1M1JC

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
390
structure length
390
Chain Sequence
TRENCCILDERFGSYCPTTCGIADFFNKYRLTTDGELLEIEGLLQQATNSTGSIEYLIQHIKTIYPSEKQTLPQSIEQLTQKSKKIIEEIIRYENTILAHENTIQQLTDMHIMNSNKITQLKQKIAQLESHCQEPCKDTAEIQETTGRDCQDIANKGARKSGLYFIKPQKAKQSFLVYCEIDTYGNGWTVLQRRLDGSEDFRRNWVQYKEGFGHLSPDDTTEFWLGNEKIHLITTQSTLPYALRIELEDWSGKKGTADYAVFKVGTEEDKYRLTYAYFIGGEAGDAFDGFNFGDDPSDKSYTYHNGMRFSTFDNDNDNFEGNCAEQDGSGWWMNRCHAGHLNGPYYIGGVYSRDTGTNSYDNGIIWATWRDRWYSMKKTTMKIIPFNRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha subunit
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
molecule tags Blood clotting
total genus 125
structure length 390
sequence length 390
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
C PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1m1jC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1m1jC02
1RF0C 1LTJB 1FZAA 2OYHA 2A45G 1Z3SA 3GHGA 2J61A 1LWUB 2Q9IC 1FZEB 2H43C 2J3GA 2JHIF 2HPCA 2JHLF 1FICA 1FZFC 1FZGC 2Q9IB 3H32A 1FZBC 3E1IC 3HUSA 4NYTA 1RF1A 4M7FA 1M1JA 2WNPF 1JY3N 1JY3O 1FZFB 1FZGB 2FFDA 1JY2N 1JY2O 2J0GA 3BVHC 1FZBB 3E1IB 1FZEC 2J3FA 4ZFGA 1LTJA 2J0HA 1FZCC 1RE4B 2A45I 3BVHB 4JYOX 2HODA 2J1GA 1LWUA 1N86C 1W2EA 2A45H 4R9TA 1RF0A 2J60A 1FZCB 1JC9A 2Z4EC 1N73C 2J5ZA 2J0YA 2HLOC 2Q9IA 1N86B 2J64A 2H43A 1FIDA 2Z4EB 1RE4C 1RE3C 1N73B 1FZFA 1FZGA 2HLOB 2J61B 2JHMF 1FZBA 1FZDA 3E1IA 1JY3P 3FIBA 1JY2P 1RE3B 4R9JA 3BVHA 3H32B 2J3UA 1FZEA 2OYIC 1LT9C 2XNXC 3HUSB 2J3FD 1FIBA 1FZAC 2OYHC 1FZCA 1M1JB 2JHKF 2GY7A 3GHGC 2OYIB 1LT9B 2XNXB 1N86A 4M7HA 1FZAB 4EPUA 2OYHB 2Z4EA 2HPCC 1T3UA 1N73A 3GHGB 2J3OA 2HLOA 3H32C 2FIBA 2HODB 1Z3UA 3HUSC 2D39A 1RF0B 1RF1C 2HPCB 1M1JC 1RE4A 1RE3A 4JZCA 2FFDC 2H43B 1RF1B 1LTJC 2J2PA 2JHHC 2FFDB 2HODC 1LWUC 2XNXA 1LT9A 2OYIA
chains in the Genus database with same CATH superfamily
4JF7A 1WMKA 3RK3B 1T2KD 3V4WA 1Z3SA 3OAKA 1FDMA 1ZLLA 2BASA 2HPCA 1VQOP 2ZYGA 1MKMA 1BSNA 5E79E 3A5TA 2IDBA 3AEAC 4IFMA 4OGQC 1LJ2A 5E79H 3RBXA 2W90A 3PTZA 1N86C 4D6TG 2L5GB 1H0TA 4H44C 1FZCB 1LNQA 2L91A 2UWJE 1EDLA 3M9BA 1FZFA 2QJKB 1CW5A 2JHMF 1OXZA 2R3SA 3FX0A 2C0WA 3E1IA 1FZDA 2YIUC 5AW3B 1NTZG 4L74A 1EXIA 2JO1A 2QM7A 3RK2C 1LT9C 1H88A 1FOSE 5AVZB 4C7RA 3VYIA 1N7SD 3GF7A 1FZAB 1VQMP 1NTZE 2HLOA 2W6AA 1PV3A 4U7JA 1T6AA 1SQQD 1SQPK 1ZOYC 2M3BA 2AEFA 4W7YA 4RJTA 4BRYA 1IFJA 1NTKK 1LTJB 1YIJP 3RK3E 3PJSK 3Q2YA 1N7SB 2MJZA 2LXCB 3VMAA 4WWIA 3BRTB 5AVYB 1OW8A 1L0LD 1FZGC 2HR3A 5AVQB 2WSSH 3AEBC 1IC2A 1PPJD 2H7HA 4GDOA 1FZBB 1VQ6P 1WT6A 2O1KA 1AQ5A 1M8OB 4UB6E 2KXPB 2N9YB 5AW9B 4UB6H 2RKLA 5CCHC 2WZ7A 1HBWA 4IL6E 1ZR2A 4L76A 2QRXA 4NPFX 3PP5A 4GKGA 3B8EB 4PD4D 2ZFCA 3AE5C 4IL6H 1NAFA 3CPWO 2CK3H 4H0LD 4I1LA 3JC22 1T3JA 3USSA 3VTPC 4GIFA 3L71D 3E7KA 3KDPB 1KILA 4A7PA 1G2CB 2WVRA 3MHVA 1OW7A 3A0HE 2H89C 2FFDB 3VP9A 3SWFA 1LWUC 1G1IA 2J5UA 1SQQG 3BCCG 1ZRTD 3A0HH 1NAYA 1JMMA 4H0LB 1U7JA 3M06A 5KTBA 1H8AA 1SQXD 1IFNA 5AVTB 1GU5A 3EFGA 1DIPA 5KJ7A 2N1TB 2WNPF 3CXHD 1SQQE 3UIAA 2J0GA 2GM4A 3N7NA 1FZEC 1L0LG 3L70D 1SS1A 4I6MC 4XE5B 5CMZA 1XTCC 2Q9IA 1MZ9A 3LIDA 4N78E 2Z4EB 1QVFO 1RE3C 2QJPB 4UB8E 1L0LE 2OARA 1NTZK 4JYCA 1RY3A 1JY3P 1Y47A 1PPJE 4UB8H 2YNYA 2J3UA 2XNXC 2P67A 3PRJA 3HE4A 1K73Q 2WMMA 4M7HA 5AVUB 3RL0D 2FIBA 3P8MC 1GMJA 3D70A 1CI6B 3CWBD 3BATA 1GL2D 3VOPA 1L0LJ 3B71A 2IBZE 2JWDA 2PRRA 1DD4A 3L71G 4PD4E 1GD2E 3OA7A 4IFDK 1JO5A 1SFCD 2HODC 2CPSA 1SQPD 1GZLA 3V4QA 1URQC 4PD4H 4TLFA 4GOEA 1Q7YQ 3L75D 3GG2A 2J3GA 4WY4C 1NTKD 3RL0B 2PAJA 1FICA 3WU2E 3V6IA 1NO4A 4ASVA 1YBKA 3L71E 1NKZB 2WT7B 1RF1A 3SWYA 1GL2B 2RMZA 3WU2H 5CCGD 1NJIQ 1SQXG 2J3FA 3SFEC 2PGDA 1KFNA 1S2EA 3B5NC 2P1JA 1OIPA 3K5BA 2BEQD 2NPSC 5TISE 4C7NB 2E75D 1JM0A 4YXDC 1ZRTE 2Y9YA 3VMZA 2IX7C 3L70G 3L72D 5TISH 1SQXE 1RE4C 3CCVP 1Q81Q 1SP4A 3L71J 4YPCA 1JY2P 2E76C 2E74D 2B87B 2YKOA 3CXHE 2PFXA 3BVHA 5AVRB 2QM8A 1NOHA 2ZVNB 3L70E 1E79H 3CXHH 2YO3A 2HG5D 2FBWC 2GUSA 1BGYJ 1YTZI 2N1TA 2WPSA 5BU5A 3H1LD 3H32C 3KXDA 1JTHA 2IFMA 2HPCB 2BCCD 3AE7C 1VF5C 1SQXJ 4W7ZA 2WSFH 1KN7A 2E74B 2QA4P 1J1DC 3CLQA 3LW5H 5BU8B 1ZP0C 1SQQK 3CWBG 1ZXGA 1Y9BA 1DEBA 3H1ID 3L70J 3CCRP 3AECC 3TDKA 3AE3C 3MD0A 1SQPG 2DW3A 2WSFJ 1LTTC 3L75G 1J1EB 2QIWA 1FZFB 1SQVJ 3CWBE 2BEZF 3TF5A 3E1IB 3LW5J 1NTKG 3M0DC 1L0LK 1YQ4C 1T2KC 3E1RA 1FZCC 3KQGA 1Q90D 2OTJP 4R9TA 4DZOA 1SQPE 2JKVA 1K04A 1CI6A 5GTHH 1S5LX 4BWNA 1E5WA 3L75E 1BDCA 1NTKE 2HLOB 4LC1A 5KAIE 4DJGA 3AE9C 1KTMA 3L72G 3CWBJ 1FC2C 1D7MA 5KAIH 4XFJA 1FZAC 3ZDMA 4BRYB 1VQPP 2WT7A 1S72P 1BE3J 2H88C 1GL2A 2ZYDA 4DCKA 3HUSC 3L72E 1PIXA 1AJYA 1IK9A 4RESB 3L73D 1AVYA 3OJAB 1LTJC 1AV1A 3RK3D 1M7LA 3D6ZA 2BCCG 1N7SC 2M8RA 1LTBC 2OYHA 1W2BO 2H43C 2KUBA 2O01H 1X22A 2P2UA 5CCGA 2JHLF 4NPEA 3H1LE 2Y9ZA 2HFED 4GODA 1FZBC 1VQ5P 2QSIA 2W27A 3LIEA 3C8VA 3AEFC 1KILD 3L72J 2KIKA 2BCCE 1FS0E 1SQXK 1P84D 3N4XA 2IFNA 3EFFK 1W2EA 5AVVB 1QL1A 1U57A 2O01J 2QJYB 3H1IE 3P8CD 3V5BA 3H25A 3KYQA 3H1LJ 4L73A 1KILB 5KJ7D 1NTMJ 4R9JA 2BCCJ 1SQVK 4H13D 3HE5B 1NU1D 4Y99B 2FKWB 2Q5UA 3M91A 3JCUE 5AW1B 1N73A 2J3OA 3H1IJ 2E43A 2XZRA 1OWAA 2XDJA 3KHUA 3JCUH 3G71P 1M1JC 4BXLA 2FFDC 3I5CA 4WVZA 1KD1Q 2A06D 3V2QA 3KZIE 5AW2B 1DH3A 3PHLA 4H13B 4H0LC 4JYBA 4W80A 1RF0C 1KQLA 3KZIH 3L73G 3CMAP 1LTAC 1EZVD 1LGHB 1G1JA 3QWOC 1SQBD 4B86A 2Q9IB 1IJDB 1M90Q 1HUCA 4K35A 3L73E 5K5GB 2WSEH 3U59A 4N78D 2K9JA 1X79B 2Z4EC 2QJPC 1UIXA 3HE4B 3AEEC 1KZUB 3NMDA 1L4AA 3TYYA 5DJUB 3FIBA 4PV1D 2SPZA 4JQ0D 1KILE 2YMYA 5H2FH 1VQ9P 2WSEJ 1P84E 3L73J 2J3FD 5TJHA 1ZW0A 4ZKUA 2ITAA 1XTGB 2R32A 2Q3EA 1P84H 3S9OA 4LGDE 4OGQD 1K9MQ 1NU1G 3P8CE 3MUDA 1Z3UA 2IBZD 2Y0EA 1OVVA 2W6BA 4PV1B 2O1JA 1LTIC 1NHLA 1RF1B 5CJ0A 3AE4C 1YI2P 2IBZI 1OFCX 4OVNF 4PD4I 4WBAA 1NU1E 3PLNA 1QEXA 4U3FD 2A06G 3O6QB 1PL5A 2JP3A 2WITA 4OGQB 3FXDA 2KZJA 2N1TD 2M0BA 3G9RA 3HE5A 5KKZB 1NGMB 2P7JA 2MKVA 1RH5B 2ZT9C 4M7FA 1SFCC 4IL6X 3CC2P 1BGYD 2A06E 1A02F 2J0HA 1GTWA 3BVHB 2J1GA 2QG4A 3F5HA 1NU1J 1EZVE 3RK2B 1L0ND 1PP9J 3AE6C 1KB9D 4IFFA 4WB4A 1RHZB 1JTHB 1SQBE 3CCSP 2R5BA 1YITP 2R44A 4R4MA 1M1KQ 1HJ0A 5APTA 3SFDC 1PPJG 2O01N 2E75C 2ZYAA 3CXHI 3IFMA 4NPDA 2G8YA 3HD7A 2KLUA 2KI7B 3CL3D 1MUUA 3A7OA 1Q86Q 2YXQB 4OH8B 1SQVD 2HPCC 3T97A 2D39A 2E74C 3CCJP 1SQBJ 2FYNC 1PGJA 2J2PA 2IBZG 4C46A 3JSVC 2OYIA 2KNCA 3VMYA 2W83C 1X8YA 3TK1A 2OTLP 3GHGA 3M0AA 2JWAA 1MFZA 4OWFA 1JUNA 1J1EC 1FZFC 3BRVB 3E1IC 4U3FG 2P58A 5APSA 1YTZT 1JY3N 2JEEA 2R5DA 2W6JH 5CBNA 3NTNA 3Q5RA 1BE3D 2ZXXA 3V2PA 4I7ZC 2WWWA 3G3ZA 1BGYG 4U3FE 2HLOC 2WTYA 1S1CX 1VQLP 1WRGA 5BVZA 3EQ2A 3CX5D 4ZKPA 3H1KE 1PFIA 2D2CD 2Z5IA 1VQ4P 1HGVA 3O6QA 4N6JA 1BGYE 3IN6A 1GW4A 3WUVA 2GY7A 4LLHA 5CBOA 4HYTB 1RQUA 1N86A 1N2DC 4AQRD 4O9BA 4EPUA 2OYHB 3II6A 1T3UA 1NU1K 1EXJA 4U3FJ 1L0NE 3F89A 1KB9E 3FWLA 3MZWB 1YQ3C 1FBMA 4JZCA 1SQVG 2D2CB 3H1KJ 5APUA 1LP1A 1KB9H 2OYOA 1LT9A 5KLVJ 3FXEA 2A45G 1YHQP 1NTMD 1FZEB 4KJMA 5AW5B 1SQVE 3HRNA 1EC5A 3RBZA 1L0NJ 3RK3C 3U1AA 1JY3O 3WUUA 1JY2N 1SQBK 4ZFGA 1FU1A 2QJYC 2A45H 1L2PA 1OZHA 2Q3IA 2KZIA 1BE3G 4EDFA 1KYOD 5GTIE 4EI2A 1KILC 1ZV8A 1JEKA 2ZAEB 1N73B 1FZGA 3RGUA 2I8DA 5GTIH 3BASA 4Y99C 5GTHE 2J58A 1KC8Q 1BE3E 1DEEG 2KB7P 3V2RA 1CSBA 2QJKC 5APWA 2O3JA 1VQKP 2Y0CA 2I1KA 2HODB 5KJ7C 2V7QH 1PGQA 3Q1MA 1VQ7P 3CC4P 1URQB 5CCHA 3CX5E 2KLVA 4H13C 3OW2O 1L4AD 2KK7A 1FOSF 1NWQA 2IZ1A 3CX5H 4D6TD 4ASWA 1QL2A 2FXMA 3H1HD 1AA0A 4I2LC 2E76D 2Q9IC 2K9JB 2V7QJ 1NKNA 2JJLA 2FY8A 3G6EP 1JOCA 3CI9A 3P32A 1OVRA 3H1LG 2NPSB 2AXTH 1NTMG 1L4AB 1JY2O 1J2JB 2J59M 1RE4B 1KMIZ 1LWUA 1FDIA 4YTPC 4Z1MH 1GK4A 2W8ZA 2WQYC 2E76B 3D71A 5KLVK 3AE1C 3VP8A 1NH4A 3H1IG 1NTME 1JCCA 2M3EA 3I56P 1BSHA 1YJNP 2VRSA 1VQNP 2OTKE 2YKPA 3GLMA 1Q82Q 1L0NK 1HF9A 1T8ZA 3H32B 1FZEA 2M5AA 2Q6QA 5KLIB 1VF5B 1P84I 3HTKA 2NRGA 1J1DB 1VL2A 3V2NA 4K3AA 1KQGB 4TT3H 2GUVA 3C9IA 1KYOE 4PV1C 1RF1C 1RE3A 1MFTA 3S1KA 1X9VA 1KYOH 2K88A 2WPVB 1USDA 1PP9D 2JHHC 1OX3A 5B5EE 2XNXA 2QVAA 1PGPA 2QE7H 2IZ0A 2Q7CA 3HD7D 5B5EH 2IPPA 5KKZC 3IF4A 1Q2NA 3H1HG 2FYUD 1NYHA 1GDTA 1EDKA 3Q3DA 3PH0A 1IFIA 2RH0A 3BVHC 1JCDA 1JMBA 4AYCA 4KT0J 2LKMA 2JDIH 4D6TE 2HODA 3H1HE 1URQA 2N1TC 1S4XA 3HD7B 3S4RA 2J0YA 3NXSA 4WY4A 1EZVI 2KYVA 3C1LA 3T97B 2K3RA 3M9HA 1AQTA 3CMEP 1H89A 1EDJA 2KS1B 4KHXA 2G3AA 2IYPA 3BCCD 2B89A 3HUSB 4DT0A 3B5NA 2OYIB 4D6TJ 2KNCB 3L4FA 3H1HJ 1U7MA 2I1JA 2NPSA 3W67A 5B66E 5H2FE 3GHGB 4MN4C 4YXWH 3L35A 1RE4A 1VDFA 5B66H 3P7KA 1NTZJ 2H43B 1S9KD 1Y8AA 3W68A 3WMM0 1YJ9P 1FJKA 5EFWB 1BCCD 1R5SA 1HJBA 3Q5PA 1PP9G 2JHIF 4H44D 3AEGC 3A3YB 1LTSC 3H32A 1KFMA 5AW4B 3CCEP 1VPCA 1NTMK 1CZQA 1M56D 2E42A 2YMKA 3TNUA 2FYUG 3R2PA 3MGNA 3L37A 3RL0C 1PP9E 2K1AA 1BDDA 3RK2D 1TU3F 1GL2C 3U1CA 2AXCA 2Z5HA 2J5ZA 3H1KD 1GK6A 1N86B 2KP8A 2J64A 2AEJA 4H44B 1EZVG 3KPEA 4DOJA 2FYUE 5KLVD 1SQBG 1OW6A 3O8ZA 2YIUB 3M0DA 3AE2C 1LP1B 4HB1A 1FIBA 3CCMP 2OYHC 1FZCA 1M1JB 1IK7A 2OQQA 1USEA 1LT9B 5CHXA 3GMAA 2B9BA 5CCGC 5L8RJ 1S3JA 5AVXB 2E5TA 2D2CC 1FJPA 3SWKA 1RF0B 1SVFA 2XU6A 1MV8A 3VN0A 1KB9I 2FYUJ 1KQFB 1K8AQ 1YJWP 2K37A 1NVOA 1DX7A 2P10A 3BCCE 1FZAA 1IZNB 4RO0A 2KS1A 1R8EA 2YKQA 1HWTC 1EQ7A 3IAOA 1BCCG 3HUSA 4NYTA 1PGOA 1FZGB 5CCHD 4N3YB 2POHA 1PZQA 3L74D 1S9KE 1LTJA 2ZJSE 2A45I 1X0TA 1SQQJ 1N7SA 3BCCJ 1BCCE 1GW3A 1JNMA 1IFDA 1RQVA 1KQSO 1FAVA 1N73C 2H43A 1FIDA 2RN0A 3MP7B 3TSIA 2J61B 1FZBA 3H1KG 2XKMA 3IR9A 2KSEA 4AUWA 3CD6P 2K9YA 2AEMA 2WSCH 2XNDH 5KLVG 1QX8A 2NZ2A 2ZT9D 1KORA 1IFPA 4JPZB 3VMXA 2WPQA 2YXRB 1BCCJ 5APVA 5DJTB 1HH0A 1L0NG 3FWNA 5KAFE 4GOFA 3CX5I 5KLVE 2WSCJ 2H8PD 1EDIA 2KSJA 2KOGA 3GF3A 1ZR4A 5KAFH 3GW6A 4EOTA 1IO4A 2ZT9B 1ZMEC 3H1JD 1SFCB 5M1BA 1LWUB 5APYA 2Q1KA 2ZXEB 4RKUJ 3ITKA 5AVWB 3TGUD 1G2CA 1L4AC 3M9QA 1HTLC 2V4HA 4L75A 2N9BA 4HH2A 4QMAA 1M1JA 2FFDA 5C39A 1QGKB 2FYUK 1FDOA 1AVOA 2LXBA 2M5AB 2C9LY 2FYZA 1RF0A 2HYNA 2YO2A 1A02J 3HTKB 3L74G 3RL0g 3MUDC 2E75B 2JR8A 1UIIA 3QH9A 3CCQP 1N7LA 1M57D 5AW6B 3MTUE 1AFOA 2ZVOB 1RE3B 5KLIC 3A0BE 1VQ8P 3I55P 1QLED 2R3CA 2C0XA 1ZN5A 3L74E 1K05A 2Y0DA 2JHKF 3A0BH 4HKZH 1HVVA 1S5LE 2XNXB 2FYNB 2Z4EA 1URQD 4Y28J 1S5LH 3NFQA 2XV5A 3B4SA 1H0TB 3WUTA 1KYOI 4WY4D 5AW0B 1KV4A 2E5YA 5APXA 3AEDC 2IYOA 3Q5SA 1SLQA 3CCUP 1GU4A 3L74J 5AW8B 2LR2A 1FE6A 3SSUA 1YYCA 2J61A 3R4YA 3B5ND 4IOIH 3ABVC 2CPBA 2NPSD 1HGZA 2WPRA 1JB0J 3G4SP 3CCLP 4I7ZB 4WY4B 1OVUA 3H1JG 1W5CE 4PJ0E 1OMIA 3TGUG 1QVGO 1LTGC 2QEXP 3HD7C 4PJ0H 4JYOX 2C9NY 4M3LA 1R5LA 2AXTE 2J60A 4ZMDA 1JC9A 3B5NB 1NTZD 3H1JE 4CPGA 4ZNCA 1Z56A 3H6PA 2GA1A 1SQPJ 3TGUE 4GT1A 4JBZA 4R4LA 3D6YA 3A2AA 4XA4A 3L75J 3AE8C 2B88A 1SFCA 1NTKJ 1VF5D 2OYIC 1LT1A 3FGAD 1DD3A 4C7NA 3EWKA 3GHGC 1IFMA 3CC7P 5AW7B 2OGUA 5APQA 2FXPA 3H1JJ 4HJGH 4EIJA 4EYYQ 1N8RQ 2B87A 2FXOA 3TGUJ 5AVSB 5CJ4A 3L36A 3MIWA 2PP6A 3TNUB
chains in the Genus database with same CATH topology
4JF7A 1DEBA 3RK3B 1T2KD 3V4WA 1X8YA 3TK1A 1Z3SA 3OAKA 1HJBA 1FDMA 3GHGA 3M0AA 1MFZA 2JHIF 1ZLLA 2BASA 3MD0A 1JUNA 2HPCA 1J1EC 1FZFC 3A3YB 3BRVB 1LTSC 3H32A 1KFMA 5AW4B 3E1IC 3VMYA 5APSA 1LTTC 1VPCA 1NTMK 1CZQA 1YTZT 1J1EB 1JY3N 2JEEA 1FZFB 2R5DA 3A5TA 2E42A 3NTNA 3E1IB 3M0DC 3TNUA 3R2PA 1L0LK 4IFMA 3MGNA 1T2KC 3L37A 3RL0C 1FZCC 3KQGA 3V2PA 2WWWA 1N86C 3RK2D 4R9TA 4DZOA 2L5GB 1CI6A 1FZCB 1GL2C 3G3ZA 3U1CA 2Z5HA 2J5ZA 2HLOC 2WTYA 1GK6A 1E5WA 1N86B 1WRGA 2KP8A 2J64A 5BVZA 3EQ2A 3KPEA 4DOJA 3M9BA 1FZFA 1CW5A 4ZKPA 2HLOB 2JHMF 1OXZA 1FZDA 2C0WA 3E1IA 4LC1A 5AW3B 1PFIA 2Z5IA 1HGVA 3O8ZA 2QM7A 4N6JA 3RK2C 3M0DA 1LT9C 1H88A 1FIBA 1GW4A 1FZAC 1FOSE 2OYHC 1FZCA 1M1JB 2GY7A 5AVZB 4LLHA 4C7RA 4HYTB 1LT9B 5CHXA 1N86A 1N2DC 4AQRD 3VYIA 2WT7A 1N7SD 1FZAB 4O9BA 4EPUA 2OYHB 1GL2A 5CCGC 3II6A 1T3UA 1NU1K 5AVXB 2HLOA 2W6AA 3HUSC 1FJPA 1RF0B 1SVFA 2XU6A 1MV8A 1FBMA 4JZCA 1IK9A 1SQPK 3VN0A 4RESB 2M3BA 5APUA 4W7YA 3OJAB 1LTJC 3RK3D 1IFJA 1M7LA 1NTKK 1LT9A 1DX7A 1N7SC 2M8RA 1LTJB 1LTBC 1FZAA 2OYHA 2A45G 1N7SB 1FZEB 2H43C 5AW5B 2MJZA 2O01H 2P2UA 3HRNA 5CCGA 2JHLF 3BRTB 5AVYB 1FZGC 2YKQA 2HFED 1HWTC 1FZBC 1EQ7A 5AVQB 3HUSA 2W27A 3LIEA 4NYTA 1KILD 3RK3C 3U1AA 1IC2A 1JY3O 2H7HA 1FZGB 1JY2N 5CCHD 1SQXK 1FZBB 4N3YB 2POHA 1SQBK 1S9KE 4ZFGA 1WT6A 2O1KA 3N4XA 1LTJA 1AQ5A 1FU1A 2A45I 2IFNA 1N7SA 1W2EA 2A45H 1QL1A 5AVVB 2Q3IA 1GW3A 1JNMA 1IFDA 1N73C 1FAVA 3P8CD 2H43A 1FIDA 1KILC 5AW9B 1ZV8A 5CCHC 1N73B 2WZ7A 3V5BA 1FZGA 1HBWA 3TSIA 2J61B 3KYQA 1FZBA 1ZR2A 1KILB 5KJ7D 3BASA 3PP5A 4GKGA 4Y99C 3B8EB 2ZFCA 2XKMA 2J58A 3IR9A 4R9JA 4AUWA 1SQVK 3HE5B 2WSCH 4Y99B 2KB7P 2FKWB 1NAFA 3V2RA 1CSBA 5APWA 4I1LA 2Q5UA 2I1KA 1T3JA 3M91A 5AW1B 2WPQA 3VMXA 1N73A 3VTPC 2J3OA 4GIFA 5APVA 2HODB 5KJ7C 2E43A 2XZRA 1OWAA 2XDJA 1KILA 3KDPB 1HH0A 1URQB 1M1JC 1G2CB 5CCHA 2KLVA 2FFDC 1L4AD 3I5CA 1FOSF 1NWQA 2H8PD 3V2QA 5AW2B 2KSJA 1DH3A 2KOGA 2FFDB 3VP9A 3SWFA 1QL2A 2FXMA 1ZR4A 1LWUC 4JYBA 4W80A 1G1IA 4EOTA 1RF0C 1KQLA 1IO4A 1LTAC 1JMMA 4I2LC 1SFCB 3M06A 5KTBA 1LWUB 2Q9IC 1H8AA 1LGHB 5APYA 1G1JA 2ZXEB 1NKNA 2JJLA 5AVWB 1IFNA 5AVTB 1G2CA 1L4AC 3M9QA 1GU5A 3EFGA 1JOCA 3CI9A 4B86A 2Q9IB 1HTLC 5KJ7A 3P32A 1IJDB 2NPSB 2N9BA 4HH2A 1HUCA 1M1JA 1L4AB 2N1TB 2WNPF 2FFDA 3UIAA 1JY2O 2J0GA 2GM4A 2FYUK 3N7NA 1FZEC 1J2JB 2J59M 1RE4B 2WSEH 1LWUA 2C9LY 3U59A 4N78D 1GK4A 2FYZA 1RF0A 4I6MC 1X79B 2HYNA 2YO2A 4XE5B 5CMZA 2Z4EC 5KLVK 1A02J 3HTKB 3VP8A 3HE4B 1XTCC 1NH4A 2Q9IA 1MZ9A 3LIDA 1JCCA 4N78E 1KZUB 2Z4EB 3NMDA 1L4AA 1N7LA 1RE3C 2VRSA 5AW6B 3TYYA 2OARA 2YKPA 3MTUE 1NTZK 4JYCA 1RY3A 1JY3P 3FIBA 1AFOA 1L0NK 1RE3B 2YMYA 1T8ZA 2YNYA 3H32B 2J3UA 1FZEA 2XNXC 2R3CA 2C0XA 1ZN5A 2J3FD 4ZKUA 2JHKF 2P67A 3HTKA 3HE4A 1HVVA 1XTGB 2XNXB 2R32A 4M7HA 1J1DB 2Z4EA 4LGDE 3V2NA 1URQD 5AVUB 2GUVA 3C9IA 3RL0D 3P8CE 2FIBA 3MUDA 3NFQA 3P8MC 1Z3UA 2XV5A 4WY4D 1RF1C 1CI6B 1RE3A 1X9VA 5AW0B 3BATA 1GL2D 3VOPA 2W6BA 5APXA 2O1JA 1SLQA 1LTIC 1NHLA 1RF1B 5CJ0A 1GD2E 2JHHC 3OA7A 4IFDK 1GU4A 1JO5A 1SFCD 2HODC 2XNXA 2CPSA 1GZLA 4WBAA 3V4QA 1URQC 5AW8B 2Q7CA 3HD7D 1YYCA 2J61A 3B5ND 2IPPA 2J3GA 2CPBA 4WY4C 2WITA 2NPSD 1HGZA 2WPRA 3RL0B 2PAJA 1FICA 2N1TD 1NO4A 1GDTA 3HE5A 4WY4B 1NKZB 2P7JA 2WT7B 1IFIA 1RF1A 4M7FA 3SWYA 1GL2B 1SFCC 5CCGD 3BVHC 1JCDA 2J3FA 1A02F 1LTGC 2J0HA 1GTWA 4AYCA 3HD7C 1KFNA 2LKMA 3B5NC 3BVHB 4JYOX 2C9NY 2HODA 2P1JA 2J1GA 4M3LA 2NPSC 4C7NB 2J60A 1URQA 1JC9A 2N1TC 3HD7B 3B5NB 3VMZA 2J0YA 2IX7C 3RK2B 3NXSA 1Z56A 4WY4A 4IFFA 3H6PA 4WB4A 1RE4C 2KYVA 4GT1A 1JTHB 1SP4A 2R5BA 3M9HA 3A2AA 4XA4A 1JY2P 1H89A 2YKOA 1SFCA 4KHXA 3BVHA 5APTA 5AVRB 2QM8A 2OYIC 3HUSB 1NOHA 3IFMA 4C7NA 3HD7A 3B5NA 3CL3D 3GHGC 1MUUA 3A7OA 2YO3A 2HG5D 2OYIB 1IFMA 4OH8B 3L4FA 2NPSA 2I1JA 2GUSA 1YTZI 2N1TA 2WPSA 2HPCC 5BU5A 5AW7B 3GHGB 5APQA 3H32C 1JTHA 3T97A 2IFMA 2D39A 3L35A 4EIJA 2HPCB 1RE4A 1VDFA 4W7ZA 3P7KA 2WSFH 5AVSB 5CJ4A 2H43B 3L36A 3MIWA 1S9KD 1J1DC 2J2PA 4C46A 3WMM0 3CLQA 3LW5H 5BU8B 2PP6A 3TNUB 2OYIA 1FJKA 1SQQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 C;  1LTJ B;  1FZA A;  2OYH A;  2A45 G;  1Z3S A;  3GHG A;  2J61 A;  1LWU B;  2Q9I C;  1FZE B;  2H43 C;  2J3G A;  2JHI F;  2HPC A;  2JHL F;  1FIC A;  1FZF C;  1FZG C;  2Q9I B;  3H32 A;  1FZB C;  3E1I C;  3HUS A;  4NYT A;  1RF1 A;  4M7F A;  1M1J A;  2WNP F;  1JY3 N;  1JY3 O;  1FZF B;  1FZG B;  2FFD A;  1JY2 N;  1JY2 O;  2J0G A;  3BVH C;  1FZB B;  3E1I B;  1FZE C;  2J3F A;  4ZFG A;  1LTJ A;  2J0H A;  1FZC C;  1RE4 B;  2A45 I;  3BVH B;  4JYO X;  2HOD A;  2J1G A;  1LWU A;  1N86 C;  1W2E A;  2A45 H;  4R9T A;  1RF0 A;  2J60 A;  1FZC B;  1JC9 A;  2Z4E C;  1N73 C;  2J5Z A;  2J0Y A;  2HLO C;  2Q9I A;  1N86 B;  2J64 A;  2H43 A;  1FID A;  2Z4E B;  1RE4 C;  1RE3 C;  1N73 B;  1FZF A;  1FZG A;  2HLO B;  2J61 B;  2JHM F;  1FZB A;  1FZD A;  3E1I A;  1JY3 P;  3FIB A;  1JY2 P;  1RE3 B;  4R9J A;  3BVH A;  3H32 B;  2J3U A;  1FZE A;  2OYI C;  1LT9 C;  2XNX C;  3HUS B;  2J3F D;  1FIB A;  1FZA C;  2OYH C;  1FZC A;  1M1J B;  2JHK F;  2GY7 A;  3GHG C;  2OYI B;  1LT9 B;  2XNX B;  1N86 A;  4M7H A;  1FZA B;  4EPU A;  2OYH B;  2Z4E A;  2HPC C;  1T3U A;  1N73 A;  3GHG B;  2J3O A;  2HLO A;  3H32 C;  2FIB A;  2HOD B;  1Z3U A;  3HUS C;  2D39 A;  1RF0 B;  1RF1 C;  2HPC B;  1M1J C;  1RE4 A;  1RE3 A;  4JZC A;  2FFD C;  2H43 B;  1RF1 B;  1LTJ C;  2J2P A;  2JHH C;  2FFD B;  2HOD C;  1LWU C;  2XNX A;  1LT9 A;  2OYI A; 
#chains in the Genus database with same CATH topology
 4JF7 A;  1WMK A;  3RK3 B;  1T2K D;  3V4W A;  1Z3S A;  3OAK A;  1FDM A;  1ZLL A;  2BAS A;  2HPC A;  1VQO P;  2ZYG A;  1MKM A;  1BSN A;  5E79 E;  3A5T A;  2IDB A;  3AEA C;  4IFM A;  4OGQ C;  1LJ2 A;  5E79 H;  3RBX A;  2W90 A;  3PTZ A;  1N86 C;  4D6T G;  2L5G B;  1H0T A;  4H44 C;  1FZC B;  1LNQ A;  2L91 A;  2UWJ E;  1EDL A;  3M9B A;  1FZF A;  2QJK B;  1CW5 A;  2JHM F;  1OXZ A;  2R3S A;  3FX0 A;  2C0W A;  3E1I A;  1FZD A;  2YIU C;  5AW3 B;  1NTZ G;  4L74 A;  1EXI A;  2JO1 A;  2QM7 A;  3RK2 C;  1LT9 C;  1H88 A;  1FOS E;  5AVZ B;  4C7R A;  3VYI A;  1N7S D;  3GF7 A;  1FZA B;  1VQM P;  1NTZ E;  2HLO A;  2W6A A;  1PV3 A;  4U7J A;  1T6A A;  1SQQ D;  1SQP K;  1ZOY C;  2M3B A;  2AEF A;  4W7Y A;  4RJT A;  4BRY A;  1IFJ A;  1NTK K;  1LTJ B;  1YIJ P;  3RK3 E;  3PJS K;  3Q2Y A;  1N7S B;  2MJZ A;  2LXC B;  3VMA A;  4WWI A;  3BRT B;  5AVY B;  1OW8 A;  1L0L D;  1FZG C;  2HR3 A;  5AVQ B;  2WSS H;  3AEB C;  1IC2 A;  1PPJ D;  2H7H A;  4GDO A;  1FZB B;  1VQ6 P;  1WT6 A;  2O1K A;  1AQ5 A;  1M8O B;  4UB6 E;  2KXP B;  2N9Y B;  5AW9 B;  4UB6 H;  2RKL A;  5CCH C;  2WZ7 A;  1HBW A;  4IL6 E;  1ZR2 A;  4L76 A;  2QRX A;  4NPF X;  3PP5 A;  4GKG A;  3B8E B;  4PD4 D;  2ZFC A;  3AE5 C;  4IL6 H;  1NAF A;  3CPW O;  2CK3 H;  4H0L D;  4I1L A;  3JC2 2;  1T3J A;  3USS A;  3VTP C;  4GIF A;  3L71 D;  3E7K A;  3KDP B;  1KIL A;  4A7P A;  1G2C B;  2WVR A;  3MHV A;  1OW7 A;  3A0H E;  2H89 C;  2FFD B;  3VP9 A;  3SWF A;  1LWU C;  1G1I A;  2J5U A;  1SQQ G;  3BCC G;  1ZRT D;  3A0H H;  1NAY A;  1JMM A;  4H0L B;  1U7J A;  3M06 A;  5KTB A;  1H8A A;  1SQX D;  1IFN A;  5AVT B;  1GU5 A;  3EFG A;  1DIP A;  5KJ7 A;  2N1T B;  2WNP F;  3CXH D;  1SQQ E;  3UIA A;  2J0G A;  2GM4 A;  3N7N A;  1FZE C;  1L0L G;  3L70 D;  1SS1 A;  4I6M C;  4XE5 B;  5CMZ A;  1XTC C;  2Q9I A;  1MZ9 A;  3LID A;  4N78 E;  2Z4E B;  1QVF O;  1RE3 C;  2QJP B;  4UB8 E;  1L0L E;  2OAR A;  1NTZ K;  4JYC A;  1RY3 A;  1JY3 P;  1Y47 A;  1PPJ E;  4UB8 H;  2YNY A;  2J3U A;  2XNX C;  2P67 A;  3PRJ A;  3HE4 A;  1K73 Q;  2WMM A;  4M7H A;  5AVU B;  3RL0 D;  2FIB A;  3P8M C;  1GMJ A;  3D70 A;  1CI6 B;  3CWB D;  3BAT A;  1GL2 D;  3VOP A;  1L0L J;  3B71 A;  2IBZ E;  2JWD A;  2PRR A;  1DD4 A;  3L71 G;  4PD4 E;  1GD2 E;  3OA7 A;  4IFD K;  1JO5 A;  1SFC D;  2HOD C;  2CPS A;  1SQP D;  1GZL A;  3V4Q A;  1URQ C;  4PD4 H;  4TLF A;  4GOE A;  1Q7Y Q;  3L75 D;  3GG2 A;  2J3G A;  4WY4 C;  1NTK D;  3RL0 B;  2PAJ A;  1FIC A;  3WU2 E;  3V6I A;  1NO4 A;  4ASV A;  1YBK A;  3L71 E;  1NKZ B;  2WT7 B;  1RF1 A;  3SWY A;  1GL2 B;  2RMZ A;  3WU2 H;  5CCG D;  1NJI Q;  1SQX G;  2J3F A;  3SFE C;  2PGD A;  1KFN A;  1S2E A;  3B5N C;  2P1J A;  1OIP A;  3K5B A;  2BEQ D;  2NPS C;  5TIS E;  4C7N B;  2E75 D;  1JM0 A;  4YXD C;  1ZRT E;  2Y9Y A;  3VMZ A;  2IX7 C;  3L70 G;  3L72 D;  5TIS H;  1SQX E;  1RE4 C;  3CCV P;  1Q81 Q;  1SP4 A;  3L71 J;  4YPC A;  1JY2 P;  2E76 C;  2E74 D;  2B87 B;  2YKO A;  3CXH E;  2PFX A;  3BVH A;  5AVR B;  2QM8 A;  1NOH A;  2ZVN B;  3L70 E;  1E79 H;  3CXH H;  2YO3 A;  2HG5 D;  2FBW C;  2GUS A;  1BGY J;  1YTZ I;  2N1T A;  2WPS A;  5BU5 A;  3H1L D;  3H32 C;  3KXD A;  1JTH A;  2IFM A;  2HPC B;  2BCC D;  3AE7 C;  1VF5 C;  1SQX J;  4W7Z A;  2WSF H;  1KN7 A;  2E74 B;  2QA4 P;  1J1D C;  3CLQ A;  3LW5 H;  5BU8 B;  1ZP0 C;  1SQQ K;  3CWB G;  1ZXG A;  1Y9B A;  1DEB A;  3H1I D;  3L70 J;  3CCR P;  3AEC C;  3TDK A;  3AE3 C;  3MD0 A;  1SQP G;  2DW3 A;  2WSF J;  1LTT C;  3L75 G;  1J1E B;  2QIW A;  1FZF B;  1SQV J;  3CWB E;  2BEZ F;  3TF5 A;  3E1I B;  3LW5 J;  1NTK G;  3M0D C;  1L0L K;  1YQ4 C;  1T2K C;  3E1R A;  1FZC C;  3KQG A;  1Q90 D;  2OTJ P;  4R9T A;  4DZO A;  1SQP E;  2JKV A;  1K04 A;  1CI6 A;  5GTH H;  1S5L X;  4BWN A;  1E5W A;  3L75 E;  1BDC A;  1NTK E;  2HLO B;  4LC1 A;  5KAI E;  4DJG A;  3AE9 C;  1KTM A;  3L72 G;  3CWB J;  1FC2 C;  1D7M A;  5KAI H;  4XFJ A;  1FZA C;  3ZDM A;  4BRY B;  1VQP P;  2WT7 A;  1S72 P;  1BE3 J;  2H88 C;  1GL2 A;  2ZYD A;  4DCK A;  3HUS C;  3L72 E;  1PIX A;  1AJY A;  1IK9 A;  4RES B;  3L73 D;  1AVY A;  3OJA B;  1LTJ C;  1AV1 A;  3RK3 D;  1M7L A;  3D6Z A;  2BCC G;  1N7S C;  2M8R A;  1LTB C;  2OYH A;  1W2B O;  2H43 C;  2KUB A;  2O01 H;  1X22 A;  2P2U A;  5CCG A;  2JHL F;  4NPE A;  3H1L E;  2Y9Z A;  2HFE D;  4GOD A;  1FZB C;  1VQ5 P;  2QSI A;  2W27 A;  3LIE A;  3C8V A;  3AEF C;  1KIL D;  3L72 J;  2KIK A;  2BCC E;  1FS0 E;  1SQX K;  1P84 D;  3N4X A;  2IFN A;  3EFF K;  1W2E A;  5AVV B;  1QL1 A;  1U57 A;  2O01 J;  2QJY B;  3H1I E;  3P8C D;  3V5B A;  3H25 A;  3KYQ A;  3H1L J;  4L73 A;  1KIL B;  5KJ7 D;  1NTM J;  4R9J A;  2BCC J;  1SQV K;  4H13 D;  3HE5 B;  1NU1 D;  4Y99 B;  2FKW B;  2Q5U A;  3M91 A;  3JCU E;  5AW1 B;  1N73 A;  2J3O A;  3H1I J;  2E43 A;  2XZR A;  1OWA A;  2XDJ A;  3KHU A;  3JCU H;  3G71 P;  1M1J C;  4BXL A;  2FFD C;  3I5C A;  4WVZ A;  1KD1 Q;  2A06 D;  3V2Q A;  3KZI E;  5AW2 B;  1DH3 A;  3PHL A;  4H13 B;  4H0L C;  4JYB A;  4W80 A;  1RF0 C;  1KQL A;  3KZI H;  3L73 G;  3CMA P;  1LTA C;  1EZV D;  1LGH B;  1G1J A;  3QWO C;  1SQB D;  4B86 A;  2Q9I B;  1IJD B;  1M90 Q;  1HUC A;  4K35 A;  3L73 E;  5K5G B;  2WSE H;  3U59 A;  4N78 D;  2K9J A;  1X79 B;  2Z4E C;  2QJP C;  1UIX A;  3HE4 B;  3AEE C;  1KZU B;  3NMD A;  1L4A A;  3TYY A;  5DJU B;  3FIB A;  4PV1 D;  2SPZ A;  4JQ0 D;  1KIL E;  2YMY A;  5H2F H;  1VQ9 P;  2WSE J;  1P84 E;  3L73 J;  2J3F D;  5TJH A;  1ZW0 A;  4ZKU A;  2ITA A;  1XTG B;  2R32 A;  2Q3E A;  1P84 H;  3S9O A;  4LGD E;  4OGQ D;  1K9M Q;  1NU1 G;  3P8C E;  3MUD A;  1Z3U A;  2IBZ D;  2Y0E A;  1OVV A;  2W6B A;  4PV1 B;  2O1J A;  1LTI C;  1NHL A;  1RF1 B;  5CJ0 A;  3AE4 C;  1YI2 P;  2IBZ I;  1OFC X;  4OVN F;  4PD4 I;  4WBA A;  1NU1 E;  3PLN A;  1QEX A;  4U3F D;  2A06 G;  3O6Q B;  1PL5 A;  2JP3 A;  2WIT A;  4OGQ B;  3FXD A;  2KZJ A;  2N1T D;  2M0B A;  3G9R A;  3HE5 A;  5KKZ B;  1NGM B;  2P7J A;  2MKV A;  1RH5 B;  2ZT9 C;  4M7F A;  1SFC C;  4IL6 X;  3CC2 P;  1BGY D;  2A06 E;  1A02 F;  2J0H A;  1GTW A;  3BVH B;  2J1G A;  2QG4 A;  3F5H A;  1NU1 J;  1EZV E;  3RK2 B;  1L0N D;  1PP9 J;  3AE6 C;  1KB9 D;  4IFF A;  4WB4 A;  1RHZ B;  1JTH B;  1SQB E;  3CCS P;  2R5B A;  1YIT P;  2R44 A;  4R4M A;  1M1K Q;  1HJ0 A;  5APT A;  3SFD C;  1PPJ G;  2O01 N;  2E75 C;  2ZYA A;  3CXH I;  3IFM A;  4NPD A;  2G8Y A;  3HD7 A;  2KLU A;  2KI7 B;  3CL3 D;  1MUU A;  3A7O A;  1Q86 Q;  2YXQ B;  4OH8 B;  1SQV D;  2HPC C;  3T97 A;  2D39 A;  2E74 C;  3CCJ P;  1SQB J;  2FYN C;  1PGJ A;  2J2P A;  2IBZ G;  4C46 A;  3JSV C;  2OYI A;  2KNC A;  3VMY A;  2W83 C;  1X8Y A;  3TK1 A;  2OTL P;  3GHG A;  3M0A A;  2JWA A;  1MFZ A;  4OWF A;  1JUN A;  1J1E C;  1FZF C;  3BRV B;  3E1I C;  4U3F G;  2P58 A;  5APS A;  1YTZ T;  1JY3 N;  2JEE A;  2R5D A;  2W6J H;  5CBN A;  3NTN A;  3Q5R A;  1BE3 D;  2ZXX A;  3V2P A;  4I7Z C;  2WWW A;  3G3Z A;  1BGY G;  4U3F E;  2HLO C;  2WTY A;  1S1C X;  1VQL P;  1WRG A;  5BVZ A;  3EQ2 A;  3CX5 D;  4ZKP A;  3H1K E;  1PFI A;  2D2C D;  2Z5I A;  1VQ4 P;  1HGV A;  3O6Q A;  4N6J A;  1BGY E;  3IN6 A;  1GW4 A;  3WUV A;  2GY7 A;  4LLH A;  5CBO A;  4HYT B;  1RQU A;  1N86 A;  1N2D C;  4AQR D;  4O9B A;  4EPU A;  2OYH B;  3II6 A;  1T3U A;  1NU1 K;  1EXJ A;  4U3F J;  1L0N E;  3F89 A;  1KB9 E;  3FWL A;  3MZW B;  1YQ3 C;  1FBM A;  4JZC A;  1SQV G;  2D2C B;  3H1K J;  5APU A;  1LP1 A;  1KB9 H;  2OYO A;  1LT9 A;  5KLV J;  3FXE A;  2A45 G;  1YHQ P;  1NTM D;  1FZE B;  4KJM A;  5AW5 B;  1SQV E;  3HRN A;  1EC5 A;  3RBZ A;  1L0N J;  3RK3 C;  3U1A A;  1JY3 O;  3WUU A;  1JY2 N;  1SQB K;  4ZFG A;  1FU1 A;  2QJY C;  2A45 H;  1L2P A;  1OZH A;  2Q3I A;  2KZI A;  1BE3 G;  4EDF A;  1KYO D;  5GTI E;  4EI2 A;  1KIL C;  1ZV8 A;  1JEK A;  2ZAE B;  1N73 B;  1FZG A;  3RGU A;  2I8D A;  5GTI H;  3BAS A;  4Y99 C;  5GTH E;  2J58 A;  1KC8 Q;  1BE3 E;  1DEE G;  2KB7 P;  3V2R A;  1CSB A;  2QJK C;  5APW A;  2O3J A;  1VQK P;  2Y0C A;  2I1K A;  2HOD B;  5KJ7 C;  2V7Q H;  1PGQ A;  3Q1M A;  1VQ7 P;  3CC4 P;  1URQ B;  5CCH A;  3CX5 E;  2KLV A;  4H13 C;  3OW2 O;  1L4A D;  2KK7 A;  1FOS F;  1NWQ A;  2IZ1 A;  3CX5 H;  4D6T D;  4ASW A;  1QL2 A;  2FXM A;  3H1H D;  1AA0 A;  4I2L C;  2E76 D;  2Q9I C;  2K9J B;  2V7Q J;  1NKN A;  2JJL A;  2FY8 A;  3G6E P;  1JOC A;  3CI9 A;  3P32 A;  1OVR A;  3H1L G;  2NPS B;  2AXT H;  1NTM G;  1L4A B;  1JY2 O;  1J2J B;  2J59 M;  1RE4 B;  1KMI Z;  1LWU A;  1FDI A;  4YTP C;  4Z1M H;  1GK4 A;  2W8Z A;  2WQY C;  2E76 B;  3D71 A;  5KLV K;  3AE1 C;  3VP8 A;  1NH4 A;  3H1I G;  1NTM E;  1JCC A;  2M3E A;  3I56 P;  1BSH A;  1YJN P;  2VRS A;  1VQN P;  2OTK E;  2YKP A;  3GLM A;  1Q82 Q;  1L0N K;  1HF9 A;  1T8Z A;  3H32 B;  1FZE A;  2M5A A;  2Q6Q A;  5KLI B;  1VF5 B;  1P84 I;  3HTK A;  2NRG A;  1J1D B;  1VL2 A;  3V2N A;  4K3A A;  1KQG B;  4TT3 H;  2GUV A;  3C9I A;  1KYO E;  4PV1 C;  1RF1 C;  1RE3 A;  1MFT A;  3S1K A;  1X9V A;  1KYO H;  2K88 A;  2WPV B;  1USD A;  1PP9 D;  2JHH C;  1OX3 A;  5B5E E;  2XNX A;  2QVA A;  1PGP A;  2QE7 H;  2IZ0 A;  2Q7C A;  3HD7 D;  5B5E H;  2IPP A;  5KKZ C;  3IF4 A;  1Q2N A;  3H1H G;  2FYU D;  1NYH A;  1GDT A;  1EDK A;  3Q3D A;  3PH0 A;  1IFI A;  2RH0 A;  3BVH C;  1JCD A;  1JMB A;  4AYC A;  4KT0 J;  2LKM A;  2JDI H;  4D6T E;  2HOD A;  3H1H E;  1URQ A;  2N1T C;  1S4X A;  3HD7 B;  3S4R A;  2J0Y A;  3NXS A;  4WY4 A;  1EZV I;  2KYV A;  3C1L A;  3T97 B;  2K3R A;  3M9H A;  1AQT A;  3CME P;  1H89 A;  1EDJ A;  2KS1 B;  4KHX A;  2G3A A;  2IYP A;  3BCC D;  2B89 A;  3HUS B;  4DT0 A;  3B5N A;  2OYI B;  4D6T J;  2KNC B;  3L4F A;  3H1H J;  1U7M A;  2I1J A;  2NPS A;  3W67 A;  5B66 E;  5H2F E;  3GHG B;  4MN4 C;  4YXW H;  3L35 A;  1RE4 A;  1VDF A;  5B66 H;  3P7K A;  1NTZ J;  2H43 B;  1S9K D;  1Y8A A;  3W68 A;  3WMM 0;  1YJ9 P;  1FJK A;  5EFW B;  1BCC D;  1R5S A;  1HJB A;  3Q5P A;  1PP9 G;  2JHI F;  4H44 D;  3AEG C;  3A3Y B;  1LTS C;  3H32 A;  1KFM A;  5AW4 B;  3CCE P;  1VPC A;  1NTM K;  1CZQ A;  1M56 D;  2E42 A;  2YMK A;  3TNU A;  2FYU G;  3R2P A;  3MGN A;  3L37 A;  3RL0 C;  1PP9 E;  2K1A A;  1BDD A;  3RK2 D;  1TU3 F;  1GL2 C;  3U1C A;  2AXC A;  2Z5H A;  2J5Z A;  3H1K D;  1GK6 A;  1N86 B;  2KP8 A;  2J64 A;  2AEJ A;  4H44 B;  1EZV G;  3KPE A;  4DOJ A;  2FYU E;  5KLV D;  1SQB G;  1OW6 A;  3O8Z A;  2YIU B;  3M0D A;  3AE2 C;  1LP1 B;  4HB1 A;  1FIB A;  3CCM P;  2OYH C;  1FZC A;  1M1J B;  1IK7 A;  2OQQ A;  1USE A;  1LT9 B;  5CHX A;  3GMA A;  2B9B A;  5CCG C;  5L8R J;  1S3J A;  5AVX B;  2E5T A;  2D2C C;  1FJP A;  3SWK A;  1RF0 B;  1SVF A;  2XU6 A;  1MV8 A;  3VN0 A;  1KB9 I;  2FYU J;  1KQF B;  1K8A Q;  1YJW P;  2K37 A;  1NVO A;  1DX7 A;  2P10 A;  3BCC E;  1FZA A;  1IZN B;  4RO0 A;  2KS1 A;  1R8E A;  2YKQ A;  1HWT C;  1EQ7 A;  3IAO A;  1BCC G;  3HUS A;  4NYT A;  1PGO A;  1FZG B;  5CCH D;  4N3Y B;  2POH A;  1PZQ A;  3L74 D;  1S9K E;  1LTJ A;  2ZJS E;  2A45 I;  1X0T A;  1SQQ J;  1N7S A;  3BCC J;  1BCC E;  1GW3 A;  1JNM A;  1IFD A;  1RQV A;  1KQS O;  1FAV A;  1N73 C;  2H43 A;  1FID A;  2RN0 A;  3MP7 B;  3TSI A;  2J61 B;  1FZB A;  3H1K G;  2XKM A;  3IR9 A;  2KSE A;  4AUW A;  3CD6 P;  2K9Y A;  2AEM A;  2WSC H;  2XND H;  5KLV G;  1QX8 A;  2NZ2 A;  2ZT9 D;  1KOR A;  1IFP A;  4JPZ B;  3VMX A;  2WPQ A;  2YXR B;  1BCC J;  5APV A;  5DJT B;  1HH0 A;  1L0N G;  3FWN A;  5KAF E;  4GOF A;  3CX5 I;  5KLV E;  2WSC J;  2H8P D;  1EDI A;  2KSJ A;  2KOG A;  3GF3 A;  1ZR4 A;  5KAF H;  3GW6 A;  4EOT A;  1IO4 A;  2ZT9 B;  1ZME C;  3H1J D;  1SFC B;  5M1B A;  1LWU B;  5APY A;  2Q1K A;  2ZXE B;  4RKU J;  3ITK A;  5AVW B;  3TGU D;  1G2C A;  1L4A C;  3M9Q A;  1HTL C;  2V4H A;  4L75 A;  2N9B A;  4HH2 A;  4QMA A;  1M1J A;  2FFD A;  5C39 A;  1QGK B;  2FYU K;  1FDO A;  1AVO A;  2LXB A;  2M5A B;  2C9L Y;  2FYZ A;  1RF0 A;  2HYN A;  2YO2 A;  1A02 J;  3HTK B;  3L74 G;  3RL0 g;  3MUD C;  2E75 B;  2JR8 A;  1UII A;  3QH9 A;  3CCQ P;  1N7L A;  1M57 D;  5AW6 B;  3MTU E;  1AFO A;  2ZVO B;  1RE3 B;  5KLI C;  3A0B E;  1VQ8 P;  3I55 P;  1QLE D;  2R3C A;  2C0X A;  1ZN5 A;  3L74 E;  1K05 A;  2Y0D A;  2JHK F;  3A0B H;  4HKZ H;  1HVV A;  1S5L E;  2XNX B;  2FYN B;  2Z4E A;  1URQ D;  4Y28 J;  1S5L H;  3NFQ A;  2XV5 A;  3B4S A;  1H0T B;  3WUT A;  1KYO I;  4WY4 D;  5AW0 B;  1KV4 A;  2E5Y A;  5APX A;  3AED C;  2IYO A;  3Q5S A;  1SLQ A;  3CCU P;  1GU4 A;  3L74 J;  5AW8 B;  2LR2 A;  1FE6 A;  3SSU A;  1YYC A;  2J61 A;  3R4Y A;  3B5N D;  4IOI H;  3ABV C;  2CPB A;  2NPS D;  1HGZ A;  2WPR A;  1JB0 J;  3G4S P;  3CCL P;  4I7Z B;  4WY4 B;  1OVU A;  3H1J G;  1W5C E;  4PJ0 E;  1OMI A;  3TGU G;  1QVG O;  1LTG C;  2QEX P;  3HD7 C;  4PJ0 H;  4JYO X;  2C9N Y;  4M3L A;  1R5L A;  2AXT E;  2J60 A;  4ZMD A;  1JC9 A;  3B5N B;  1NTZ D;  3H1J E;  4CPG A;  4ZNC A;  1Z56 A;  3H6P A;  2GA1 A;  1SQP J;  3TGU E;  4GT1 A;  4JBZ A;  4R4L A;  3D6Y A;  3A2A A;  4XA4 A;  3L75 J;  3AE8 C;  2B88 A;  1SFC A;  1NTK J;  1VF5 D;  2OYI C;  1LT1 A;  3FGA D;  1DD3 A;  4C7N A;  3EWK A;  3GHG C;  1IFM A;  3CC7 P;  5AW7 B;  2OGU A;  5APQ A;  2FXP A;  3H1J J;  4HJG H;  4EIJ A;  4EYY Q;  1N8R Q;  2B87 A;  2FXO A;  3TGU J;  5AVS B;  5CJ4 A;  3L36 A;  3MIW A;  2PP6 A;  3TNU B; 
#chains in the Genus database with same CATH homology
 4JF7 A;  1DEB A;  3RK3 B;  1T2K D;  3V4W A;  1X8Y A;  3TK1 A;  1Z3S A;  3OAK A;  1HJB A;  1FDM A;  3GHG A;  3M0A A;  1MFZ A;  2JHI F;  1ZLL A;  2BAS A;  3MD0 A;  1JUN A;  2HPC A;  1J1E C;  1FZF C;  3A3Y B;  3BRV B;  1LTS C;  3H32 A;  1KFM A;  5AW4 B;  3E1I C;  3VMY A;  5APS A;  1LTT C;  1VPC A;  1NTM K;  1CZQ A;  1YTZ T;  1J1E B;  1JY3 N;  2JEE A;  1FZF B;  2R5D A;  3A5T A;  2E42 A;  3NTN A;  3E1I B;  3M0D C;  3TNU A;  3R2P A;  1L0L K;  4IFM A;  3MGN A;  1T2K C;  3L37 A;  3RL0 C;  1FZC C;  3KQG A;  3V2P A;  2WWW A;  1N86 C;  3RK2 D;  4R9T A;  4DZO A;  2L5G B;  1CI6 A;  1FZC B;  1GL2 C;  3G3Z A;  3U1C A;  2Z5H A;  2J5Z A;  2HLO C;  2WTY A;  1GK6 A;  1E5W A;  1N86 B;  1WRG A;  2KP8 A;  2J64 A;  5BVZ A;  3EQ2 A;  3KPE A;  4DOJ A;  3M9B A;  1FZF A;  1CW5 A;  4ZKP A;  2HLO B;  2JHM F;  1OXZ A;  1FZD A;  2C0W A;  3E1I A;  4LC1 A;  5AW3 B;  1PFI A;  2Z5I A;  1HGV A;  3O8Z A;  2QM7 A;  4N6J A;  3RK2 C;  3M0D A;  1LT9 C;  1H88 A;  1FIB A;  1GW4 A;  1FZA C;  1FOS E;  2OYH C;  1FZC A;  1M1J B;  2GY7 A;  5AVZ B;  4LLH A;  4C7R A;  4HYT B;  1LT9 B;  5CHX A;  1N86 A;  1N2D C;  4AQR D;  3VYI A;  2WT7 A;  1N7S D;  1FZA B;  4O9B A;  4EPU A;  2OYH B;  1GL2 A;  5CCG C;  3II6 A;  1T3U A;  1NU1 K;  5AVX B;  2HLO A;  2W6A A;  3HUS C;  1FJP A;  1RF0 B;  1SVF A;  2XU6 A;  1MV8 A;  1FBM A;  4JZC A;  1IK9 A;  1SQP K;  3VN0 A;  4RES B;  2M3B A;  5APU A;  4W7Y A;  3OJA B;  1LTJ C;  3RK3 D;  1IFJ A;  1M7L A;  1NTK K;  1LT9 A;  1DX7 A;  1N7S C;  2M8R A;  1LTJ B;  1LTB C;  1FZA A;  2OYH A;  2A45 G;  1N7S B;  1FZE B;  2H43 C;  5AW5 B;  2MJZ A;  2O01 H;  2P2U A;  3HRN A;  5CCG A;  2JHL F;  3BRT B;  5AVY B;  1FZG C;  2YKQ A;  2HFE D;  1HWT C;  1FZB C;  1EQ7 A;  5AVQ B;  3HUS A;  2W27 A;  3LIE A;  4NYT A;  1KIL D;  3RK3 C;  3U1A A;  1IC2 A;  1JY3 O;  2H7H A;  1FZG B;  1JY2 N;  5CCH D;  1SQX K;  1FZB B;  4N3Y B;  2POH A;  1SQB K;  1S9K E;  4ZFG A;  1WT6 A;  2O1K A;  3N4X A;  1LTJ A;  1AQ5 A;  1FU1 A;  2A45 I;  2IFN A;  1N7S A;  1W2E A;  2A45 H;  1QL1 A;  5AVV B;  2Q3I A;  1GW3 A;  1JNM A;  1IFD A;  1N73 C;  1FAV A;  3P8C D;  2H43 A;  1FID A;  1KIL C;  5AW9 B;  1ZV8 A;  5CCH C;  1N73 B;  2WZ7 A;  3V5B A;  1FZG A;  1HBW A;  3TSI A;  2J61 B;  3KYQ A;  1FZB A;  1ZR2 A;  1KIL B;  5KJ7 D;  3BAS A;  3PP5 A;  4GKG A;  4Y99 C;  3B8E B;  2ZFC A;  2XKM A;  2J58 A;  3IR9 A;  4R9J A;  4AUW A;  1SQV K;  3HE5 B;  2WSC H;  4Y99 B;  2KB7 P;  2FKW B;  1NAF A;  3V2R A;  1CSB A;  5APW A;  4I1L A;  2Q5U A;  2I1K A;  1T3J A;  3M91 A;  5AW1 B;  2WPQ A;  3VMX A;  1N73 A;  3VTP C;  2J3O A;  4GIF A;  5APV A;  2HOD B;  5KJ7 C;  2E43 A;  2XZR A;  1OWA A;  2XDJ A;  1KIL A;  3KDP B;  1HH0 A;  1URQ B;  1M1J C;  1G2C B;  5CCH A;  2KLV A;  2FFD C;  1L4A D;  3I5C A;  1FOS F;  1NWQ A;  2H8P D;  3V2Q A;  5AW2 B;  2KSJ A;  1DH3 A;  2KOG A;  2FFD B;  3VP9 A;  3SWF A;  1QL2 A;  2FXM A;  1ZR4 A;  1LWU C;  4JYB A;  4W80 A;  1G1I A;  4EOT A;  1RF0 C;  1KQL A;  1IO4 A;  1LTA C;  1JMM A;  4I2L C;  1SFC B;  3M06 A;  5KTB A;  1LWU B;  2Q9I C;  1H8A A;  1LGH B;  5APY A;  1G1J A;  2ZXE B;  1NKN A;  2JJL A;  5AVW B;  1IFN A;  5AVT B;  1G2C A;  1L4A C;  3M9Q A;  1GU5 A;  3EFG A;  1JOC A;  3CI9 A;  4B86 A;  2Q9I B;  1HTL C;  5KJ7 A;  3P32 A;  1IJD B;  2NPS B;  2N9B A;  4HH2 A;  1HUC A;  1M1J A;  1L4A B;  2N1T B;  2WNP F;  2FFD A;  3UIA A;  1JY2 O;  2J0G A;  2GM4 A;  2FYU K;  3N7N A;  1FZE C;  1J2J B;  2J59 M;  1RE4 B;  2WSE H;  1LWU A;  2C9L Y;  3U59 A;  4N78 D;  1GK4 A;  2FYZ A;  1RF0 A;  4I6M C;  1X79 B;  2HYN A;  2YO2 A;  4XE5 B;  5CMZ A;  2Z4E C;  5KLV K;  1A02 J;  3HTK B;  3VP8 A;  3HE4 B;  1XTC C;  1NH4 A;  2Q9I A;  1MZ9 A;  3LID A;  1JCC A;  4N78 E;  1KZU B;  2Z4E B;  3NMD A;  1L4A A;  1N7L A;  1RE3 C;  2VRS A;  5AW6 B;  3TYY A;  2OAR A;  2YKP A;  3MTU E;  1NTZ K;  4JYC A;  1RY3 A;  1JY3 P;  3FIB A;  1AFO A;  1L0N K;  1RE3 B;  2YMY A;  1T8Z A;  2YNY A;  3H32 B;  2J3U A;  1FZE A;  2XNX C;  2R3C A;  2C0X A;  1ZN5 A;  2J3F D;  4ZKU A;  2JHK F;  2P67 A;  3HTK A;  3HE4 A;  1HVV A;  1XTG B;  2XNX B;  2R32 A;  4M7H A;  1J1D B;  2Z4E A;  4LGD E;  3V2N A;  1URQ D;  5AVU B;  2GUV A;  3C9I A;  3RL0 D;  3P8C E;  2FIB A;  3MUD A;  3NFQ A;  3P8M C;  1Z3U A;  2XV5 A;  4WY4 D;  1RF1 C;  1CI6 B;  1RE3 A;  1X9V A;  5AW0 B;  3BAT A;  1GL2 D;  3VOP A;  2W6B A;  5APX A;  2O1J A;  1SLQ A;  1LTI C;  1NHL A;  1RF1 B;  5CJ0 A;  1GD2 E;  2JHH C;  3OA7 A;  4IFD K;  1GU4 A;  1JO5 A;  1SFC D;  2HOD C;  2XNX A;  2CPS A;  1GZL A;  4WBA A;  3V4Q A;  1URQ C;  5AW8 B;  2Q7C A;  3HD7 D;  1YYC A;  2J61 A;  3B5N D;  2IPP A;  2J3G A;  2CPB A;  4WY4 C;  2WIT A;  2NPS D;  1HGZ A;  2WPR A;  3RL0 B;  2PAJ A;  1FIC A;  2N1T D;  1NO4 A;  1GDT A;  3HE5 A;  4WY4 B;  1NKZ B;  2P7J A;  2WT7 B;  1IFI A;  1RF1 A;  4M7F A;  3SWY A;  1GL2 B;  1SFC C;  5CCG D;  3BVH C;  1JCD A;  2J3F A;  1A02 F;  1LTG C;  2J0H A;  1GTW A;  4AYC A;  3HD7 C;  1KFN A;  2LKM A;  3B5N C;  3BVH B;  4JYO X;  2C9N Y;  2HOD A;  2P1J A;  2J1G A;  4M3L A;  2NPS C;  4C7N B;  2J60 A;  1URQ A;  1JC9 A;  2N1T C;  3HD7 B;  3B5N B;  3VMZ A;  2J0Y A;  2IX7 C;  3RK2 B;  3NXS A;  1Z56 A;  4WY4 A;  4IFF A;  3H6P A;  4WB4 A;  1RE4 C;  2KYV A;  4GT1 A;  1JTH B;  1SP4 A;  2R5B A;  3M9H A;  3A2A A;  4XA4 A;  1JY2 P;  1H89 A;  2YKO A;  1SFC A;  4KHX A;  3BVH A;  5APT A;  5AVR B;  2QM8 A;  2OYI C;  3HUS B;  1NOH A;  3IFM A;  4C7N A;  3HD7 A;  3B5N A;  3CL3 D;  3GHG C;  1MUU A;  3A7O A;  2YO3 A;  2HG5 D;  2OYI B;  1IFM A;  4OH8 B;  3L4F A;  2NPS A;  2I1J A;  2GUS A;  1YTZ I;  2N1T A;  2WPS A;  2HPC C;  5BU5 A;  5AW7 B;  3GHG B;  5APQ A;  3H32 C;  1JTH A;  3T97 A;  2IFM A;  2D39 A;  3L35 A;  4EIJ A;  2HPC B;  1RE4 A;  1VDF A;  4W7Z A;  3P7K A;  2WSF H;  5AVS B;  5CJ4 A;  2H43 B;  3L36 A;  3MIW A;  1S9K D;  1J1D C;  2J2P A;  4C46 A;  3WMM 0;  3CLQ A;  3LW5 H;  5BU8 B;  2PP6 A;  3TNU B;  2OYI A;  1FJK A;  1SQQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...