1M1JC

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
390
structure length
390
Chain Sequence
TRENCCILDERFGSYCPTTCGIADFFNKYRLTTDGELLEIEGLLQQATNSTGSIEYLIQHIKTIYPSEKQTLPQSIEQLTQKSKKIIEEIIRYENTILAHENTIQQLTDMHIMNSNKITQLKQKIAQLESHCQEPCKDTAEIQETTGRDCQDIANKGARKSGLYFIKPQKAKQSFLVYCEIDTYGNGWTVLQRRLDGSEDFRRNWVQYKEGFGHLSPDDTTEFWLGNEKIHLITTQSTLPYALRIELEDWSGKKGTADYAVFKVGTEEDKYRLTYAYFIGGEAGDAFDGFNFGDDPSDKSYTYHNGMRFSTFDNDNDNFEGNCAEQDGSGWWMNRCHAGHLNGPYYIGGVYSRDTGTNSYDNGIIWATWRDRWYSMKKTTMKIIPFNRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha subunit
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
total genus 125
structure length 390
sequence length 390
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
C PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1m1jC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1m1jC02
2J1GA 1FZBA 1W2EA 1FZDA 4EPUA 1RE4C 2HLOB 2A45I 2J60A 2JHHC 1FZCC 2HLOA 2J5ZA 2A45G 2J0GA 1FICA 1FZFA 2J64A 4R9JA 2J2PA 2OYIB 1Z3UA 2OYIA 2JHKF 3FIBA 1RF1B 2JHLF 1JY3N 2D39A 1FIDA 2JHMF 1JY2N 1FZGC 1RF1C 2J3OA 3E1IB 2HPCB 1FZBC 1RF0A 3E1IA 3GHGB 2HPCA 3GHGA 4M7FA 4ZFGA 3BVHB 3E1IC 2HPCC 2XNXA 2H43B 2HLOC 1FZFB 3BVHA 3GHGC 2H43A 1FZFC 2J3FA 4M7HA 2OYIC 1LWUA 2Q9IB 1M1JB 2Q9IA 1M1JA 4JYOX 1RE3A 2J3UA 2FFDB 1RF0B 2FIBA 1JY3P 2FFDA 1FZAB 1N73B 1FZAA 1JY2P 2J3FD 2XNXB 1LT9B 1RF0C 1N73A 1FZAC 1FZEA 2J0YA 1LT9A 2J61A 2J3GA 1N73C 2XNXC 4NYTA 3BVHC 2H43C 3H32A 4JZCA 2GY7A 3HUSA 1T3UA 2Z4EB 1LWUB 2Z4EA 1JY3O 1RE4A 1FZCB 1LTJB 2HODB 1JY2O 2Z4EC 1FZCA 1RE3B 1LTJA 1LWUC 2HODA 2J0HA 4R9TA 1Z3SA 1LTJC 2Q9IC 2HODC 1M1JC 2JHIF 2WNPF 1RE3C 2FFDC 1FZEB 2J61B 1JC9A 2OYHB 2OYHA 3H32B 1FZEC 3HUSB 1LT9C 1N86B 2A45H 2OYHC 1N86A 1FZGB 3H32C 1FZGA 3HUSC 1N86C 1RE4B 1RF1A 1FIBA 1FZBB
chains in the Genus database with same CATH superfamily
1CZQA 3A7OA 1FZDA 1S72P 1RE4C 3H1KG 5EFWB 2HLOB 1VQ4P 1SQBE 2YXQB 1YBKA 1NGMB 1VQNP 2KB7P 2ZXEB 1NU1G 3JSVC 1PGQA 2WITA 4C7RA 2JEEA 1AQTA 1RF1B 4C7NA 3W67A 4I6MC 2PP6A 2N1TB 5KAIE 4M7FA 1SQBJ 1IFDA 2K37A 4Y99C 2O1JA 2JP3A 1PP9G 2KSJA 1KB9D 3OJAB 2PFXA 4AUWA 1EZVD 1M90Q 2IYPA 1LNQA 3IFMA 2JWDA 3A0HE 4H13B 1T2KD 1J1DC 3OW2O 3L4FA 3NTNA 2H43C 2BEZF 2KK7A 3B71A 5APTA 2Z4EB 1MFZA 3AE2C 2IBZE 1AV1A 1LTJA 2ZT9C 5KAFE 2ZVOB 3K5BA 1JMBA 1S1CX 3B5NC 1VQ9P 1S5LX 2K3RA 2WSEH 1IO4A 4H0LD 2WT7A 2OYOA 2Q7CA 3H1JD 1PGJA 1SP4A 1FC2C 1URQC 1W2EA 3RK3B 1LJ2A 2A45I 1FZCC 3ZDMA 4HJGH 4WY4D 1U7MA 3SFEC 1M56D 1LP1A 1KORA 1NOHA 5DJUB 4NPEA 4GOFA 3TSIA 5BU5A 5GTHE 3MIWA 1PIXA 2KUBA 1G1IA 1GZLA 1NO4A 2WSFH 1KYOH 3WUUA 3SWKA 1ZV8A 5CCHC 3EFGA 1N7SA 3GF7A 1NU1K 2OTJP 3HTKA 4JPZB 3Q5RA 2IX7C 2QRXA 1NTKG 4UB6E 3L73G 3II6A 3Q3DA 4N78D 1NYHA 5CJ0A 1LT9A 4O9BA 3NXSA 3V6IA 3HUSA 1IFNA 1RE4A 2I1JA 1BGYE 3WU2H 3CXHI 1OZHA 1RE3C 2KLVA 1KTMA 1UIIA 1KQSO 3E1RA 2WSCJ 5AW2B 1L0NG 1R5LA 2E75D 2J1GA 1BGYJ 1FDMA 5KLVD 1GD2E 1KMIZ 4BRYA 1QL2A 1AVOA 5AW6B 2J64A 4ZKPA 4EIJA 3HE5A 4RKUJ 3PRJA 1H0TB 2ZFCA 3EFFK 1PV3A 3MD0A 1FIDA 2UWJE 1Q82Q 3R4YA 1SFCC 1YJNP 1WT6A 1NTMD 1YI2P 1QX8A 3CLQA 2H43A 3CCJP 2Z5HA 2QG4A 1SVFA 2QJPB 2C9LY 4IL6H 2BEQD 1W2BO 1GU4A 4EOTA 2K9JB 2FYUG 1JY3P 3V4QA 3RGUA 2BCCE 1N73C 2KLUA 4EI2A 1VF5B 2MKVA 1P84H 1N2DC 3M9BA 1S9KD 2FKWB 1URQA 1L4AC 1PGOA 1FZCA 2Q9IC 1NTKK 1HGZA 2NPSC 1NHLA 1KYOE 1IC2A 2BCCJ 2OYHB 5AVRB 1X0TA 3AEGC 3RK3E 5B66E 1FZGB 3SFDC 1JM0A 3H32C 1N86C 3Q1MA 3L71E 2KXPB 1SQXE 4DOJA 4PJ0E 5KJ7D 2J60A 1IFIA 2WPRA 2A45G 3V2QA 5CCHA 1SQPD 2JO1A 3LW5J 1KQFB 3FX0A 1GL2B 1HBWA 1BDCA 1JTHA 2Q3IA 2RN0A 3EQ2A 4EYYQ 1GMJA 1BE3E 2P58A 3L35A 1L0NK 1T3JA 3HD7C 1JY3N 1EDKA 1ZW0A 4GDOA 3L71J 1SQXJ 3AECC 4TT3H 1RF1C 2QVAA 1KB9I 1RH5B 4W7ZA 4XFJA 2G3AA 3E1IA 5CCGC 3O6QB 1EZVI 3BRTB 1MFTA 4PD4H 5KKZB 1MUUA 1GK6A 3RK2D 2OQQA 1BE3J 3R2PA 4N3YB 2WWWA 1ZOYC 2QM8A 3VP8A 4JYOX 5AVVB 1RE3A 3P8MC 3L75G 2NZ2A 2J3UA 1NTZE 1RF0B 2E74D 1DD4A 1KYOD 2W6AA 5AW9B 3H1IG 1JCCA 1VQLP 1L0LG 2KSEA 1JY3O 1PGPA 2HODB 2Z4EC 2O1KA 1HH0A 1HJ0A 2FYUK 1DD3A 3RL0g 2R3CA 1NTZJ 2IZ0A 1SQQG 2WNPF 1JCDA 1H88A 1FZEB 2FXMA 2H7HA 2J61B 3BRVB 1ZRTD 1HWTC 1D7MA 4UB8E 4WY4B 3L74G 4Y28J 2O01J 1BE3D 4LGDE 1J1EB 1SFCA 5APXA 2QSIA 3L72E 3RK3C 5KAIH 2J2PA 3TYYA 2W27A 5TISE 4LLHA 2H89C 2FYZA 1JUNA 3L72J 3MTUE 3A0HH 3GHGA 3N7NA 3C8VA 5APYA 1IZNB 4B86A 3H1HD 2AEJA 1Z56A 5KTBA 2Y9ZA 2Q9IA 2NPSA 2LKMA 2GUSA 3MUDC 5KAFH 1VL2A 1N7SD 1FZAA 1JY2P 1CW5A 4WBAA 2ZJSE 2Q3EA 3H32A 1GDTA 1SQVD 1HF9A 2KZJA 4K3AA 3IAOA 2A06E 2C0WA 3TGUE 2FYNB 3L72D 3CWBE 2JHIF 3CX5H 1AA0A 1PPJG 3AEDC 4L76A 3HD7A 1P84D 1AVYA 1LTAC 1L0LK 1MKMA 3O8ZA 1RF1A 3S4RA 2HR3A 5CCGA 2H88C 3MZWB 4H44D 2B87B 5GTHH 3TGUJ 1M7LA 1SQQK 3CWBJ 3HE4A 1PL5A 1YYCA 4R9JA 3A3YB 1S5LE 3HRNA 2XV5A 4GT1A 4D6TD 1NU1E 3P8CE 1JY2N 2R5BA 5AVZB 2JJLA 2ITAA 2YMYA 2HPCA 3KZIE 4UB6H 1EZVG 2LXBA 3P7KA 2QJYC 1JOCA 2E5TA 2Q5UA 2WSCH 2OARA 1DH3A 3I5CA 3M9QA 3TNUB 1OMIA 1NU1J 1U57A 3L36A 2FFDB 2ZXXA 4DCKA 2G8YA 1OIPA 2Y0CA 3NFQA 4I2LC 4PD4D 1M1KQ 2O01N 4GOEA 3V4WA 3VMXA 2C9NY 3FGAD 2MJZA 2PGDA 2KNCB 1VF5C 2ZYAA 3E7KA 1JY2O 4L74A 3NMDA 5CJ4A 1Z3SA 1EXJA 3CCEP 5H2FE 1CI6B 2CPSA 3H1JG 3EWKA 1URQD 3FXEA 3WUVA 2OYHC 1NJIQ 1JNMA 3KYQA 3CC2P 4JYCA 3PJSK 1FE6A 1ZP0C 1KILB 2E76C 1SQBD 3IR9A 2J58A 1Z3UA 1GL2C 2OGUA 2WPSA 1FBMA 5GTIE 3CC7P 3RK2B 3Q5PA 3WUTA 1IFMA 2D39A 2IZ1A 1ZMEC 1LTIC 3VTPC 1RHZB 1A02F 4C7NB 5CCHD 3MUDA 1QGKB 3I55P 3U1CA 5AW0B 3CX5E 4OGQD 3CI9A 2E74B 2J5UA 4DZOA 1JEKA 5KKZC 4W80A 2KZIA 4YTPC 2WPVB 2OYIC 2RH0A 3KXDA 1QL1A 2KYVA 5AVXB 3C1LA 4OWFA 1VQOP 2DW3A 1Q90D 1YITP 1OVUA 2JWAA 1RF0C 3LW5H 1EDIA 1T6AA 1ZXGA 1NTKE 3BVHC 3L73E 3KHUA 5B66H 1FOSF 1KFNA 3CCUP 2XNDH 1LTJB 4YXDC 2IBZD 4PJ0H 2HODC 1M1JC 4PV1D 2K9YA 4M3LA 4BWNA 1G1JA 1NTKJ 1H8AA 5KLVG 1FZEC 3L73J 1M8OB 1HGVA 2ZYDA 2YKPA 1J1EC 1GU5A 2XKMA 1MZ9A 1L0NE 4HKZH 3AE1C 4N6JA 3AE8C 3CX5D 1T8ZA 3BATA 2KS1A 1LP1B 2POHA 2KOGA 2JR8A 2QJKB 1SFCD 2IDBA 3KQGA 1NTMG 2W8ZA 2JHLF 4WVZA 2K9JA 3RBXA 1L0NJ 3M0AA 2LXCB 4ZFGA 3KPEA 4GKGA 1SS1A 2N9BA 2J3FA 1VQMP 2O01H 3N4XA 3G3ZA 3U59A 1FU1A 3WMM0 3CMAP 1BCCE 2FYUE 1LT9B 1L4AD 4ASVA 1GTWA 4JZCA 4UB8H 1XTCC 2NPSD 3D6ZA 3PP5A 3RL0D 2IYOA 1BGYD 3B5NA 1P84I 1M57D 4H44B 2FYNC 1BCCJ 2FYUJ 3I56P 2VRSA 2FXPA 3B8EB 2WVRA 3AEEC 3CCRP 1SQPG 1KILE 3VMZA 2ZAEB 4WWIA 5TISH 4BRYB 1FS0E 1QEXA 2YIUC 3AEBC 4KHXA 1NKNA 2Q6QA 3O6QA 3HD7D 5KLIC 1FICA 3HE5B 4RJTA 2OYIA 5K5GB 5KLVK 4DJGA 1KFMA 5CCGD 1IK7A 2YNYA 1NWQA 5E79E 1HVVA 5APUA 1J1DB 1FDOA 2D2CC 2J3OA 3A0BE 2GA1A 1W5CE 1FZBC 1RF0A 2V7QH 2OTLP 2H43B 1BCCD 2HLOC 1FZFB 3BVHA 4DT0A 2FY8A 1NAFA 4I1LA 3C9IA 3BCCE 2M5AA 1NTMK 4RO0A 4PD4I 2P7JA 5B5EE 1LTBC 1M1JA 1ZLLA 2HYNA 1IFPA 1FZEA 3L75E 2J61A 2BCCD 1OVRA 3MGNA 5AW3B 2N1TC 1KD1Q 4R4LA 4RESB 3BCCJ 1EDLA 2XZRA 1FZCB 2GM4A 3H1IE 2I1KA 1L0LE 1DX7A 1BE3G 3CXHE 4H13C 1VQ5P 3MHVA 3L75J 2QA4P 3SWYA 4AQRD 5AVWB 3RK3D 1S5LH 4JBZA 4H0LB 3B4SA 3L71D 1SQXD 3GLMA 2QE7H 1L0LJ 4L73A 3KZIH 1JTHB 1OFCX 3CL3D 1KILC 2IPPA 3USSA 4OGQB 3BCCD 3KDPB 1SQPK 1Q86Q 1KN7A 2JHMF 3M06A 3RK2C 2E42A 3E1IB 3F89A 1Y9BA 2CPBA 4Z1MH 1GW3A 3H1HG 2KIKA 1IJDB 1G2CA 1USDA 1X8YA 3GMAA 2NRGA 3OA7A 1KQLA 3V2RA 1LT1A 1VQKP 2B89A 1RQUA 1X79B 1NTZD 5H2FH 1SQVG 1N73A 4PV1B 1A02J 2IBZI 3V5BA 5C39A 3L72G 3TDKA 1L4AA 1CSBA 4R4MA 2K1AA 1KC8Q 2E5YA 2KP8A 1LTJC 1ZR2A 3L70E 3S9OA 2ZVNB 1N86A 3T97B 3AE5C 3W68A 5GTIH 1PPJE 1FZBA 4U3FE 3VYIA 3VP9A 2M0BA 3CCQP 1LGHB 2HLOA 3OAKA 2E75B 2V7QJ 3H1LE 5AW8B 3L70J 2M8RA 2RKLA 4D6TG 1TU3F 1JB0J 3VOPA 5CBOA 1OW6A 2R3SA 1GW4A 1ZR4A 1EC5A 2YO2A 3CPWO 4U3FJ 3H6PA 3CCVP 1X22A 3GHGB 4IFMA 4IL6X 1H89A 3H1LJ 2N1TA 2P2UA 1YQ3C 3H1KE 5APSA 5CHXA 1KB9E 1R5SA 1EZVE 3S1KA 2Q9IB 4LC1A 5BVZA 4XA4A 3RL0B 1FZAB 2GUVA 1VF5D 2FXOA 3L70D 3AE3C 2J3FD 2XNXB 2HG5D 2J0YA 2J3GA 3H1KJ 3V2PA 1HJBA 1T3UA 1LWUB 2Z4EA 2B9BA 2QJPC 1PP9E 2C0XA 1FAVA 1WMKA 1LTTC 4U3FD 2A06D 3TGUD 4QMAA 3CWBD 1KILA 3H1LD 1SQVK 1JC9A 3FXDA 4H44C 3HD7B 2ZT9D 3G9RA 3H1JE 3B5ND 1KQGB 1YTZI 2E76D 3TF5A 1SQBG 1PP9J 1GL2D 3HE4B 2JHHC 2J5ZA 1DEEG 1Q2NA 3UIAA 1ZN5A 1GK4A 3H1KD 1QVFO 1EXIA 5AW1B 2ZYGA 3H1JJ 4W7YA 3CCLP 1FZGC 1NU1D 2Y0EA 3P8CD 4AYCA 3CCSP 2HPCB 4KJMA 3CMEP 1OW8A 2QEXP 1JO5A 1HUCA 1FZFC 3VMAA 4M7HA 4BXLA 1VPCA 2WPQA 1PP9D 3FWNA 5APVA 1OXZA 4N78E 3G71P 4NYTA 3GF3A 4CPGA 2IBZG 2P1JA 1T2KC 3AEFC 3M0DC 1BSHA 2R5DA 1KYOI 3JCUE 4ZKUA 3CD6P 3AE4C 2AXTE 5TJHA 3D70A 1AJYA 2YKQA 1DEBA 2P67A 4A7PA 2W6BA 1K8AQ 2A45H 5KLVE 5E79H 4H0LC 1VQ7P 3A0BH 1VQPP 2QIWA 2H8PD 1FJKA 2JHKF 3FIBA 2WT7B 3AE6C 1JMMA 1H0TA 2R44A 4OGQC 2WTYA 1FJPA 4WY4C 3TK1A 2IFMA 1YIJP 1NAYA 1SQBK 5KLVJ 5B5EH 1NTME 1BDDA 3E1IC 3JC22 1X9VA 4K35A 2PRRA 3CC4P 2XDJA 1OVVA 2WZ7A 1NTMJ 4KT0J 1L2PA 4JF7A 5CMZA 1E5WA 1Q81Q 3CXHH 1N7SB 1BGYG 2WQYC 1NTKD 4PV1C 1K04A 1S9KE 3L73D 3HTKB 4I7ZB 3PLNA 2W6JH 2W90A 3M9HA 1EQ7A 1QLED 3PH0A 2YO3A 2OYHA 1U7JA 2L5GB 3HUSB 3GG2A 1FZGA 1RE4B 3Q2YA 2I8DA 1L0ND 1SQPE 5M1BA 2J0GA 2QJYB 1PFIA 1RQVA 2KS1B 1DIPA 1FZFA 2E75C 1GL2A 5AVSB 3M91A 2D2CD 2QM7A 1RY3A 3CCMP 1BCCG 1KZUB 3A2AA 3IF4A 2K88A 3AE9C 1USEA 5AVYB 1VQ6P 2B88A 4Y99B 1SQPJ 3H25A 4HYTB 3GHGC 2BASA 5BU8B 3VN0A 2WSEJ 3M0DA 4GODA 1R8EA 2Q1KA 2KI7B 3FWLA 3ABVC 1AQ5A 2JKVA 2N9YB 2BCCG 2N1TD 1OW7A 3MP7B 3PHLA 4JYBA 4ASWA 3SSUA 3RL0C 1FZAC 2FYUD 5CBNA 2XNXC 4ZNCA 1K05A 2FBWC 2ZT9B 1LTGC 1N7LA 4H13D 3G4SP 3B5NB 1LWUC 2E76B 2HODA 3BASA 3V2NA 2J0HA 4R9TA 2YKOA 3AEAC 4OH8B 2WMMA 2WSFJ 1NH4A 1ZRTE 3GW6A 1N8RQ 2FFDC 2M3BA 3L71G 3RBZA 1SQXG 1HTLC 1VDFA 1YQ4C 2WSSH 4WY4A 1BSNA 1URQB 3WU2E 2Y9YA 1KILD 1Y8AA 3D71A 1S4XA 1MV8A 3BCCG 3A5TA 2AEMA 4L75A 2OYIB 1E79H 1SQQE 5KJ7C 3IN6A 1KB9H 4IOIH 2XU6A 3AE7C 3L74E 3H1IJ 3VMYA 4XE5B 3L37A 1YJWP 3BVHB 2HPCC 4U7JA 1FDIA 3G6EP 1SQQJ 2M5AB 1S2EA 1LTSC 3H1HE 1NTZG 5APQA 1YTZT 2HFED 2E43A 1M1JB 5L8RJ 4GIFA 5AW4B 1IK9A 2SPZA 3L74J 2IFNA 4YXWH 4IFFA 2FIBA 5AW7B 2YXRB 3L75D 4IL6E 1SQVE 2GY7A 1S3JA 2AEFA 1K9MQ 3T97A 4MN4C 2E74C 3P32A 3H1HJ 5AVQB 2JDIH 1RE3B 3H1ID 4EDFA 2AXCA 1L0LD 1EDJA 2RMZA 2J59M 3CXHD 1P84E 1SQQD 4NPDA 1SQVJ 2Y0DA 3LIEA 5APWA 2CK3H 2P10A 4EPUA 3L74D 2W83C 2B87A 2LR2A 1FOSE 3LIDA 3F5HA 5AW5B 2V4HA 1VQ8P 1NVOA 1SLQA 1SQXK 2Z5IA 3D6YA 3SWFA 1Q7YQ 4D6TE 1UIXA 1SFCB 4JQ0D 3CX5I 4WB4A 2O3JA 1KV4A 2XNXA 1G2CB 4OVNF 2YMKA 4TLFA 2M3EA 1IFJA 4HH2A 1WRGA 4ZMDA 3QWOC 3Q5SA 4D6TJ 1LWUA 2QJKC 3L70G 1OX3A 2L91A 3JCUH 1YHQP 3ITKA 5DJTB 3TNUA 2AXTH 2R32A 1K73Q 2FFDA 4C46A 4PD4E 1N73B 5AVUB 1J2JB 1NKZB 3PTZA 4U3FG 2A06G 1L4AB 1N7SC 3TGUG 1Y47A 1NTZK 3CWBG 2KNCA 5AVTB 3H1LG 4YPCA 4HB1A 2YIUB 2NPSB 3QH9A 1XTGB 4I7ZC 5KLIB 3U1AA 1QVGO 2OTKE 1CI6A 1OWAA 1AFOA 5KJ7A 4IFDK 3H32B 1N86B 1LT9C 1YJ9P 1PZQA 2PAJA 4NPFX 2D2CB 3HUSC 1FIBA 1FZBB 1PPJD
chains in the Genus database with same CATH topology
1CZQA 5APXA 3A7OA 1FZDA 1RE4C 2HLOB 3RK3C 4KHXA 1NKNA 3HD7D 1FICA 2H8PD 2J2PA 3HE5B 1FJKA 2KB7P 2OYIA 2ZXEB 2JHKF 3FIBA 5KLVK 2WT7B 3TYYA 1KFMA 2WITA 5CCGD 1JMMA 4C7RA 2JEEA 1FJPA 2W27A 2YNYA 2WTYA 4WY4C 1NWQA 1RF1B 3TK1A 2IFMA 1HVVA 5APUA 1SQBK 4LLHA 1J1DB 2FYZA 4C7NA 1JUNA 2J3OA 1FZBC 4I6MC 2PP6A 1RF0A 3MTUE 2N1TB 3GHGA 4M7FA 3N7NA 3E1IC 2H43B 2HLOC 1FZFB 3BVHA 1IFDA 4Y99C 5APYA 1X9VA 2O1JA 1NAFA 4I1LA 2KSJA 3C9IA 3OJAB 2XDJA 1NTMK 4AUWA 4B86A 2P7JA 1Z56A 5KTBA 1LTBC 2Q9IA 2WZ7A 1M1JA 2NPSA 3IFMA 1ZLLA 2LKMA 2GUSA 1T2KD 1J1DC 1N7SD 4JF7A 1FZAA 1JY2P 2HYNA 5CMZA 1CW5A 4WBAA 1E5WA 1FZEA 2J61A 3MGNA 5AW3B 2N1TC 1N7SB 3L4FA 3NTNA 2H43C 3H32A 1S9KE 1GDTA 4RESB 3HTKB 5APTA 2Z4EB 1MFZA 2XZRA 1FZCB 2GM4A 2I1KA 1LTJA 2C0WA 3M9HA 1EQ7A 2JHIF 1DX7A 3B5NC 2YO3A 2WSEH 3SWYA 2OYHA 4AQRD 2L5GB 3HD7A 3HUSB 5AVWB 1IO4A 2WT7A 2Q7CA 3RK3D 1LTAC 1L0LK 1FZGA 1RE4B 3O8ZA 1RF1A 1SP4A 1URQC 1W2EA 5CCGA 3RK3B 2A45I 1FZCC 1M7LA 1SQQK 2J0GA 3HE4A 1YYCA 4WY4D 1JTHB 1PFIA 3CL3D 1FZFA 4R9JA 1GL2A 1KILC 2IPPA 5AVSB 3M91A 1NOHA 3A3YB 2QM7A 1RY3A 3HRNA 3KDPB 2XV5A 4GT1A 1SQPK 1KZUB 3A2AA 3M06A 1JY2N 3P8CE 3RK2C 2R5BA 5AVZB 3TSIA 2E42A 2JHMF 5BU5A 3MIWA 3E1IB 2JJLA 5AVYB 1G1IA 2YMYA 1GZLA 2HPCA 4Y99B 2CPBA 1NO4A 2WSFH 1GW3A 4HYTB 3GHGC 1ZV8A 2BASA 5CCHC 1IJDB 1G2CA 3P7KA 5BU8B 3VN0A 3EFGA 3M0DA 1X8YA 1N7SA 1JOCA 1NU1K 3OA7A 1KQLA 2Q5UA 3V2RA 3HTKA 2WSCH 2OARA 2IX7C 1DH3A 1AQ5A 3I5CA 3M9QA 3TNUB 2N1TD 3L36A 2FFDB 4JYBA 1X79B 3II6A 3NFQA 4I2LC 4N78D 1N73A 5CJ0A 3RL0C 1FZAC 1LT9A 4O9BA 3NXSA 2XNXC 3V4WA 1A02J 3V5BA 3VMXA 3HUSA 2C9NY 2MJZA 1IFNA 1L4AA 1RE4A 1LTGC 2I1JA 1CSBA 1N7LA 1JY2O 3B5NB 1LWUC 2HODA 3BASA 3NMDA 2KP8A 3V2NA 5CJ4A 2YKOA 1Z3SA 2J0HA 4R9TA 1LTJC 4OH8B 1ZR2A 1CI6B 1RE3C 2KLVA 2CPSA 1NH4A 2FFDC 1URQD 2M3BA 1HTLC 1VDFA 4WY4A 2OYHC 1N86A 1URQB 5AW2B 1JNMA 3KYQA 2J1GA 1FZBA 1KILD 1FDMA 3VYIA 4JYCA 3VP9A 1GD2E 1LGHB 2HLOA 1MV8A 3OAKA 1KILB 1QL2A 5AW8B 3A5TA 2M8RA 5AW6B 3IR9A 2J58A 2J64A 4ZKPA 2OYIB 4EIJA 1Z3UA 1GL2C 3HE5A 2WPSA 5KJ7C 3VOPA 1FBMA 2ZFCA 3RK2B 2XU6A 1GW4A 1IFMA 1ZR4A 2D39A 3MD0A 1FIDA 1LTIC 3VTPC 1A02F 4C7NB 5CCHD 3MUDA 2YO2A 1SFCC 3H6PA 1WT6A 3VMYA 3GHGB 4IFMA 3U1CA 4XE5B 3L37A 1H89A 3BVHB 3CLQA 5AW0B 2HPCC 2N1TA 2P2UA 3CI9A 2H43A 5APSA 5CHXA 4DZOA 2Z5HA 4W80A 1SVFA 2C9LY 1LTSC 2OYIC 5APQA 1YTZT 2HFED 2E43A 2Q9IB 1QL1A 1M1JB 2KYVA 5AVXB 4GIFA 4EOTA 1GU4A 5AW4B 1IK9A 4LC1A 2IFNA 5BVZA 4IFFA 2FIBA 4XA4A 1JY3P 3RL0B 1FZAB 5AW7B 2GUVA 3V4QA 2XNXB 2J3FD 1RF0C 3LW5H 2HG5D 2J0YA 2J3GA 1N73C 3V2PA 3BVHC 1HJBA 2GY7A 1T3UA 1N2DC 3M9BA 3T97A 1S9KD 2FKWB 1FOSF 1URQA 3P32A 1LWUB 2Z4EA 5AVQB 1KFNA 1L4AC 1LTJB 2C0XA 1FZCA 1RE3B 1FAVA 1LTTC 2Q9IC 2HODC 1M1JC 1NTKK 1HGZA 2NPSC 1KILA 1NHLA 1SQVK 4M3LA 1IC2A 1JC9A 1G1JA 2J59M 2OYHB 5AVRB 3HD7B 1H8AA 1FZEC 3LIEA 5APWA 1FZGB 3H32C 3B5ND 1N86C 1HGVA 1YTZI 4DOJA 2YKPA 1J1EC 1GU5A 4EPUA 2XKMA 1MZ9A 1GL2D 5KJ7D 2J60A 1IFIA 3HE4B 2WPRA 2JHHC 2J5ZA 2A45G 3V2QA 5CCHA 1HBWA 1GL2B 3LIDA 4N6JA 1FOSE 3UIAA 1T8ZA 1ZN5A 3BATA 1JTHA 2Q3IA 5AW5B 1SLQA 1GK4A 2POHA 3EQ2A 2KOGA 5AW1B 1SQXK 2Z5IA 1SFCD 3SWFA 3KQGA 3L35A 1L0NK 1T3JA 3HD7C 4W7YA 2JHLF 1JY3N 1SFCB 4WB4A 1FZGC 1RF1C 3P8CD 4AYCA 2HPCB 4W7ZA 3E1IA 5CCGC 3M0AA 4ZFGA 2XNXA 3BRTB 3KPEA 1G2CB 1MUUA 4GKGA 1JO5A 1GK6A 2N9BA 1IFJA 4HH2A 1HUCA 1WRGA 3RK2D 1FZFC 2J3FA 2O01H 3R2PA 4M7HA 4N3YB 3N4XA 3G3ZA 1LWUA 3U59A 1VPCA 2WWWA 2WPQA 1FU1A 2QM8A 3VP8A 4JYOX 5AVVB 1RE3A 3P8MC 3TNUA 2J3UA 3WMM0 2R32A 5APVA 1RF0B 2FFDA 1OXZA 4C46A 4N78E 1N73B 1LT9B 2W6AA 5AW9B 1L4AD 5AVUB 1J2JB 4NYTA 1NKZB 1JCCA 1GTWA 4JZCA 2P1JA 1T2KC 1L4AB 1XTCC 2NPSD 3M0DC 1N7SC 3PP5A 1NTZK 1JY3O 2R5DA 5AVTB 4ZKUA 2HODB 2Z4EC 2O1KA 3RL0D 2NPSB 1HH0A 2FYUK 1XTGB 3B5NA 2R3CA 2WNPF 3U1AA 1JCDA 2YKQA 1H88A 1CI6A 1DEBA 1OWAA 1AFOA 1FZEB 2FXMA 5KJ7A 2H7HA 2P67A 3BRVB 4IFDK 2J61B 1HWTC 2VRSA 2W6BA 4WY4B 3H32B 3B8EB 1N86B 1LT9C 2A45H 2PAJA 4LGDE 1J1EB 3HUSC 1FIBA 1FZBB 3VMZA 1SFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1G A;  1FZB A;  1W2E A;  1FZD A;  4EPU A;  1RE4 C;  2HLO B;  2A45 I;  2J60 A;  2JHH C;  1FZC C;  2HLO A;  2J5Z A;  2A45 G;  2J0G A;  1FIC A;  1FZF A;  2J64 A;  4R9J A;  2J2P A;  2OYI B;  1Z3U A;  2OYI A;  2JHK F;  3FIB A;  1RF1 B;  2JHL F;  1JY3 N;  2D39 A;  1FID A;  2JHM F;  1JY2 N;  1FZG C;  1RF1 C;  2J3O A;  3E1I B;  2HPC B;  1FZB C;  1RF0 A;  3E1I A;  3GHG B;  2HPC A;  3GHG A;  4M7F A;  4ZFG A;  3BVH B;  3E1I C;  2HPC C;  2XNX A;  2H43 B;  2HLO C;  1FZF B;  3BVH A;  3GHG C;  2H43 A;  1FZF C;  2J3F A;  4M7H A;  2OYI C;  1LWU A;  2Q9I B;  1M1J B;  2Q9I A;  1M1J A;  4JYO X;  1RE3 A;  2J3U A;  2FFD B;  1RF0 B;  2FIB A;  1JY3 P;  2FFD A;  1FZA B;  1N73 B;  1FZA A;  1JY2 P;  2J3F D;  2XNX B;  1LT9 B;  1RF0 C;  1N73 A;  1FZA C;  1FZE A;  2J0Y A;  1LT9 A;  2J61 A;  2J3G A;  1N73 C;  2XNX C;  4NYT A;  3BVH C;  2H43 C;  3H32 A;  4JZC A;  2GY7 A;  3HUS A;  1T3U A;  2Z4E B;  1LWU B;  2Z4E A;  1JY3 O;  1RE4 A;  1FZC B;  1LTJ B;  2HOD B;  1JY2 O;  2Z4E C;  1FZC A;  1RE3 B;  1LTJ A;  1LWU C;  2HOD A;  2J0H A;  4R9T A;  1Z3S A;  1LTJ C;  2Q9I C;  2HOD C;  1M1J C;  2JHI F;  2WNP F;  1RE3 C;  2FFD C;  1FZE B;  2J61 B;  1JC9 A;  2OYH B;  2OYH A;  3H32 B;  1FZE C;  3HUS B;  1LT9 C;  1N86 B;  2A45 H;  2OYH C;  1N86 A;  1FZG B;  3H32 C;  1FZG A;  3HUS C;  1N86 C;  1RE4 B;  1RF1 A;  1FIB A;  1FZB B; 
#chains in the Genus database with same CATH topology
 1CZQ A;  3A7O A;  1FZD A;  1S72 P;  1RE4 C;  3H1K G;  5EFW B;  2HLO B;  1VQ4 P;  1SQB E;  2YXQ B;  1YBK A;  1NGM B;  1VQN P;  2KB7 P;  2ZXE B;  1NU1 G;  3JSV C;  1PGQ A;  2WIT A;  4C7R A;  2JEE A;  1AQT A;  1RF1 B;  4C7N A;  3W67 A;  4I6M C;  2PP6 A;  2N1T B;  5KAI E;  4M7F A;  1SQB J;  1IFD A;  2K37 A;  4Y99 C;  2O1J A;  2JP3 A;  1PP9 G;  2KSJ A;  1KB9 D;  3OJA B;  2PFX A;  4AUW A;  1EZV D;  1M90 Q;  2IYP A;  1LNQ A;  3IFM A;  2JWD A;  3A0H E;  4H13 B;  1T2K D;  1J1D C;  3OW2 O;  3L4F A;  3NTN A;  2H43 C;  2BEZ F;  2KK7 A;  3B71 A;  5APT A;  2Z4E B;  1MFZ A;  3AE2 C;  2IBZ E;  1AV1 A;  1LTJ A;  2ZT9 C;  5KAF E;  2ZVO B;  3K5B A;  1JMB A;  1S1C X;  3B5N C;  1VQ9 P;  1S5L X;  2K3R A;  2WSE H;  1IO4 A;  4H0L D;  2WT7 A;  2OYO A;  2Q7C A;  3H1J D;  1PGJ A;  1SP4 A;  1FC2 C;  1URQ C;  1W2E A;  3RK3 B;  1LJ2 A;  2A45 I;  1FZC C;  3ZDM A;  4HJG H;  4WY4 D;  1U7M A;  3SFE C;  1M56 D;  1LP1 A;  1KOR A;  1NOH A;  5DJU B;  4NPE A;  4GOF A;  3TSI A;  5BU5 A;  5GTH E;  3MIW A;  1PIX A;  2KUB A;  1G1I A;  1GZL A;  1NO4 A;  2WSF H;  1KYO H;  3WUU A;  3SWK A;  1ZV8 A;  5CCH C;  3EFG A;  1N7S A;  3GF7 A;  1NU1 K;  2OTJ P;  3HTK A;  4JPZ B;  3Q5R A;  2IX7 C;  2QRX A;  1NTK G;  4UB6 E;  3L73 G;  3II6 A;  3Q3D A;  4N78 D;  1NYH A;  5CJ0 A;  1LT9 A;  4O9B A;  3NXS A;  3V6I A;  3HUS A;  1IFN A;  1RE4 A;  2I1J A;  1BGY E;  3WU2 H;  3CXH I;  1OZH A;  1RE3 C;  2KLV A;  1KTM A;  1UII A;  1KQS O;  3E1R A;  2WSC J;  5AW2 B;  1L0N G;  1R5L A;  2E75 D;  2J1G A;  1BGY J;  1FDM A;  5KLV D;  1GD2 E;  1KMI Z;  4BRY A;  1QL2 A;  1AVO A;  5AW6 B;  2J64 A;  4ZKP A;  4EIJ A;  3HE5 A;  4RKU J;  3PRJ A;  1H0T B;  2ZFC A;  3EFF K;  1PV3 A;  3MD0 A;  1FID A;  2UWJ E;  1Q82 Q;  3R4Y A;  1SFC C;  1YJN P;  1WT6 A;  1NTM D;  1YI2 P;  1QX8 A;  3CLQ A;  2H43 A;  3CCJ P;  2Z5H A;  2QG4 A;  1SVF A;  2QJP B;  2C9L Y;  4IL6 H;  2BEQ D;  1W2B O;  1GU4 A;  4EOT A;  2K9J B;  2FYU G;  1JY3 P;  3V4Q A;  3RGU A;  2BCC E;  1N73 C;  2KLU A;  4EI2 A;  1VF5 B;  2MKV A;  1P84 H;  1N2D C;  3M9B A;  1S9K D;  2FKW B;  1URQ A;  1L4A C;  1PGO A;  1FZC A;  2Q9I C;  1NTK K;  1HGZ A;  2NPS C;  1NHL A;  1KYO E;  1IC2 A;  2BCC J;  2OYH B;  5AVR B;  1X0T A;  3AEG C;  3RK3 E;  5B66 E;  1FZG B;  3SFD C;  1JM0 A;  3H32 C;  1N86 C;  3Q1M A;  3L71 E;  2KXP B;  1SQX E;  4DOJ A;  4PJ0 E;  5KJ7 D;  2J60 A;  1IFI A;  2WPR A;  2A45 G;  3V2Q A;  5CCH A;  1SQP D;  2JO1 A;  3LW5 J;  1KQF B;  3FX0 A;  1GL2 B;  1HBW A;  1BDC A;  1JTH A;  2Q3I A;  2RN0 A;  3EQ2 A;  4EYY Q;  1GMJ A;  1BE3 E;  2P58 A;  3L35 A;  1L0N K;  1T3J A;  3HD7 C;  1JY3 N;  1EDK A;  1ZW0 A;  4GDO A;  3L71 J;  1SQX J;  3AEC C;  4TT3 H;  1RF1 C;  2QVA A;  1KB9 I;  1RH5 B;  4W7Z A;  4XFJ A;  2G3A A;  3E1I A;  5CCG C;  3O6Q B;  1EZV I;  3BRT B;  1MFT A;  4PD4 H;  5KKZ B;  1MUU A;  1GK6 A;  3RK2 D;  2OQQ A;  1BE3 J;  3R2P A;  4N3Y B;  2WWW A;  1ZOY C;  2QM8 A;  3VP8 A;  4JYO X;  5AVV B;  1RE3 A;  3P8M C;  3L75 G;  2NZ2 A;  2J3U A;  1NTZ E;  1RF0 B;  2E74 D;  1DD4 A;  1KYO D;  2W6A A;  5AW9 B;  3H1I G;  1JCC A;  1VQL P;  1L0L G;  2KSE A;  1JY3 O;  1PGP A;  2HOD B;  2Z4E C;  2O1K A;  1HH0 A;  1HJ0 A;  2FYU K;  1DD3 A;  3RL0 g;  2R3C A;  1NTZ J;  2IZ0 A;  1SQQ G;  2WNP F;  1JCD A;  1H88 A;  1FZE B;  2FXM A;  2H7H A;  2J61 B;  3BRV B;  1ZRT D;  1HWT C;  1D7M A;  4UB8 E;  4WY4 B;  3L74 G;  4Y28 J;  2O01 J;  1BE3 D;  4LGD E;  1J1E B;  1SFC A;  5APX A;  2QSI A;  3L72 E;  3RK3 C;  5KAI H;  2J2P A;  3TYY A;  2W27 A;  5TIS E;  4LLH A;  2H89 C;  2FYZ A;  1JUN A;  3L72 J;  3MTU E;  3A0H H;  3GHG A;  3N7N A;  3C8V A;  5APY A;  1IZN B;  4B86 A;  3H1H D;  2AEJ A;  1Z56 A;  5KTB A;  2Y9Z A;  2Q9I A;  2NPS A;  2LKM A;  2GUS A;  3MUD C;  5KAF H;  1VL2 A;  1N7S D;  1FZA A;  1JY2 P;  1CW5 A;  4WBA A;  2ZJS E;  2Q3E A;  3H32 A;  1GDT A;  1SQV D;  1HF9 A;  2KZJ A;  4K3A A;  3IAO A;  2A06 E;  2C0W A;  3TGU E;  2FYN B;  3L72 D;  3CWB E;  2JHI F;  3CX5 H;  1AA0 A;  1PPJ G;  3AED C;  4L76 A;  3HD7 A;  1P84 D;  1AVY A;  1LTA C;  1L0L K;  1MKM A;  3O8Z A;  1RF1 A;  3S4R A;  2HR3 A;  5CCG A;  2H88 C;  3MZW B;  4H44 D;  2B87 B;  5GTH H;  3TGU J;  1M7L A;  1SQQ K;  3CWB J;  3HE4 A;  1PL5 A;  1YYC A;  4R9J A;  3A3Y B;  1S5L E;  3HRN A;  2XV5 A;  4GT1 A;  4D6T D;  1NU1 E;  3P8C E;  1JY2 N;  2R5B A;  5AVZ B;  2JJL A;  2ITA A;  2YMY A;  2HPC A;  3KZI E;  4UB6 H;  1EZV G;  2LXB A;  3P7K A;  2QJY C;  1JOC A;  2E5T A;  2Q5U A;  2WSC H;  2OAR A;  1DH3 A;  3I5C A;  3M9Q A;  3TNU B;  1OMI A;  1NU1 J;  1U57 A;  3L36 A;  2FFD B;  2ZXX A;  4DCK A;  2G8Y A;  1OIP A;  2Y0C A;  3NFQ A;  4I2L C;  4PD4 D;  1M1K Q;  2O01 N;  4GOE A;  3V4W A;  3VMX A;  2C9N Y;  3FGA D;  2MJZ A;  2PGD A;  2KNC B;  1VF5 C;  2ZYA A;  3E7K A;  1JY2 O;  4L74 A;  3NMD A;  5CJ4 A;  1Z3S A;  1EXJ A;  3CCE P;  5H2F E;  1CI6 B;  2CPS A;  3H1J G;  3EWK A;  1URQ D;  3FXE A;  3WUV A;  2OYH C;  1NJI Q;  1JNM A;  3KYQ A;  3CC2 P;  4JYC A;  3PJS K;  1FE6 A;  1ZP0 C;  1KIL B;  2E76 C;  1SQB D;  3IR9 A;  2J58 A;  1Z3U A;  1GL2 C;  2OGU A;  2WPS A;  1FBM A;  5GTI E;  3CC7 P;  3RK2 B;  3Q5P A;  3WUT A;  1IFM A;  2D39 A;  2IZ1 A;  1ZME C;  1LTI C;  3VTP C;  1RHZ B;  1A02 F;  4C7N B;  5CCH D;  3MUD A;  1QGK B;  3I55 P;  3U1C A;  5AW0 B;  3CX5 E;  4OGQ D;  3CI9 A;  2E74 B;  2J5U A;  4DZO A;  1JEK A;  5KKZ C;  4W80 A;  2KZI A;  4YTP C;  2WPV B;  2OYI C;  2RH0 A;  3KXD A;  1QL1 A;  2KYV A;  5AVX B;  3C1L A;  4OWF A;  1VQO P;  2DW3 A;  1Q90 D;  1YIT P;  1OVU A;  2JWA A;  1RF0 C;  3LW5 H;  1EDI A;  1T6A A;  1ZXG A;  1NTK E;  3BVH C;  3L73 E;  3KHU A;  5B66 H;  1FOS F;  1KFN A;  3CCU P;  2XND H;  1LTJ B;  4YXD C;  2IBZ D;  4PJ0 H;  2HOD C;  1M1J C;  4PV1 D;  2K9Y A;  4M3L A;  4BWN A;  1G1J A;  1NTK J;  1H8A A;  5KLV G;  1FZE C;  3L73 J;  1M8O B;  1HGV A;  2ZYD A;  2YKP A;  1J1E C;  1GU5 A;  2XKM A;  1MZ9 A;  1L0N E;  4HKZ H;  3AE1 C;  4N6J A;  3AE8 C;  3CX5 D;  1T8Z A;  3BAT A;  2KS1 A;  1LP1 B;  2POH A;  2KOG A;  2JR8 A;  2QJK B;  1SFC D;  2IDB A;  3KQG A;  1NTM G;  2W8Z A;  2JHL F;  4WVZ A;  2K9J A;  3RBX A;  1L0N J;  3M0A A;  2LXC B;  4ZFG A;  3KPE A;  4GKG A;  1SS1 A;  2N9B A;  2J3F A;  1VQM P;  2O01 H;  3N4X A;  3G3Z A;  3U59 A;  1FU1 A;  3WMM 0;  3CMA P;  1BCC E;  2FYU E;  1LT9 B;  1L4A D;  4ASV A;  1GTW A;  4JZC A;  4UB8 H;  1XTC C;  2NPS D;  3D6Z A;  3PP5 A;  3RL0 D;  2IYO A;  1BGY D;  3B5N A;  1P84 I;  1M57 D;  4H44 B;  2FYN C;  1BCC J;  2FYU J;  3I56 P;  2VRS A;  2FXP A;  3B8E B;  2WVR A;  3AEE C;  3CCR P;  1SQP G;  1KIL E;  3VMZ A;  2ZAE B;  4WWI A;  5TIS H;  4BRY B;  1FS0 E;  1QEX A;  2YIU C;  3AEB C;  4KHX A;  1NKN A;  2Q6Q A;  3O6Q A;  3HD7 D;  5KLI C;  1FIC A;  3HE5 B;  4RJT A;  2OYI A;  5K5G B;  5KLV K;  4DJG A;  1KFM A;  5CCG D;  1IK7 A;  2YNY A;  1NWQ A;  5E79 E;  1HVV A;  5APU A;  1J1D B;  1FDO A;  2D2C C;  2J3O A;  3A0B E;  2GA1 A;  1W5C E;  1FZB C;  1RF0 A;  2V7Q H;  2OTL P;  2H43 B;  1BCC D;  2HLO C;  1FZF B;  3BVH A;  4DT0 A;  2FY8 A;  1NAF A;  4I1L A;  3C9I A;  3BCC E;  2M5A A;  1NTM K;  4RO0 A;  4PD4 I;  2P7J A;  5B5E E;  1LTB C;  1M1J A;  1ZLL A;  2HYN A;  1IFP A;  1FZE A;  3L75 E;  2J61 A;  2BCC D;  1OVR A;  3MGN A;  5AW3 B;  2N1T C;  1KD1 Q;  4R4L A;  4RES B;  3BCC J;  1EDL A;  2XZR A;  1FZC B;  2GM4 A;  3H1I E;  2I1K A;  1L0L E;  1DX7 A;  1BE3 G;  3CXH E;  4H13 C;  1VQ5 P;  3MHV A;  3L75 J;  2QA4 P;  3SWY A;  4AQR D;  5AVW B;  3RK3 D;  1S5L H;  4JBZ A;  4H0L B;  3B4S A;  3L71 D;  1SQX D;  3GLM A;  2QE7 H;  1L0L J;  4L73 A;  3KZI H;  1JTH B;  1OFC X;  3CL3 D;  1KIL C;  2IPP A;  3USS A;  4OGQ B;  3BCC D;  3KDP B;  1SQP K;  1Q86 Q;  1KN7 A;  2JHM F;  3M06 A;  3RK2 C;  2E42 A;  3E1I B;  3F89 A;  1Y9B A;  2CPB A;  4Z1M H;  1GW3 A;  3H1H G;  2KIK A;  1IJD B;  1G2C A;  1USD A;  1X8Y A;  3GMA A;  2NRG A;  3OA7 A;  1KQL A;  3V2R A;  1LT1 A;  1VQK P;  2B89 A;  1RQU A;  1X79 B;  1NTZ D;  5H2F H;  1SQV G;  1N73 A;  4PV1 B;  1A02 J;  2IBZ I;  3V5B A;  5C39 A;  3L72 G;  3TDK A;  1L4A A;  1CSB A;  4R4M A;  2K1A A;  1KC8 Q;  2E5Y A;  2KP8 A;  1LTJ C;  1ZR2 A;  3L70 E;  3S9O A;  2ZVN B;  1N86 A;  3T97 B;  3AE5 C;  3W68 A;  5GTI H;  1PPJ E;  1FZB A;  4U3F E;  3VYI A;  3VP9 A;  2M0B A;  3CCQ P;  1LGH B;  2HLO A;  3OAK A;  2E75 B;  2V7Q J;  3H1L E;  5AW8 B;  3L70 J;  2M8R A;  2RKL A;  4D6T G;  1TU3 F;  1JB0 J;  3VOP A;  5CBO A;  1OW6 A;  2R3S A;  1GW4 A;  1ZR4 A;  1EC5 A;  2YO2 A;  3CPW O;  4U3F J;  3H6P A;  3CCV P;  1X22 A;  3GHG B;  4IFM A;  4IL6 X;  1H89 A;  3H1L J;  2N1T A;  2P2U A;  1YQ3 C;  3H1K E;  5APS A;  5CHX A;  1KB9 E;  1R5S A;  1EZV E;  3S1K A;  2Q9I B;  4LC1 A;  5BVZ A;  4XA4 A;  3RL0 B;  1FZA B;  2GUV A;  1VF5 D;  2FXO A;  3L70 D;  3AE3 C;  2J3F D;  2XNX B;  2HG5 D;  2J0Y A;  2J3G A;  3H1K J;  3V2P A;  1HJB A;  1T3U A;  1LWU B;  2Z4E A;  2B9B A;  2QJP C;  1PP9 E;  2C0X A;  1FAV A;  1WMK A;  1LTT C;  4U3F D;  2A06 D;  3TGU D;  4QMA A;  3CWB D;  1KIL A;  3H1L D;  1SQV K;  1JC9 A;  3FXD A;  4H44 C;  3HD7 B;  2ZT9 D;  3G9R A;  3H1J E;  3B5N D;  1KQG B;  1YTZ I;  2E76 D;  3TF5 A;  1SQB G;  1PP9 J;  1GL2 D;  3HE4 B;  2JHH C;  2J5Z A;  1DEE G;  1Q2N A;  3UIA A;  1ZN5 A;  1GK4 A;  3H1K D;  1QVF O;  1EXI A;  5AW1 B;  2ZYG A;  3H1J J;  4W7Y A;  3CCL P;  1FZG C;  1NU1 D;  2Y0E A;  3P8C D;  4AYC A;  3CCS P;  2HPC B;  4KJM A;  3CME P;  1OW8 A;  2QEX P;  1JO5 A;  1HUC A;  1FZF C;  3VMA A;  4M7H A;  4BXL A;  1VPC A;  2WPQ A;  1PP9 D;  3FWN A;  5APV A;  1OXZ A;  4N78 E;  3G71 P;  4NYT A;  3GF3 A;  4CPG A;  2IBZ G;  2P1J A;  1T2K C;  3AEF C;  3M0D C;  1BSH A;  2R5D A;  1KYO I;  3JCU E;  4ZKU A;  3CD6 P;  3AE4 C;  2AXT E;  5TJH A;  3D70 A;  1AJY A;  2YKQ A;  1DEB A;  2P67 A;  4A7P A;  2W6B A;  1K8A Q;  2A45 H;  5KLV E;  5E79 H;  4H0L C;  1VQ7 P;  3A0B H;  1VQP P;  2QIW A;  2H8P D;  1FJK A;  2JHK F;  3FIB A;  2WT7 B;  3AE6 C;  1JMM A;  1H0T A;  2R44 A;  4OGQ C;  2WTY A;  1FJP A;  4WY4 C;  3TK1 A;  2IFM A;  1YIJ P;  1NAY A;  1SQB K;  5KLV J;  5B5E H;  1NTM E;  1BDD A;  3E1I C;  3JC2 2;  1X9V A;  4K35 A;  2PRR A;  3CC4 P;  2XDJ A;  1OVV A;  2WZ7 A;  1NTM J;  4KT0 J;  1L2P A;  4JF7 A;  5CMZ A;  1E5W A;  1Q81 Q;  3CXH H;  1N7S B;  1BGY G;  2WQY C;  1NTK D;  4PV1 C;  1K04 A;  1S9K E;  3L73 D;  3HTK B;  4I7Z B;  3PLN A;  2W6J H;  2W90 A;  3M9H A;  1EQ7 A;  1QLE D;  3PH0 A;  2YO3 A;  2OYH A;  1U7J A;  2L5G B;  3HUS B;  3GG2 A;  1FZG A;  1RE4 B;  3Q2Y A;  2I8D A;  1L0N D;  1SQP E;  5M1B A;  2J0G A;  2QJY B;  1PFI A;  1RQV A;  2KS1 B;  1DIP A;  1FZF A;  2E75 C;  1GL2 A;  5AVS B;  3M91 A;  2D2C D;  2QM7 A;  1RY3 A;  3CCM P;  1BCC G;  1KZU B;  3A2A A;  3IF4 A;  2K88 A;  3AE9 C;  1USE A;  5AVY B;  1VQ6 P;  2B88 A;  4Y99 B;  1SQP J;  3H25 A;  4HYT B;  3GHG C;  2BAS A;  5BU8 B;  3VN0 A;  2WSE J;  3M0D A;  4GOD A;  1R8E A;  2Q1K A;  2KI7 B;  3FWL A;  3ABV C;  1AQ5 A;  2JKV A;  2N9Y B;  2BCC G;  2N1T D;  1OW7 A;  3MP7 B;  3PHL A;  4JYB A;  4ASW A;  3SSU A;  3RL0 C;  1FZA C;  2FYU D;  5CBN A;  2XNX C;  4ZNC A;  1K05 A;  2FBW C;  2ZT9 B;  1LTG C;  1N7L A;  4H13 D;  3G4S P;  3B5N B;  1LWU C;  2E76 B;  2HOD A;  3BAS A;  3V2N A;  2J0H A;  4R9T A;  2YKO A;  3AEA C;  4OH8 B;  2WMM A;  2WSF J;  1NH4 A;  1ZRT E;  3GW6 A;  1N8R Q;  2FFD C;  2M3B A;  3L71 G;  3RBZ A;  1SQX G;  1HTL C;  1VDF A;  1YQ4 C;  2WSS H;  4WY4 A;  1BSN A;  1URQ B;  3WU2 E;  2Y9Y A;  1KIL D;  1Y8A A;  3D71 A;  1S4X A;  1MV8 A;  3BCC G;  3A5T A;  2AEM A;  4L75 A;  2OYI B;  1E79 H;  1SQQ E;  5KJ7 C;  3IN6 A;  1KB9 H;  4IOI H;  2XU6 A;  3AE7 C;  3L74 E;  3H1I J;  3VMY A;  4XE5 B;  3L37 A;  1YJW P;  3BVH B;  2HPC C;  4U7J A;  1FDI A;  3G6E P;  1SQQ J;  2M5A B;  1S2E A;  1LTS C;  3H1H E;  1NTZ G;  5APQ A;  1YTZ T;  2HFE D;  2E43 A;  1M1J B;  5L8R J;  4GIF A;  5AW4 B;  1IK9 A;  2SPZ A;  3L74 J;  2IFN A;  4YXW H;  4IFF A;  2FIB A;  5AW7 B;  2YXR B;  3L75 D;  4IL6 E;  1SQV E;  2GY7 A;  1S3J A;  2AEF A;  1K9M Q;  3T97 A;  4MN4 C;  2E74 C;  3P32 A;  3H1H J;  5AVQ B;  2JDI H;  1RE3 B;  3H1I D;  4EDF A;  2AXC A;  1L0L D;  1EDJ A;  2RMZ A;  2J59 M;  3CXH D;  1P84 E;  1SQQ D;  4NPD A;  1SQV J;  2Y0D A;  3LIE A;  5APW A;  2CK3 H;  2P10 A;  4EPU A;  3L74 D;  2W83 C;  2B87 A;  2LR2 A;  1FOS E;  3LID A;  3F5H A;  5AW5 B;  2V4H A;  1VQ8 P;  1NVO A;  1SLQ A;  1SQX K;  2Z5I A;  3D6Y A;  3SWF A;  1Q7Y Q;  4D6T E;  1UIX A;  1SFC B;  4JQ0 D;  3CX5 I;  4WB4 A;  2O3J A;  1KV4 A;  2XNX A;  1G2C B;  4OVN F;  2YMK A;  4TLF A;  2M3E A;  1IFJ A;  4HH2 A;  1WRG A;  4ZMD A;  3QWO C;  3Q5S A;  4D6T J;  1LWU A;  2QJK C;  3L70 G;  1OX3 A;  2L91 A;  3JCU H;  1YHQ P;  3ITK A;  5DJT B;  3TNU A;  2AXT H;  2R32 A;  1K73 Q;  2FFD A;  4C46 A;  4PD4 E;  1N73 B;  5AVU B;  1J2J B;  1NKZ B;  3PTZ A;  4U3F G;  2A06 G;  1L4A B;  1N7S C;  3TGU G;  1Y47 A;  1NTZ K;  3CWB G;  2KNC A;  5AVT B;  3H1L G;  4YPC A;  4HB1 A;  2YIU B;  2NPS B;  3QH9 A;  1XTG B;  4I7Z C;  5KLI B;  3U1A A;  1QVG O;  2OTK E;  1CI6 A;  1OWA A;  1AFO A;  5KJ7 A;  4IFD K;  3H32 B;  1N86 B;  1LT9 C;  1YJ9 P;  1PZQ A;  2PAJ A;  4NPF X;  2D2C B;  3HUS C;  1FIB A;  1FZB B;  1PPJ D; 
#chains in the Genus database with same CATH homology
 1CZQ A;  5APX A;  3A7O A;  1FZD A;  1RE4 C;  2HLO B;  3RK3 C;  4KHX A;  1NKN A;  3HD7 D;  1FIC A;  2H8P D;  2J2P A;  3HE5 B;  1FJK A;  2KB7 P;  2OYI A;  2ZXE B;  2JHK F;  3FIB A;  5KLV K;  2WT7 B;  3TYY A;  1KFM A;  2WIT A;  5CCG D;  1JMM A;  4C7R A;  2JEE A;  1FJP A;  2W27 A;  2YNY A;  2WTY A;  4WY4 C;  1NWQ A;  1RF1 B;  3TK1 A;  2IFM A;  1HVV A;  5APU A;  1SQB K;  4LLH A;  1J1D B;  2FYZ A;  4C7N A;  1JUN A;  2J3O A;  1FZB C;  4I6M C;  2PP6 A;  1RF0 A;  3MTU E;  2N1T B;  3GHG A;  4M7F A;  3N7N A;  3E1I C;  2H43 B;  2HLO C;  1FZF B;  3BVH A;  1IFD A;  4Y99 C;  5APY A;  1X9V A;  2O1J A;  1NAF A;  4I1L A;  2KSJ A;  3C9I A;  3OJA B;  2XDJ A;  1NTM K;  4AUW A;  4B86 A;  2P7J A;  1Z56 A;  5KTB A;  1LTB C;  2Q9I A;  2WZ7 A;  1M1J A;  2NPS A;  3IFM A;  1ZLL A;  2LKM A;  2GUS A;  1T2K D;  1J1D C;  1N7S D;  4JF7 A;  1FZA A;  1JY2 P;  2HYN A;  5CMZ A;  1CW5 A;  4WBA A;  1E5W A;  1FZE A;  2J61 A;  3MGN A;  5AW3 B;  2N1T C;  1N7S B;  3L4F A;  3NTN A;  2H43 C;  3H32 A;  1S9K E;  1GDT A;  4RES B;  3HTK B;  5APT A;  2Z4E B;  1MFZ A;  2XZR A;  1FZC B;  2GM4 A;  2I1K A;  1LTJ A;  2C0W A;  3M9H A;  1EQ7 A;  2JHI F;  1DX7 A;  3B5N C;  2YO3 A;  2WSE H;  3SWY A;  2OYH A;  4AQR D;  2L5G B;  3HD7 A;  3HUS B;  5AVW B;  1IO4 A;  2WT7 A;  2Q7C A;  3RK3 D;  1LTA C;  1L0L K;  1FZG A;  1RE4 B;  3O8Z A;  1RF1 A;  1SP4 A;  1URQ C;  1W2E A;  5CCG A;  3RK3 B;  2A45 I;  1FZC C;  1M7L A;  1SQQ K;  2J0G A;  3HE4 A;  1YYC A;  4WY4 D;  1JTH B;  1PFI A;  3CL3 D;  1FZF A;  4R9J A;  1GL2 A;  1KIL C;  2IPP A;  5AVS B;  3M91 A;  1NOH A;  3A3Y B;  2QM7 A;  1RY3 A;  3HRN A;  3KDP B;  2XV5 A;  4GT1 A;  1SQP K;  1KZU B;  3A2A A;  3M06 A;  1JY2 N;  3P8C E;  3RK2 C;  2R5B A;  5AVZ B;  3TSI A;  2E42 A;  2JHM F;  5BU5 A;  3MIW A;  3E1I B;  2JJL A;  5AVY B;  1G1I A;  2YMY A;  1GZL A;  2HPC A;  4Y99 B;  2CPB A;  1NO4 A;  2WSF H;  1GW3 A;  4HYT B;  3GHG C;  1ZV8 A;  2BAS A;  5CCH C;  1IJD B;  1G2C A;  3P7K A;  5BU8 B;  3VN0 A;  3EFG A;  3M0D A;  1X8Y A;  1N7S A;  1JOC A;  1NU1 K;  3OA7 A;  1KQL A;  2Q5U A;  3V2R A;  3HTK A;  2WSC H;  2OAR A;  2IX7 C;  1DH3 A;  1AQ5 A;  3I5C A;  3M9Q A;  3TNU B;  2N1T D;  3L36 A;  2FFD B;  4JYB A;  1X79 B;  3II6 A;  3NFQ A;  4I2L C;  4N78 D;  1N73 A;  5CJ0 A;  3RL0 C;  1FZA C;  1LT9 A;  4O9B A;  3NXS A;  2XNX C;  3V4W A;  1A02 J;  3V5B A;  3VMX A;  3HUS A;  2C9N Y;  2MJZ A;  1IFN A;  1L4A A;  1RE4 A;  1LTG C;  2I1J A;  1CSB A;  1N7L A;  1JY2 O;  3B5N B;  1LWU C;  2HOD A;  3BAS A;  3NMD A;  2KP8 A;  3V2N A;  5CJ4 A;  2YKO A;  1Z3S A;  2J0H A;  4R9T A;  1LTJ C;  4OH8 B;  1ZR2 A;  1CI6 B;  1RE3 C;  2KLV A;  2CPS A;  1NH4 A;  2FFD C;  1URQ D;  2M3B A;  1HTL C;  1VDF A;  4WY4 A;  2OYH C;  1N86 A;  1URQ B;  5AW2 B;  1JNM A;  3KYQ A;  2J1G A;  1FZB A;  1KIL D;  1FDM A;  3VYI A;  4JYC A;  3VP9 A;  1GD2 E;  1LGH B;  2HLO A;  1MV8 A;  3OAK A;  1KIL B;  1QL2 A;  5AW8 B;  3A5T A;  2M8R A;  5AW6 B;  3IR9 A;  2J58 A;  2J64 A;  4ZKP A;  2OYI B;  4EIJ A;  1Z3U A;  1GL2 C;  3HE5 A;  2WPS A;  5KJ7 C;  3VOP A;  1FBM A;  2ZFC A;  3RK2 B;  2XU6 A;  1GW4 A;  1IFM A;  1ZR4 A;  2D39 A;  3MD0 A;  1FID A;  1LTI C;  3VTP C;  1A02 F;  4C7N B;  5CCH D;  3MUD A;  2YO2 A;  1SFC C;  3H6P A;  1WT6 A;  3VMY A;  3GHG B;  4IFM A;  3U1C A;  4XE5 B;  3L37 A;  1H89 A;  3BVH B;  3CLQ A;  5AW0 B;  2HPC C;  2N1T A;  2P2U A;  3CI9 A;  2H43 A;  5APS A;  5CHX A;  4DZO A;  2Z5H A;  4W80 A;  1SVF A;  2C9L Y;  1LTS C;  2OYI C;  5APQ A;  1YTZ T;  2HFE D;  2E43 A;  2Q9I B;  1QL1 A;  1M1J B;  2KYV A;  5AVX B;  4GIF A;  4EOT A;  1GU4 A;  5AW4 B;  1IK9 A;  4LC1 A;  2IFN A;  5BVZ A;  4IFF A;  2FIB A;  4XA4 A;  1JY3 P;  3RL0 B;  1FZA B;  5AW7 B;  2GUV A;  3V4Q A;  2XNX B;  2J3F D;  1RF0 C;  3LW5 H;  2HG5 D;  2J0Y A;  2J3G A;  1N73 C;  3V2P A;  3BVH C;  1HJB A;  2GY7 A;  1T3U A;  1N2D C;  3M9B A;  3T97 A;  1S9K D;  2FKW B;  1FOS F;  1URQ A;  3P32 A;  1LWU B;  2Z4E A;  5AVQ B;  1KFN A;  1L4A C;  1LTJ B;  2C0X A;  1FZC A;  1RE3 B;  1FAV A;  1LTT C;  2Q9I C;  2HOD C;  1M1J C;  1NTK K;  1HGZ A;  2NPS C;  1KIL A;  1NHL A;  1SQV K;  4M3L A;  1IC2 A;  1JC9 A;  1G1J A;  2J59 M;  2OYH B;  5AVR B;  3HD7 B;  1H8A A;  1FZE C;  3LIE A;  5APW A;  1FZG B;  3H32 C;  3B5N D;  1N86 C;  1HGV A;  1YTZ I;  4DOJ A;  2YKP A;  1J1E C;  1GU5 A;  4EPU A;  2XKM A;  1MZ9 A;  1GL2 D;  5KJ7 D;  2J60 A;  1IFI A;  3HE4 B;  2WPR A;  2JHH C;  2J5Z A;  2A45 G;  3V2Q A;  5CCH A;  1HBW A;  1GL2 B;  3LID A;  4N6J A;  1FOS E;  3UIA A;  1T8Z A;  1ZN5 A;  3BAT A;  1JTH A;  2Q3I A;  5AW5 B;  1SLQ A;  1GK4 A;  2POH A;  3EQ2 A;  2KOG A;  5AW1 B;  1SQX K;  2Z5I A;  1SFC D;  3SWF A;  3KQG A;  3L35 A;  1L0N K;  1T3J A;  3HD7 C;  4W7Y A;  2JHL F;  1JY3 N;  1SFC B;  4WB4 A;  1FZG C;  1RF1 C;  3P8C D;  4AYC A;  2HPC B;  4W7Z A;  3E1I A;  5CCG C;  3M0A A;  4ZFG A;  2XNX A;  3BRT B;  3KPE A;  1G2C B;  1MUU A;  4GKG A;  1JO5 A;  1GK6 A;  2N9B A;  1IFJ A;  4HH2 A;  1HUC A;  1WRG A;  3RK2 D;  1FZF C;  2J3F A;  2O01 H;  3R2P A;  4M7H A;  4N3Y B;  3N4X A;  3G3Z A;  1LWU A;  3U59 A;  1VPC A;  2WWW A;  2WPQ A;  1FU1 A;  2QM8 A;  3VP8 A;  4JYO X;  5AVV B;  1RE3 A;  3P8M C;  3TNU A;  2J3U A;  3WMM 0;  2R32 A;  5APV A;  1RF0 B;  2FFD A;  1OXZ A;  4C46 A;  4N78 E;  1N73 B;  1LT9 B;  2W6A A;  5AW9 B;  1L4A D;  5AVU B;  1J2J B;  4NYT A;  1NKZ B;  1JCC A;  1GTW A;  4JZC A;  2P1J A;  1T2K C;  1L4A B;  1XTC C;  2NPS D;  3M0D C;  1N7S C;  3PP5 A;  1NTZ K;  1JY3 O;  2R5D A;  5AVT B;  4ZKU A;  2HOD B;  2Z4E C;  2O1K A;  3RL0 D;  2NPS B;  1HH0 A;  2FYU K;  1XTG B;  3B5N A;  2R3C A;  2WNP F;  3U1A A;  1JCD A;  2YKQ A;  1H88 A;  1CI6 A;  1DEB A;  1OWA A;  1AFO A;  1FZE B;  2FXM A;  5KJ7 A;  2H7H A;  2P67 A;  3BRV B;  4IFD K;  2J61 B;  1HWT C;  2VRS A;  2W6B A;  4WY4 B;  3H32 B;  3B8E B;  1N86 B;  1LT9 C;  2A45 H;  2PAJ A;  4LGD E;  1J1E B;  3HUS C;  1FIB A;  1FZB B;  3VMZ A;  1SFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...