QH9 A;  1SFC D;  4HJG H;  3CPW O;  1EXJ A;  2YIU B;  5KLV E;  1KFM A;  3HUS A;  4WWI A;  2FXO A;  4W7Z A;  1Z3S A;  1P84 H;  2Q5U A;  3SSU A;  1LP1 A;  2BEQ D;  3TNU A;  1N73 C;  4Y99 B;  2PAJ A;  2RN0 A;  1XTG B;  3VP8 A;  4IFD K;  3H32 A;  2YNY A;  3CD6 P;  1JCC A;  1IO4 A;  2KI7 B;  4OGQ B;  4XFJ A;  4EYY Q;  3KXD A;  2CK3 H;  3TDK A;  2OYI C;  1U57 A;  1U7J A;  3H1J D;  3BCC D;  1BE3 G;  1PGQ A;  2Z4E B;  2ZYD A;  2M5A B;  2JO1 A;  1Y47 A;  3AEE C;  1LT9 A;  3H1H D;  1T6A A;  2OYH C;  1Q82 Q;  2OAR A;  3S1K A;  1FC2 C;  3IFM A;  2ZFC A;  1PPJ D;  2VRS A;  1BDC A;  1M1J C;  3AED C;  2A45 G;  1VQL P;  5APS A;  1SFC C;  3H1L E;  4QMA A;  5AW3 B;  1RE3 A;  2WSC H;  3H1L G;  2RH0 A;  4R9T A;  3JCU E;  3FXD A;  1S5L X;  4YTP C;  1JY2 N;  3L70 J;  1FZE C;  4Y28 J;  3OJA B;  1ZR4 A;  2O1K A;  1VF5 D;  3MZW B;  5CBN A;  4ZNC A;  5E79 H;  2Z4E A;  1MZ9 A;  2M5A A;  3LIE A;  1SQX K;  2YO3 A;  2DW3 A;  1HTL C;  1L0N K;  2QEX P;  1L0L D;  1ZME C;  1PPJ G;  1EZV D;  4ASW A;  1SQX E;  3L70 E;  1S4X A;  1IK7 A;  3EFF K;  3KPE A;  3V6I A;  3TGU D;  4Z1M H;  1BE3 D;  1YIJ P;  2FYU E;  2JJL A;  1J1D B;  1NAY A;  1ZOY C;  4JYB A;  5CBO A;  5KLV J;  1ZRT E;  2JHL F;  3BRT B;  1G1J A;  1U7M A;  2KLV A;  3OAK A;  1L2P A;  2Z4E C;  1LT1 A;  3BAS A;  4TT3 H;  1FZE A;  4L75 A;  4HB1 A;  1FS0 E;  2Q1K A;  1EDJ A;  2Y0C A;  4OGQ C;  1VQK P;  1VQM P;  2HPC C;  2IFN A;  3RBX A;  1SQX G;  1EXI A;  5KTB A;  4EDF A;  1FU1 A;  3M9Q A;  3HD7 A;  1SFC A;  4JF7 A;  5KAI H;  4N78 E;  1M1J A;  3WUT A;  3L70 D;  4BXL A;  1L0L K;  3L74 D;  3RL0 D;  2XU6 A;  2E74 C;  1JOC A;  4U3F E;  5B5E E;  3KYQ A;  3A5T A;  2BCC E;  1NTK D;  2PRR A;  3VYI A;  1L0L G;  1KQS O;  1LP1 B;  1NU1 J;  2AXT E;  1SQP G;  2BAS A;  4OWF A;  2YKQ A;  1RE4 B;  4WY4 D;  3H1K E;  1R5L A;  1BGY J;  2KZJ A;  2WNP F;  3HD7 C;  3BCC J;  1LWU B;  1KN7 A;  2O3J A;  1KQL A;  1Z56 A;  4LC1 A;  2OYI A;  2GY7 A;  2R32 A;  1G2C A;  1IJD B;  2BEZ F;  2HFE D;  4DJG A;  3MTU E;  1FOS F;  1GW3 A;  1E79 H;  3HD7 B;  1SQV D;  1NU1 E;  3AEC C;  3QWO C;  1QL2 A;  1GD2 E;  1AVY A;  2HR3 A;  2W6A A;  1IC2 A;  4NPF X;  3E7K A;  1NTZ J;  1J2J B;  1DEB A;  1RF1 A;  3HE4 A;  5APT A;  1YTZ T;  1LJ2 A;  1AJY A;  4JZC A;  4WY4 B;  4AYC A;  4ASV A;  1JMM A;  3L71 G;  3SFD C;  3PTZ A;  1M90 Q;  4XE5 B;  1SVF A;  1KYO D;  3L37 A;  5E79 E;  3MHV A;  3JSV C;  3FGA D;  5AVZ B;  1NGM B;  2M0B A;  1NTZ E;  1USD A;  3TSI A;  1SQV G;  4I1L A;  3CL3 D;  3BVH B;  1GW4 A;  3D6Z A;  2R44 A;  5KAF E;  2Q6Q A;  5K5G B;  3RL0 B;  2FYU G;  3M91 A;  3F89 A;  5AW4 B;  1LTG C;  1NTK G;  1NU1 D;  2KSE A;  1L0N E;  2FXP A;  1NKZ B;  2P10 A;  1PP9 E;  1DD3 A;  2B88 A;  1KD1 Q;  3N7N A;  1OZH A;  3P8M C;  1RF1 B;  3H1J J;  3Q2Y A;  2O1J A;  1N2D C;  4WY4 A;  2J2P A;  5B66 E;  2B89 A;  1YIT P;  1YTZ I;  3O8Z A;  1VQ6 P;  3B5N D;  1DIP A;  1VPC A;  1UII A;  2IPP A;  1URQ C;  2OYO A;  2QM8 A;  5M1B A;  1LT9 C;  1YQ3 C;  2XDJ A;  1IK9 A;  4H44 D;  3C1L A;  2ZXE B;  3A3Y B;  5CCH D;  1SLQ A;  3CXH E;  3V4W A;  2LXB A;  3L71 D;  1FZE B;  1S9K E;  1SQQ G;  2J5U A;  2WTY A;  3D6Y A;  4PJ0 E;  3L75 G;  5B5E H;  3SWF A;  3A0H E;  3GHG C;  1NTM K;  1S5L H;  2N1T A;  2IFM A;  3RGU A;  2WSS H;  1URQ D;  3CCQ P;  1N73 A;  4H13 D;  1SQB K;  1NOH A;  4UB8 H;  1UIX A;  4GKG A;  2KP8 A;  3AE1 C;  3RK2 D;  1URQ B;  3EQ2 A;  3W68 A;  1GMJ A;  1JC9 A;  4K3A A;  5AVX B;  1G1I A;  4HKZ H;  1N86 A;  3GMA A;  2KIK A;  1AA0 A;  1VQO P;  4PD4 H;  1FZG B;  3CX5 D;  3Q5R A;  1HJB A;  3TGU J;  1LTJ C;  1BGY D;  3E1I C;  3CCL P;  4JBZ A;  2J3U A;  3LW5 H;  2W83 C;  1M56 D;  3Q5S A;  1GK6 A;  4W7Y A;  1MFT A;  3L71 J;  4NYT A;  2NPS D;  3CWB G;  4IL6 E;  1LWU A;  3CCE P;  5KLI C;  2K1A A;  5AVW B;  2OYI B;  5BVZ A;  3CCJ P;  1VQP P;  1LTI C;  2HG5 D;  3S9O A;  2Q3I A;  1VQ5 P;  1FZA A;  4RES B;  5AVS B;  4TLF A;  2PP6 A;  3A2A A;  2FFD B;  1OX3 A;  3RL0 g;  5TIS H;  2YMK A;  1SQB G;  1IFP A;  4WBA A;  2Q9I C;  3PJS K;  5DJU B;  1RF0 B;  2RMZ A;  2IBZ E;  4GOF A;  4DZO A;  3KHU A;  1VF5 B;  1Q81 Q;  3FX0 A;  2LR2 A;  4D6T G;  1Q2N A;  2R3C A;  1FDO A;  3L74 J;  4KHX A;  3CC7 P;  1BSN A;  5CJ0 A;  3B71 A;  3H25 A;  4JQ0 D;  5CJ4 A;  3LID A;  2O01 N;  1NTZ G;  5KAF H;  4I7Z C;  1MUU A;  2WVR A;  1OXZ A;  1T8Z A;  3CXH D;  1T2K D;  1H88 A;  2HOD B;  4W80 A;  1HF9 A;  1SQX J;  4EOT A;  3PRJ A;  2QIW A;  3N4X A;  1RF0 A;  1SQQ J;  5AVT B;  5GTH H;  1X9V A;  4JYC A;  2NPS A;  1KIL D;  3CXH H;  2C9L Y;  5AVY B;  1SQP J;  1KYO I;  1ZXG A;  2QA4 P;  1QVG O;  2JKV A;  3L73 E;  5AW7 B;  4MN4 C;  1HGV A;  1W5C E;  4PV1 C;  2WQY C;  3BVH C;  2GUS A;  3EFG A;  3MUD C;  1NHL A;  2E75 B;  4R9J A;  4O9B A;  2WWW A;  4L76 A;  1D7M A;  2A45 I;  1ZRT D;  1KB9 E;  5DJT B;  1FDM A;  4EIJ A;  2IX7 C;  3D70 A;  1FZB A;  4N78 D;  1NKN A;  1MV8 A;  2M3E A;  4GT1 A;  2J3O A;  5KJ7 A;  4XA4 A;  3TF5 A;  3TGU E;  2AXC A;  1DX7 A;  2J3F A;  2W6J H;  1Q7Y Q;  4M7H A;  3A0H H;  2HPC B;  1FZD A;  2N1T B;  1KTM A;  3G3Z A;  1FZF C;  3H1I J;  1JY2 O;  1GZL A;  2JR8 A;  1A02 J;  3OW2 O;  2OQQ A;  3V2P A;  1IFD A;  3AE2 C;  1FZF A;  3B5N B;  4ZKU A;  4GOE A;  4C46 A;  1HVV A;  4PJ0 H;  3FIB A;  2AEF A;  1SS1 A;  2C0W A;  1SQX D;  4BWN A;  1FZG A;  3UIA A;  2FYU K;  3I56 P;  5KJ7 C;  1Y8A A;  4BRY B;  5AW1 B;  2QJK B;  2NRG A;  1FZB C;  4UB6 H;  1RE4 C;  4IOI H;  1LTS C;  5TIS E;  4I7Z B;  1H8A A;  2FKW B;  2W90 A;  1FE6 A;  2IZ1 A;  1PP9 J;  3M0A A;  3U1A A;  2A45 H;  2FXM A;  1OFC X;  1L0L E;  3NFQ A;  1PFI A;  4U3F J;  2I8D A;  2B87 A;  3AEA C;  3CWB J;  1FZA B;  1NTM J;  2IBZ I;  3GW6 A;  2Y0D A;  3MD0 A;  3LW5 J;  2KK7 A;  2NPS C;  1DEE G;  1EZV G;  1L4A A;  4EI2 A;  1FJK A;  4N3Y B;  4JPZ B;  4L74 A;  2O01 H;  1T2K C;  1NTK K;  4L73 A;  2HYN A;  3I55 P;  3ZDM A;  2FYN B;  1RQV A;  3PH0 A;  4DCK A;  3L72 D;  1L4A C;  3RK2 C;  1J1E B;  1VQ4 P;  1GL2 C;  1JMB A;  4OGQ D;  2P1J A;  4R4M A;  3U1C A;  1L4A D;  5CCH A;  1FZC A;  1T3J A;  1ZV8 A;  3H1H G;  1FIC A;  1BCC G;  3C8V A;  3H1K D;  1X22 A;  2OYH B;  3L75 J;  2KUB A;  1H89 A;  3O6Q A;  2A06 D;  3JCU H;  3L71 E;  1J1E C;  3RK2 B;  3H6P A;  2AEM A;  2HLO C;  1L4A B;  3NTN A;  1HJ0 A;  4C7N A;  4GDO A;  2K9J B;  3L70 G;  3V2N A;  2H89 C;  3V5B A;  3T97 B;  2IBZ G;  1S1C X;  3D71 A;  1GU4 A;  2BCC G;  4H0L B;  2D2C D;  3B5N C;  1L0N G;  5EFW B;  1EDK A;  2YO2 A;  5AW2 B;  2PGD A;  1E5W A;  1OW8 A;  3VMX A;  1EC5 A;  1FZC B;  3MP7 B;  5AW5 B;  1RQU A;  4LLH A;  1M8O B;  2K3R A;  2L5G B;  1P84 I;  2KYV A;  1NYH A;  2WMM A;  1KYO H;  1K73 Q;  1BE3 J;  1FZB B;  1M1J B;  2ZVN B;  2QJK C;  1P84 D;  1GL2 D;  1KIL B;  3I5C A;  1USE A;  3KZI E;  3MUD A;  1AQ5 A;  2CPS A;  2C0X A;  1BCC D;  3MIW A;  5GTH E;  2E43 A;  3S4R A;  4DT0 A;  2KSJ A;  5KAI E;  1NTM D;  1LGH B;  1FID A;  2JWA A;  1SQQ K;  2A06 G;  4D6T J;  3BCC E;  3CX5 I;  1SQB J;  3V2Q A;  1FZF B;  2W6B A;  1BSH A;  1QGK B;  2ZT9 B;  3PHL A;  3VP9 A;  2N1T C;  2XZR A;  1OVU A;  3USS A;  1S5L E;  3M0D A;  1NU1 K;  3FWN A;  2HOD C;  2JDI H;  4BRY A;  2GM4 A;  4H44 B;  3MGN A;  1N73 B;  1IFM A;  3EWK A;  3RL0 C;  1LTA C;  1NTM E;  1M7L A;  2MJZ A;  5APY A;  1QEX A;  1SQP K;  2IYP A;  1HUC A;  1NU1 G;  2MKV A;  2E76 C;  1URQ A;  3H1I D;  2N9B A;  3H1I E;  2B87 B;  1YI2 P;  2KS1 A;  3VOP A;  2KZI A;  4M7F A;  4IFM A;  2A06 E;  3H1H J;  2QG4 A;  4K35 A;  3L72 E;  4LGD E;  2ZXX A;  4H13 B;  3IR9 A;  4IFF A;  1SQP D;  2AXT H;  2D2C C;  4UB6 E;  3HD7 D;  1Z3U A;  3L72 J;  1KOR A;  2E5T A;  4WY4 C;  3F5H A;  4IL6 H;  1R8E A;  1N7S D;  1PGP A;  3CCS P;  2WPV B;  1SQV J;  1NVO A;  2Q9I B;  1CZQ A;  1VQ7 P;  5CCG A;  2Z5I A;  4YXW H;  2FYU J;  3AE6 C;  2FFD A;  2FFD C;  4JYO X;  5CCG C;  1NTM G;  2RKL A;  2Z5H A;  2KNC A;  2XNX C;  3CXH I;  3P7K A;  3WMM 0;  4HH2 A;  2K37 A;  2J5Z A;  3NXS A;  3OA7 A;  1SQQ D;  1SQV E;  1N7L A;  1VL2 A;  1SP4 A;  3CC2 P;  3O6Q B;  1OVR A;  1RH5 B;  5KLI B;  5CCG D;  2ZYG A;  3VMA A;  5APX A;  3GF7 A;  1JEK A;  1LTJ A;  1JUN A;  1VF5 C;  2I1J A;  4U3F D;  4RJT A;  2E75 D;  2J61 A;  2FBW C;  5H2F E;  1Y9B A;  3T97 A;  1ZLL A;  2B9B A;  1N86 C;  1T3U A;  3FXE A;  1KZU B;  4NPD A;  5AVR B;  2KOG A;  3KDP B;  2C9N Y;  3BAT A;  5AW9 B;  1IFN A;  4D6T E;  2QVA A;  1OMI A;  2WSE J;  1N8R Q;  3Q1M A;  2KB7 P;  4R4L A;  4I6M C;  1BGY G;  3G9R A;  1QLE D;  2KXP B;  2J3G A;  3L74 E;  3V4Q A;  1QX8 A;  1K05 A;  2POH A;  1S72 P;  3M0D C;  2M3B A;  3IF4 A;  2ZJS E;  1FDI A;  1FIB A;  2QJP B;  4IL6 X;  1YJW P;  3CC4 P;  2J0G A;  3L75 E;  4YPC A;  3HTK A;  4H0L C;  3SWY A;  4DOJ A;  3CCR P;  2AEJ A;  1J1D C;  2OTJ P;  1KFN A;  2R3S A;  3RK3 B;  3VN0 A;  1HH0 A;  3A0B H;  1NWQ A;  1KYO E;  4PD4 I;  2HLO B;  2QJY C;  1MKM A;  1NTK J;  1H0T B;  1PP9 D;  2QJP C;  1OW6 A;  3KZI H;  1EZV I;  1JCD A;  4KJM A;  2Q7C A;  3H1L J;  3HRN A;  1RHZ B;  3IN6 A;  1S2E A;  2XNX A;  2I1K A;  2CPB A;  5B66 H;  3AE3 C;  1VQN P;  2FYU D;  3WUV A;  5APW A;  2JHK F;  4A7P A;  3B5N A;  1BCC J;  3HTK B;  1JM0 A;  4H0L D;  2Q3E A;  3G6E P;  2W27 A;  4KT0 J;  2ITA A;  2KS1 B;  3A7O A;  1JB0 J;  3CCU P;  1GDT A;  2V4H A;  2SPZ A;  3VMY A;  2J64 A;  1S3J A;  3WU2 H;  2V7Q H;  1ZW0 A;  3Q3D A;  3GF3 A;  2HLO A;  1YBK A;  1NJI Q;  3L72 G;  2J1G A;  4CPG A;  2WPQ A;  3AEG C;  3PP5 A;  1RF1 C;  1Q90 D;  5KLV G;  3H1J E;  3L35 A;  2BCC J;  2XV5 A;  2ZVO B;  3B4S A;  2WT7 B;  2JWD A;  1FJP A;  3U59 A;  3AE4 C;  1M1K Q;  2E42 A;  1IFJ A;  1R5S A;  3V2R A;  1GL2 A;  1DH3 A;  3RK3 D;  2YXR B;  3Q5P A;  2FYZ A;  1AVO A;  2HOD A;  5GTI E;  5H2F H;  1GTW A;  1L0L J;  4B86 A;  2JHI F;  2KLU A;  1RE3 C;  1RY3 A;  1M57 D;  1NAF A;  1BGY E;  1NTK E;  2WIT A;  4Y99 C;  1YHQ P;  3WUU A;  3E1R A;  2IBZ D;  3BCC G;  3TGU G;  2NPS B;  2JHH C;  1KC8 Q;  2IDB A;  3IAO A;  2D2C B;  2N1T D;  2WSC J;  1AV1 A;  1MFZ A;  2IZ0 A;  1SQB E;  3AE8 C;  1HGZ A;  3H1K G;  1LTT C;  1SQP E;  2OYH A;  1NTZ D;  2E76 B;  2J60 A;  4M3L A;  3G4S P;  1N7S B;  3TYY A;  2WT7 A;  4I2L C;  3GLM A;  2R5B A;  1PGO A;  1YJN P;  1KIL E;  1RE4 A;  2QSI A;  4C7N B;  3AEF C;  4ZMD A;  2K9J A;  1AQT A;  1KQF B;  1RE3 B;  2OGU A;  1ZR2 A;  2J59 M;  2HPC A;  2E75 C;  3H1J G;  3VMZ A;  1NO4 A;  4PV1 B;  1VDF A;  2BCC D;  2ZT9 C;  1FOS E;  3KQG A;  2W8Z A;  1L0N D;  2J58 A;  1PV3 A;  2JEE A;  5C39 A;  2YXQ B;  1VQ9 P;  4ZFG A;  1OIP A;  5AVV B;  1KMI Z;  3HUS C;  2K88 A;  2YKO A;  1WRG A;  5TJH A;  2D39 A;  5BU8 B;  1OWA A;  2E74 B;  3CX5 H;  1FBM A;  2ZT9 D;  1N7S A;  2J0H A;  2LKM A;  2QM7 A;  2YKP A;  4UB8 E;  1H0T A;  1NH4 A;  3H1L D;  1JY2 P;  1KIL A;  2JP3 A;  1QVF O;  5AW0 B;  1X0T A;  3G71 P;  1TU3 F;  5AVU B;  2PFX A;  1CSB A;  5CCH C;  1FZC C;  1BCC E;  1LNQ A;  1KQG B;  1S9K D;  2NZ2 A;  1GU5 A;  1LTB C;  1AFO A;  2H43 A;  1EQ7 A;  1JY3 N;  1BE3 E;  5CMZ A;  3CLQ A;  4AUW A;  2WSF J;  1SQQ E;  1W2B O;  1RF0 C;  2OTL P;  4GOD A;  1K04 A;  1HWT C;  3A0B E;  1SFC B;  5APV A;  1K9M Q;  1ZN5 A;  3WU2 E;  3CCM P;  2E74 D;  1OW7 A;  2ZAE B;  3L74 G;  1Q86 Q;  2XND H;  2Y0E A;  2FIB A;  3RK3 C;  3II6 A;  5KKZ C;  2FY8 A;  2H8P D;  4PD4 E;  1X8Y A;  1PIX A;  1ZP0 C;  2QE7 H;  3RBZ A;  4HYT B;  2E5Y A;  3HE5 A;  3SFE C;  1P84 E;  3R4Y A;  2V7Q J;  1GL2 B;  3BRV B;  4GIF A;  1WT6 A;  2M8R A;  5AW8 B;  3E1I B;  2LXC B;  1GK4 A;  1PP9 G;  1FZG C;  1G2C B;  1PGJ A;  2YMY A;  3H32 C;  2FYN C;  4U7J A;  3CME P;  1BDD A;  2Y9Z A;  1A02 F;  1JO5 A;  2Q9I A;  4AQR D;  1XTC C;  3VTP C;  4YXD C;  4RO0 A;  5APU A;  1SQB D;  1FZA C;  3CMA P;  3SWK A;  5GTI H;  2JHM F;  1CI6 A;  1HBW A;  1JTH B;  2YIU C;  3H32 B;  2J3F D;  1N86 B;  3HE4 B;  3CCV P;  3GHG B;  2OTK E;  1EDL A;  3ITK A;  4PD4 D;  2O01 J;  2K9Y A;  3M9H A;  2QJY B;  4NPE A;  1W2E A;  5APQ A;  1LTJ B;  3B8E B;  2P2U A;  1L0N J;  4RKU J;  1LT9 B;  3PLN A;  3BVH A;  2J0Y A;  5KKZ B;  3P32 A;  3M06 A;  2ZYA A;  5KLV D;  1IZN B;  3ABV C;  5AVQ B;  1EDI A;  1CW5 A;  4PV1 D;  1YQ4 C;  2H7H A;  1IFI A;  1PL5 A;  4ZKP A;  1CI6 B;  1JTH A;  1WMK A;  3GHG A;  3L73 D;  4OH8 B;  1X79 B;  3TK1 A;  5BU5 A;  2P58 A;  3CX5 E;  1EZV E;  3L4F A;  3GG2 A;  3CWB E; 
#chains in the Genus database with same CATH homology
 3MD0 A;  2CPB A;  1SVF A;  3P8C E;  5KJ7 D;  2NPS C;  2XKM A;  1L4A A;  1FJK A;  4N3Y B;  3L37 A;  2GUV A;  5APW A;  2JHK F;  2R5D A;  2O01 H;  5AVZ B;  3NMD A;  3B5N A;  2WSE H;  1NTK K;  3HTK B;  1T2K C;  3M9B A;  2HYN A;  2W27 A;  3TSI A;  4I1L A;  3A7O A;  3CL3 D;  3BVH B;  1GW4 A;  1GDT A;  1L4A C;  3VMY A;  2J64 A;  3RL0 B;  3M91 A;  3RK2 C;  5AW4 B;  1LTG C;  2H43 B;  1J1E B;  1GL2 C;  2HLO A;  2P1J A;  3U1C A;  1JNM A;  1L4A D;  2J1G A;  5CCH A;  1FZC A;  2WPQ A;  1T3J A;  1NKZ B;  1ZV8 A;  1QL1 A;  5CHX A;  1FIC A;  3PP5 A;  1RF1 C;  2WPR A;  3N7N A;  4N6J A;  3P8M C;  2OYH B;  1RF1 B;  3L35 A;  2WSF H;  2O1J A;  2XV5 A;  3HUS B;  1H89 A;  2WT7 B;  1N2D C;  1FJP A;  4WY4 A;  3U59 A;  2J2P A;  2XNX B;  2E42 A;  2P7J A;  1IFJ A;  3C9I A;  1JY3 O;  4C7R A;  1J1E C;  3RK2 B;  2H43 C;  3TNU B;  3H6P A;  3V2R A;  1GL2 A;  2HLO C;  1DH3 A;  3P8C D;  1L4A B;  3NTN A;  4C7N A;  5AW6 B;  3L36 A;  3RK3 D;  1SQV K;  4EPU A;  2FYZ A;  2WPS A;  2HOD A;  3V2N A;  1GTW A;  1YYC A;  3V5B A;  1YTZ I;  3O8Z A;  4B86 A;  3B5N D;  2JHI F;  1RE3 C;  1VPC A;  1RY3 A;  4WB4 A;  1NAF A;  2IPP A;  1URQ C;  2QM8 A;  1LT9 C;  3CI9 A;  2XDJ A;  1GU4 A;  1LWU C;  1KIL C;  2P67 A;  2WIT A;  4Y99 C;  3HE5 B;  3B5N C;  1IK9 A;  1JY3 P;  2ZXE B;  2NPS B;  2JHH C;  3A3Y B;  5CCH D;  1SLQ A;  3V4W A;  2YO2 A;  1NTZ K;  5AW2 B;  1FAV A;  1FZE B;  3R2P A;  3E1I A;  2N1T D;  1S9K E;  2WZ7 A;  1N7S C;  1MFZ A;  2J61 B;  1E5W A;  3VMX A;  1FZC B;  5KLV K;  2WTY A;  5AW5 B;  1SFC D;  1HGZ A;  4LLH A;  1LTT C;  3SWF A;  3GHG C;  1NTM K;  2OYH A;  2N1T A;  2L5G B;  2IFM A;  1KFM A;  3HUS A;  4M3L A;  1N7S B;  2J60 A;  3TYY A;  2WT7 A;  4I2L C;  2KYV A;  4W7Z A;  1URQ D;  1N73 A;  1Z3S A;  2R5B A;  1SQB K;  2Q5U A;  1NOH A;  1FZB B;  1M1J B;  3TNU A;  4GKG A;  1RE4 A;  1N73 C;  2KP8 A;  4Y99 B;  2PAJ A;  1GL2 D;  1KIL B;  4C7N B;  3I5C A;  3RK2 D;  1XTG B;  1URQ B;  3VP8 A;  3EQ2 A;  1JC9 A;  5AVX B;  4IFD K;  1G1I A;  3H32 A;  3MUD A;  1AQ5 A;  1N86 A;  1RE3 B;  2HPC A;  1ZR2 A;  2J59 M;  2YNY A;  3VMZ A;  1JCC A;  1IO4 A;  2CPS A;  2C0X A;  1NO4 A;  3MIW A;  2OYI C;  1FZG B;  1VDF A;  1HJB A;  1FOS E;  3KQG A;  1LTJ C;  2E43 A;  3E1I C;  2J58 A;  2KSJ A;  2JEE A;  3LW5 H;  2J3U A;  1LGH B;  1FID A;  1SQQ K;  4ZFG A;  2Z4E B;  1GK6 A;  3V2Q A;  5AVV B;  4W7Y A;  1FZF B;  2W6B A;  4NYT A;  2NPS D;  3HUS C;  1LWU A;  1LT9 A;  3VP9 A;  2N1T C;  5AVW B;  2YKO A;  2OYI B;  2XZR A;  2OYH C;  1WRG A;  5BVZ A;  2OAR A;  2D39 A;  3M0D A;  1NU1 K;  2HOD C;  5BU8 B;  1LTI C;  1OWA A;  2HG5 D;  2GM4 A;  1FBM A;  3MGN A;  1N7S A;  2Q3I A;  3IFM A;  2LKM A;  2J0H A;  2ZFC A;  1FZA A;  2QM7 A;  4RES B;  2YKP A;  1N73 B;  2VRS A;  1IFM A;  5AVS B;  2FFD B;  2PP6 A;  3A2A A;  3RL0 C;  1LTA C;  1M7L A;  1M1J C;  2A45 G;  3BVH C;  2MJZ A;  1NH4 A;  5APY A;  1JY2 P;  1KIL A;  1SQP K;  5APS A;  4WBA A;  1HUC A;  1SFC C;  2Q9I C;  1URQ A;  5AW3 B;  5AW0 B;  1RE3 A;  2N9B A;  2WSC H;  1RF0 B;  5AVU B;  3VOP A;  1CSB A;  4M7F A;  4IFM A;  4DZO A;  4R9T A;  4LGD E;  5CCH C;  1FZC C;  3IR9 A;  4IFF A;  1S9K D;  1JY2 N;  1FZE C;  1GU5 A;  1LTB C;  3OJA B;  1AFO A;  1ZR4 A;  3HD7 D;  2H43 A;  2O1K A;  2R3C A;  1EQ7 A;  1JY3 N;  1Z3U A;  4KHX A;  2Z4E A;  5CMZ A;  3CLQ A;  1MZ9 A;  4WY4 C;  4AUW A;  3LIE A;  5CJ0 A;  1SQX K;  2YO3 A;  1N7S D;  1HTL C;  5CJ4 A;  1RF0 C;  1L0N K;  3LID A;  1HWT C;  1SFC B;  2Q9I B;  5APV A;  1ZN5 A;  1MUU A;  1CZQ A;  1OXZ A;  1T8Z A;  5CCG A;  2Z5I A;  2FFD A;  2FFD C;  4JYO X;  1T2K D;  5CCG C;  3KPE A;  1H88 A;  2Z5H A;  2FIB A;  2XNX C;  3RK3 C;  2JJL A;  3II6 A;  3P7K A;  3WMM 0;  2HOD B;  4HH2 A;  4W80 A;  4EOT A;  2J5Z A;  1J1D B;  3NXS A;  3OA7 A;  4JYB A;  1N7L A;  3N4X A;  2H8P D;  1RF0 A;  1SP4 A;  1X8Y A;  5AVT B;  2JHL F;  3BRT B;  1G1J A;  4HYT B;  2KLV A;  3HE5 A;  1X9V A;  3OAK A;  4JYC A;  5CCG D;  2Z4E C;  2NPS A;  1KIL D;  5APX A;  1GL2 B;  3BAS A;  2C9L Y;  5AVY B;  1LTJ A;  3BRV B;  4GIF A;  1WT6 A;  1JUN A;  2M8R A;  5AW8 B;  1FZE A;  3E1I B;  2I1J A;  2J61 A;  5AW7 B;  1GK4 A;  1HGV A;  3T97 A;  1FZG C;  1ZLL A;  1G2C B;  2HPC C;  2YMY A;  1T3U A;  2IFN A;  1KZU B;  3EFG A;  2GUS A;  1NHL A;  1N86 C;  3H32 C;  4R9J A;  5AVR B;  2KOG A;  3KDP B;  4O9B A;  5KTB A;  2WWW A;  2C9N Y;  3BAT A;  1FU1 A;  1A02 F;  3M9Q A;  1JO5 A;  3HD7 A;  1SFC A;  2A45 I;  4AQR D;  4JF7 A;  2Q9I A;  1XTC C;  5AW9 B;  3VTP C;  1IFN A;  1FDM A;  4EIJ A;  4N78 E;  2IX7 C;  2KB7 P;  1FZB A;  1M1J A;  4N78 D;  4I6M C;  1L0L K;  5APU A;  1NKN A;  1MV8 A;  3RL0 D;  2XU6 A;  4GT1 A;  1FZA C;  1JOC A;  2J3O A;  5KJ7 A;  2J3G A;  4XA4 A;  1DX7 A;  2J3F A;  3V4Q A;  1CI6 A;  2JHM F;  1HBW A;  1JTH B;  2POH A;  3H32 B;  2J3F D;  1N86 B;  3HE4 B;  4M7H A;  2HPC B;  3GHG B;  3M0D C;  2M3B A;  1FZD A;  2N1T B;  3KYQ A;  1FIB A;  3A5T A;  3G3Z A;  1FZF C;  3VYI A;  1JY2 O;  1GZL A;  1A02 J;  3M9H A;  2BAS A;  2J0G A;  2YKQ A;  1RE4 B;  1W2E A;  4WY4 D;  5APQ A;  3V2P A;  1LTJ B;  1IFD A;  3B8E B;  2P2U A;  2WNP F;  3HD7 C;  1FZF A;  3B5N B;  3HTK A;  4ZKU A;  4C46 A;  1LWU B;  3SWY A;  1KQL A;  1HVV A;  4DOJ A;  1Z56 A;  1LT9 B;  4LC1 A;  3FIB A;  1J1D C;  2OYI A;  2GY7 A;  2R32 A;  1G2C A;  3BVH A;  2J0Y A;  2C0W A;  1KFN A;  1IJD B;  1FZG A;  3P32 A;  3RK3 B;  3M06 A;  3UIA A;  2HFE D;  3VN0 A;  2FYU K;  1HH0 A;  3MTU E;  5KJ7 C;  1FOS F;  1GW3 A;  5AVQ B;  3HD7 B;  1NWQ A;  5AW1 B;  2HLO B;  1FZB C;  1QL2 A;  1RE4 C;  1GD2 E;  1CW5 A;  1LTS C;  2W6A A;  1IC2 A;  1H8A A;  2H7H A;  2FKW B;  1IFI A;  4ZKP A;  3M0A A;  1J2J B;  1DEB A;  3U1A A;  2A45 H;  2FXM A;  1RF1 A;  1CI6 B;  1JCD A;  1JTH A;  3NFQ A;  2Q7C A;  3HE4 A;  1PFI A;  3HRN A;  3GHG A;  5APT A;  1YTZ T;  4OH8 B;  1X79 B;  3TK1 A;  4JZC A;  4WY4 B;  5BU5 A;  2XNX A;  4AYC A;  1JMM A;  3L4F A;  1FZA B;  2I1K A;  4XE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...