1M1JC

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
390
structure length
390
Chain Sequence
b'TRENCCILDERFGSYCPTTCGIADFFNKYRLTTDGELLEIEGLLQQATNSTGSIEYLIQHIKTIYPSEKQTLPQSIEQLTQKSKKIIEEIIRYENTILAHENTIQQLTDMHIMNSNKITQLKQKIAQLESHCQEPCKDTAEIQETTGRDCQDIANKGARKSGLYFIKPQKAKQSFLVYCEIDTYGNGWTVLQRRLDGSEDFRRNWVQYKEGFGHLSPDDTTEFWLGNEKIHLITTQSTLPYALRIELEDWSGKKGTADYAVFKVGTEEDKYRLTYAYFIGGEAGDAFDGFNFGDDPSDKSYTYHNGMRFSTFDNDNDNFEGNCAEQDGSGWWMNRCHAGHLNGPYYIGGVYSRDTGTNSYDNGIIWATWRDRWYSMKKTTMKIIPFNRLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha subunit
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
molecule tags Blood clotting
total genus 125
structure length 390
sequence length 390
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
C PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1m1jC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1m1jC02
1JY2O 4NYTA 1FICA 2HODA 2XNXC 2Z4EC 2J3GA 3HUSB 1M1JB 1LWUC 2JHHC 4R9JA 2XNXA 2Z4EA 2A45G 2J60A 2Q9IC 4EPUA 1RE3B 1LWUA 2Q9IA 2J0YA 1LT9C 1FZCB 1FZFB 2FIBA 3GHGB 4ZFGA 1N86C 1LT9A 3H32C 1LTJB 1FZBC 3E1IC 1W2EA 3HUSC 1RF0C 1N73C 2OYIB 4JYOX 3H32A 1JC9A 1FZBA 2HPCC 2J64A 3HUSA 2J1GA 1RF0A 1N73A 2A45H 2HPCA 2GY7A 3BVHB 1FZCC 4JZCA 1T3UA 2JHKF 1RF1B 2JHLF 4R9TA 1FZCA 2H43B 1RE4B 1Z3SA 2J0HA 1FZAB 1FZGB 2OYIC 1Z3UA 2OYHC 2FFDC 1FZDA 2OYIA 2HLOB 2J3UA 2J3OA 2OYHA 4M7FA 2FFDA 2J61A 1M1JC 3BVHA 1M1JA 1RE3C 2JHIF 1FZAC 1FZFC 3GHGC 1RE3A 1FZEB 1FZAA 1FZGA 4M7HA 2XNXB 2Z4EB 1LTJC 1FZFA 2J3FA 3GHGA 1LWUB 2Q9IB 1LTJA 2A45I 1LT9B 1FIBA 3BVHC 1FZEC 1N86B 3H32B 1RF1C 1FZBB 3E1IB 2H43C 1RE4C 1FZEA 1JY3P 1RF0B 1N73B 1FZGC 1RF1A 2HPCB 2H43A 1RE4A 2HODB 1JY2P 3FIBA 2HLOC 2J0GA 1FIDA 2J2PA 1JY3N 2HLOA 2J5ZA 2JHMF 1JY2N 1JY3O 1N86A 2WNPF 2OYHB 3E1IA 2J3FD 2HODC 2FFDB 2D39A 2J61B
chains in the Genus database with same CATH superfamily
2WVRA 1JTHA 1BGYG 3JSVC 3D6YA 3GF3A 1PPJG 2Z4EC 5M1BA 4KJMA 3KZIH 3CC4P 2J0YA 1OVRA 4RKUJ 3I5CA 2A06D 4L76A 3H1HJ 2Q1KA 2HPCC 5KKZC 2W6AA 2KLUA 1N8RQ 4JZCA 5AW5B 2FXOA 2WSCJ 4HYTB 2OGUA 1E79H 2KIKA 3TSIA 1YJWP 2RKLA 4C7RA 1YHQP 4PD4E 4MN4C 2OYOA 2J3UA 2Q6QA 4M7FA 2FYUD 1QX8A 3B5NC 2E75C 1NVOA 1HTLC 2JHIF 1L4AC 1BGYJ 1JMMA 1SQPG 1FZFA 3RL0B 1SQVG 5CJ4A 1ZRTE 3BATA 4TLFA 1KMIZ 1NH4A 4WWIA 1KQFB 3VYIA 1T2KD 3H32B 1JY3P 3AE5C 2FYUK 3VMAA 2H89C 1NGMB 3M9QA 1SFCC 3EQ2A 2ZT9D 3CX5E 2JJLA 3T97A 2WMMA 2J61B 1FICA 3NTNA 3NXSA 4N78D 2JEEA 3HUSB 2NZ2A 1OMIA 2I1JA 2Z4EA 1W5CE 2WZ7A 2WQYC 1AFOA 3AE6C 1NTKG 4RESB 1FZCB 3KPEA 1SQPJ 1SQVJ 4KHXA 1RF0C 1URQB 2D2CC 3A0BH 4N6JA 1RHZB 2Y0CA 2HPCA 1EZVG 1KB9E 3L75G 1NO4A 3SWFA 1GD2E 2LKMA 3O6QA 1JUNA 2O3JA 1S2EA 3CXHE 4W80A 2Z5IA 4H0LB 1IFIA 3JC22 2M8RA 3CCEP 3R4YA 1YIJP 3CPWO 5CCGD 2C9LY 3B5NA 5B5EH 1GW3A 1VQKP 4DOJA 2FYNC 3HE5A 1FZEB 1DH3A 2E43A 2YO3A 4IL6E 4XE5B 3MD0A 1NTKJ 5KTBA 1EC5A 3GF7A 3G71P 1L0LG 4JQ0D 1FZBB 1YQ4C 2KZJA 3WUVA 1QEXA 2HODB 1PP9D 4HH2A 4CPGA 3L37A 3AE4C 3L75J 4U7JA 3P8CD 4L74A 1SFCA 5H2FE 4ASWA 2OTKE 1JNMA 1ZOYC 2J59M 4U3FE 3FXEA 2BCCG 3HTKB 1H89A 5AW8B 1S9KE 4L75A 3CMEP 2QSIA 1VQ5P 2W8ZA 5KAFH 4GOFA 1FJKA 2R32A 5KJ7D 4XFJA 4ZKUA 1RF0A 3H1HD 3RL0g 2JHKF 1KZUB 1L0LJ 2LXCB 1M8OB 1KYOD 2ZYDA 3KDPB 1Y8AA 4I7ZC 5AVWB 1X8YA 2WT7A 2ZYAA 3L74G 2HR3A 3SWKA 2DW3A 3S9OA 3BVHA 3B8EB 1IJDB 2WSSH 5TISH 1VF5D 3IR9A 3H1JG 2OQQA 4PJ0H 1BCCG 5GTIH 2P67A 3PP5A 2E76D 1G2CA 1BGYD 3G3ZA 1PPJD 5CBNA 2BCCJ 1N7SA 1HF9A 3RK3E 4BRYB 4JYBA 3BCCE 3CWBE 4OWFA 4QMAA 3E1RA 1YTZI 5AVSB 1RE4C 2B9BA 2QJPC 3L71G 1FOSF 3PLNA 4JBZA 1CI6B 3W68A 2IBZG 1LNQA 3GG2A 1LTGC 1NHLA 2YO2A 3L36A 5CHXA 3L74J 1M1JB 3SWYA 1ZN5A 2J60A 1LT1A 2Q9IC 1H8AA 3CCLP 3AE3C 1H0TB 3V2RA 3H1JJ 4WVZA 3B5ND 1LTSC 1BCCJ 2E75D 3H1KG 3A7OA 4KT0J 2GM4A 5AW6B 1XTCC 2Y0DA 4H44D 1SQQE 2YXRB 1SQXG 1KQGB 1SQPD 1SQVD 3LIDA 1T2KC 2MJZA 1GL2C 3B4SA 1RF1B 5KLIC 1SQBG 3KXDA 3L71J 3I55P 4HKZH 1AQ5A 2R3SA 1ZR2A 1DD4A 2O01J 1T3JA 3CLQA 2ZT9C 1SFCD 3OW2O 1FZGA 3CX5H 3Q5RA 2QJKB 1SQPK 1NAYA 1SQVK 1OZHA 1BSHA 3RK3B 3D6ZA 3TF5A 1S5LE 3H1KJ 1NTKD 3L73E 1SQXJ 1RE4A 3V2NA 3M0DC 5KLVE 1T6AA 3A0BE 2M3EA 2I8DA 1FIDA 1SQBJ 1ZXGA 1EZVD 3L75D 1KB9H 3CC7P 3E1IA 1PL5A 2YMKA 5BU8B 3V4WA 3CXHH 1FDMA 2A45G 3AEFC 5CCGC 3MUDC 2Q9IA 1FZFB 2RH0A 1NTKK 1SQPE 3M9BA 2Q3EA 2GUVA 2ZXEB 2OYIB 2QJYB 1DEEG 4IL6H 2QM8A 4OGQD 1N7SD 1HUCA 3TGUG 3M91A 2JHLF 3A3YB 2J0HA 1GL2A 3C1LA 1L0LD 2JWAA 2OYHC 1J1DC 1OVUA 4PD4I 1FU1A 1VQ7P 2Z5HA 1GK4A 2KS1A 2R5DA 1Y47A 2E74D 1BE3G 3BRVB 1SLQA 2WPRA 2W90A 1MFZA 5BVZA 4YPCA 1OIPA 2Z4EB 1L0NG 5K5GB 1VQOP 3AEAC 3S1KA 1Q2NA 1CZQA 1QLED 1Q90D 4R4LA 4AQRD 5AVTB 1ZLLA 2Y9ZA 3AEEC 2BCCD 2HYNA 3L72E 1L0LK 4LGDE 5AW3B 4Y99C 1JCCA 2HPCB 1NTME 5KKZB 4L73A 5KJ7C 5KAFE 3M0DA 3O6QB 2Q3IA 2V7QJ 3TGUJ 2AXTE 5APVA 1CSBA 1MZ9A 3U1CA 1NU1G 3WMM0 3CX5I 3LW5H 1GMJA 1MUUA 4RO0A 1M56D 5APTA 1BE3J 3WUTA 3HE5B 3L74D 2I1KA 1L4AB 2P1JA 5CCGA 1GDTA 3VP8A 3MUDA 3VTPC 4PJ0E 1L0NJ 5APSA 3H1JD 5GTIE 2E76C 1ZR4A 1BCCD 3H1LE 4D6TE 1T3UA 4PV1C 1S72P 4R9TA 1KB9I 1P84D 3USSA 5APXA 3L71D 3CXHI 2OYHA 3MTUE 1SFCB 2WPVB 3I56P 3O8ZA 2IBZD 1NU1J 3H1IG 1QVGO 3HD7D 5CBOA 1N2DC 1FE6A 2JDIH 1IFMA 3G9RA 2PP6A 5KAIE 5APQA 1RF0B 1KC8Q 4H44C 2D2CB 3H1KD 2OTLP 3HE4A 2J0GA 1SQXD 2BEQD 5KJ7A 2J5ZA 2JHMF 2Q5UA 2OARA 2IPPA 2ZYGA 1N86A 3GW6A 1NJIQ 1SQBD 1GL2D 2WT7B 2PGDA 1JY2O 3TNUA 3L74E 1JO5A 4I2LC 2UWJE 2KNCB 3H1IJ 3E7KA 2FYNB 3CCMP 1G2CB 3IAOA 1EDIA 2FKWB 3AE2C 5AW9B 2IZ0A 2IDBA 1OVVA 2K9YA 1GZLA 2A06E 1Z3SA 1SQBK 1KN7A 1AJYA 1S5LH 1G1JA 1X79B 3F89A 1VQ6P 3KHUA 1LTAC 2C0XA 2W6BA 1FS0E 3RK2D 3RGUA 1YJNP 1YTZT 3CCRP 1ZMEC 2B89A 2ZVNB 4IFMA 4GKGA 1D7MA 2FYUE 1FDIA 1VQNP 4WB4A 3BVHC 4OVNF 3H1KE 1NWQA 4DCKA 1GU5A 2PAJA 3LIEA 2J2PA 4OGQC 1N7SC 3AE9C 2JO1A 3TGUD 2P7JA 4NYTA 2XDJA 4I7ZB 4ZNCA 1DX7A 5AVYB 1DD3A 4GODA 4C7NA 3VMYA 1YYCA 2G8YA 2QIWA 2E74C 1XTGB 2XU6A 2KB7P 1OW7A 1BE3D 2KLVA 2C0WA 2N1TD 4N78E 2YNYA 2YXQB 3HUSC 5CCHD 1H88A 1KTMA 1L0ND 1YITP 2J1GA 2WSEJ 2GY7A 1FZCC 3WU2H 1RE4B 2QRXA 1FZAB 1UIIA 1VPCA 1URQC 1A02J 3UIAA 2FFDC 3ZDMA 2J3OA 2Y0EA 1K05A 1EQ7A 4BWNA 1PFIA 1RE3C 2WSFJ 1HGVA 3QWOC 4RJTA 3V4QA 2AXTH 3GHGC 2WTYA 1NU1D 1L0NK 2Q9IB 1IFNA 2JKVA 2W83C 1G1IA 3AECC 1FZEC 2VRSA 5AW4B 1M1KQ 1LJ2A 1FZGC 4DZOA 3CCUP 1K04A 2P58A 2K88A 1GL2B 5KLIB 1KQLA 3BRTB 1M57D 2WNPF 4PV1D 1GW4A 5AW0B 2HODC 1PP9E 2D39A 1PGOA 1HBWA 2PFXA 2FXPA 2KS1B 1IK7A 3MIWA 3P8CE 2ZT9B 1YI2P 4R4MA 4GIFA 3HD7C 3H1ID 3E1IC 1QL1A 1FDOA 3U59A 4GT1A 1HJBA 3HUSA 2CPBA 3CC2P 3L4FA 3L35A 4WY4C 1Q81Q 2ZVOB 1K9MQ 1FZCA 4IOIH 1PGPA 5KAIH 5C39A 3GLMA 1URQA 2QA4P 3H1HE 2FFDA 1QL2A 4EYYQ 2KXPB 1KYOE 2KUBA 4H13D 2KZIA 1RE3A 4M7HA 1ZV8A 1IZNB 1LTJC 3GHGA 3FWLA 5DJTB 4W7ZA 1MFTA 4EDFA 1FAVA 3CCSP 1CW5A 1PGJA 2B88A 3D71A 2B87A 1FZEA 3FWNA 1JTHB 1BGYE 3FX0A 1PPJE 2HLOC 1J2JB 1J1EC 3OA7A 1MKMA 1JY3O 1WT6A 2OYHB 3P7KA 4M3LA 1J1DB 1S4XA 2QVAA 2AEMA 2HODA 1DEBA 3TYYA 2J3GA 4DT0A 4TT3H 2N9BA 3RK2C 5DJUB 3VN0A 4EPUA 2O01H 1VQMP 5APUA 5GTHE 1SVFA 4JYOX 3HD7A 5E79E 1PZQA 1PGQA 1HH0A 2Y9YA 1YJ9P 1AVYA 2P10A 3HTKA 3Q5SA 4WY4A 3Q5PA 1WMKA 3JCUE 4Y99B 3PH0A 1SQVE 3MHVA 3RL0D 2CK3H 2WITA 2E42A 2KI7B 3G4SP 1VQLP 1UIXA 3TDKA 2ZFCA 2LXBA 5B66E 3AEBC 2BASA 3V2QA 1LTJA 2NRGA 5AVXB 1VF5B 3M06A 3VP9A 2SPZA 3T97B 2H43C 2N1TC 2E76B 4U3FJ 5CCHC 5AW2B 2IYPA 4PV1B 1T8ZA 2RN0A 2HLOA 3BCCG 1NTKE 3CWBG 3AEDC 4YXWH 1JY2N 4I6MC 3WU2E 4JYCA 2OTJP 1URQD 3W67A 1EZVE 3IFMA 3L75E 2BEZF 1LT9C 1QVFO 2FIBA 1N86C 1BSNA 1LTIC 1N73C 4PD4D 5CMZA 2A45H 3MZWB 2M5AA 3B5NB 1EXIA 2E75B 2POHA 3C8VA 1RH5B 2OYIC 4H44B 2FBWC 1Z3UA 1SQQG 3A0HH 2GUSA 1ZRTD 1HVVA 1N7LA 3BCCJ 2IBZI 5CJ0A 3CWBJ 2R3CA 1ZP0C 3V6IA 3FXDA 1VQPP 1L0LE 4N3YB 4UB8E 1JMBA 4C7NB 3P32A 4C46A 3PTZA 1FIBA 1PV3A 3CX5D 2H43A 3RBZA 2N1TA 2K9JA 4ZMDA 4ASVA 5CCHA 3CD6P 4GOEA 2QM7A 2RMZA 1KILC 2BCCE 3FGAD 1IK9A 4HJGH 1JEKA 2YIUC 3L73G 4WY4D 1SQQJ 2JWDA 5KLVG 2XNXC 2E5YA 2YMYA 1SP4A 1Y9BA 1LWUC 3K5BA 2K1AA 2IX7C 4H13C 1KB9D 1VQ8P 5L8RJ 2NPSC 3NMDA 3CCQP 1KYOH 1LT9A 2WSCH 2YKPA 3CXHD 1JC9A 2R5BA 2XZRA 1K8AQ 3OJAB 1N73A 2J5UA 4GDOA 3BVHB 1E5WA 1RQUA 1S1CX 2L5GB 3H1JE 2H7HA 4NPFX 1BCCE 2M3BA 5AVUB 4NPDA 1LP1A 2OYIA 1NTZG 4OGQB 1N7SB 1IFPA 3CCJP 1SQXK 3D70A 1W2BO 1P84E 3L73J 2YKOA 2E5TA 4IFFA 1U7MA 5KLVJ 3L71E 1R5LA 3OAKA 4HB1A 1IO4A 2K37A 3PRJA 5AVRB 3L70G 2A45I 2E74B 3C9IA 2IBZE 4EOTA 1YQ3C 4JPZB 1VL2A 2IZ1A 3TK1A 2WWWA 1Q82Q 3A2AA 4WBAA 1IC2A 1OFCX 5GTHH 3FIBA 4U3FD 3AE7C 2P2UA 1JCDA 3EWKA 5E79H 2ZAEB 1NOHA 3L72G 1KILA 3H25A 1S9KD 1Q7YQ 1FJPA 2J3FD 2FFDB 1NTZJ 1NTMG 1OW6A 1NKNA 3JCUH 3CCVP 3VOPA 1SQXE 3RL0C 2ITAA 1HGZA 4W7YA 2YKQA 3SFDC 2XNXA 1RE3B 1LWUA 4AYCA 4YTPC 1USDA 3GHGB 1SQBE 4ZFGA 2J58A 3H32C 2NPSA 1OX3A 1W2EA 2H88C 5B66H 1KV4A 3L70J 2B87B 1IFJA 1LTBC 4Y28J 4LLHA 1LTTC 1L4AA 1FZGB 2PRRA 3PHLA 4BXLA 4IL6X 3VMXA 3H1LG 4D6TG 2O1KA 3L72J 5AVVB 2HG5D 3RK3D 3BCCD 1KYOI 3CMAP 3CWBD 1NTMJ 4A7PA 4UB6E 2QJPB 2C9NY 3G6EP 2AEJA 3WUUA 4Z1MH 1EDKA 3HD7B 1RQVA 3E1IB 3EFFK 1KFNA 1BDDA 3GMAA 4H0LC 1U7JA 1SS1A 3II6A 1NKZB 4WY4B 1JY3N 2WSEH 2IFMA 3AE8C 3IF4A 3N7NA 3HRNA 4OH8B 2FY8A 1AV1A 1DIPA 3P8MC 3A0HE 3H1LJ 2QE7H 3VMZA 1SQQD 2AEFA 4D6TJ 2JHHC 2FXMA 1NYHA 1K73Q 1KORA 1USEA 3TGUE 4K3AA 1X22A 2WSFH 1MV8A 4K35A 1LTJB 5AW1B 1FZBC 3KQGA 4UB8H 3H32A 1AA0A 2J64A 1EXJA 2IYOA 1NU1K 3KYQA 1PIXA 2WPQA 2KNCA 1BE3E 3QH9A 1JB0J 2W6JH 3NFQA 1X9VA 1L0NE 2HLOB 3RBXA 1SQQK 1J1EB 3KZIE 2J61A 3V2PA 1S3JA 2R44A 1OXZA 3R2PA 1IFDA 1FZAC 2A06G 4DJGA 2V4HA 3AE1C 1KILD 3ABVC 3L73D 3Q2YA 1JOCA 1VDFA 2WPSA 3RK2B 5KLVD 1WRGA 2JP3A 3S4RA 4JF7A 2ZXXA 3Q3DA 3EFGA 4PD4H 1GTWA 1NU1E 2FYUG 2NPSD 1JY2P 2QG4A 2M5AB 2KOGA 1Q86Q 1ZW0A 1FC2C 1R5SA 3BASA 1VQ4P 2O01N 2GA1A 1L4AD 1EDJA 3U1AA 2KK7A 1L2PA 1LGHB 5KLVK 1HJ0A 2Q7CA 2K3RA 2L91A 4R9JA 1NTZD 5AW7B 2KSJA 4YXDC 1KQSO 1OW8A 1JM0A 1EZVI 2HFED 1P84H 2KYVA 3H6PA 4B86A 1FZBA 2KSEA 1EDLA 1NAFA 3SFEC 3L70D 2N9YB 2H43B 2N1TB 2W27A 3H1IE 2K9JB 4O9BA 2FYUJ 1HWTC 1M90Q 1FZDA 4NPEA 3A5TA 1FBMA 1NTZK 1FOSE 2XNDH 1M1JC 1KILE 4U3FG 1S5LX 1FZAA 5APWA 3L72D 3MP7B 3HE4B 2JR8A 1NTMD 2D2CD 4ZKPA 2AXCA 1LT9B 1A02F 5EFWB 1N86B 1RF1C 2MKVA 3TNUB 3ITKA 3MGNA 1N73B 1X0TA 1TU3F 5B5EE 2M0BA 1LP1B 3M9HA 1NTZE 4AUWA 3F5HA 1BDCA 5TJHA 1NTMK 2QJKC 3PJSK 1KFMA 3H1LD 3RK3C 3AEGC 4D6TD 3M0AA 5APYA 5BU5A 4BRYA 2XKMA 1PP9G 1OWAA 2ZJSE 4XA4A 3L70E 2XV5A 4I1LA 2QEXP 4UB6H 1R8EA 3SSUA 4LC1A 1CI6A 3CL3D 3N4XA 1AQTA 5H2FH 5AVQB 5AVZB 3LW5J 3B71A 4EIJA 2CPSA 4EI2A 2IFNA 2FYZA 1KILB 4H0LD 3IN6A 1M1JA 2YIUB 1GU4A 1FZFC 1H0TA 1P84I 2XNXB 1AVOA 3Q1MA 2J3FA 1LWUB 3H1HG 1KD1Q 1GK6A 2QJYC 3CI9A 1RY3A 4H13B 1YBKA 2NPSB 1PP9J 1QGKB 1M7LA 2H8PD 2V7QH 1RF1A 4IFDK 1Z56A 1U57A 1VF5C 5TISE 2KP8A 1VQ9P 2O1JA 2LR2A 2G3AA 3V5BA
chains in the Genus database with same CATH topology
1JTHA 5BU8B 3V4WA 1NKNA 2Z4EC 3VOPA 3RL0C 1HGZA 4W7YA 2YKQA 3MIWA 2XNXA 1FDMA 2A45G 5CCGC 3P8CE 1RE3B 1LWUA 4AYCA 2Q9IA 2J0YA 1FZFB 3GHGB 1NTKK 3M9BA 4ZFGA 2J58A 4GIFA 3HD7C 2GUVA 3H32C 3I5CA 2ZXEB 3E1IC 1QL1A 2NPSA 3U59A 1W2EA 2OYIB 4GT1A 1HJBA 2HPCC 2W6AA 3HUSA 1IFJA 1LTBC 4LLHA 2CPBA 2QM8A 3L35A 1N7SD 1LTTC 1HUCA 3L4FA 4HYTB 4WY4C 5AW5B 4JZCA 1L4AA 3M91A 3TSIA 2JHLF 3A3YB 1FZCA 2J0HA 1GL2A 4C7RA 1FZGB 2OYHC 1J1DC 3VMXA 2J3UA 1URQA 4M7FA 2FFDA 1FU1A 1QL2A 2Z5HA 3B5NC 1GK4A 2O1KA 2R5DA 1HTLC 5AVVB 2HG5D 3BRVB 3RK3D 2JHIF 1L4AC 1SLQA 2WPRA 1RE3A 1MFZA 5BVZA 4M7HA 1ZV8A 1JMMA 1LTJC 2Z4EB 1FZFA 3GHGA 3RL0B 5CJ4A 2C9NY 3BATA 4W7ZA 1CZQA 1FAVA 1NH4A 4AQRD 1CW5A 5AVTB 1ZLLA 3VYIA 1T2KD 2HYNA 3HD7B 3H32B 3E1IB 1KFNA 1L0LK 4LGDE 1FZEA 1JY3P 5AW3B 1JTHB 4Y99C 1JCCA 2HPCB 5KJ7C 2FYUK 2HLOC 1J2JB 3II6A 3M0DA 1NKZB 4WY4B 1J1EC 3M9QA 1SFCC 2Q3IA 1JY3N 3EQ2A 2WSEH 2IFMA 5APVA 1CSBA 3OA7A 2JJLA 1JY3O 1WT6A 3N7NA 1MZ9A 3U1CA 3HRNA 3P7KA 4M3LA 4OH8B 3T97A 1J1DB 3WMM0 2OYHB 2J61B 3LW5H 1MUUA 1FICA 3NTNA 3P8MC 2HODA 1DEBA 3NXSA 4N78D 2JEEA 3TYYA 2J3GA 3HUSB 3VMZA 5APTA 2N9BA 2JHHC 2FXMA 2I1JA 3RK2C 2Z4EA 3VN0A 2WZ7A 4EPUA 3HE5B 1AFOA 2O01H 2I1KA 1L4AB 2P1JA 4RESB 5CCGA 1GDTA 3VP8A 1FZCB 3MUDA 3VTPC 3KPEA 2WSFH 1MV8A 5APUA 1LTJB 5AW1B 5APSA 1FZBC 3KQGA 4KHXA 1SVFA 1RF0C 4JYOX 3HD7A 3H32A 1ZR4A 1URQB 1HH0A 2J64A 4N6JA 1NU1K 3KYQA 2HPCA 2WPQA 1T3UA 1NO4A 3HTKA 3SWFA 1GD2E 4R9TA 2LKMA 4WY4A 1JUNA 3NFQA 4Y99B 4W80A 2Z5IA 1X9VA 1IFIA 5APXA 2HLOB 1SQQK 2M8RA 3MTUE 2OYHA 3RL0D 1J1EB 1SFCB 2WITA 2J61A 3V2PA 2E42A 5CCGD 2C9LY 1OXZA 3R2PA 2ZFCA 3B5NA 3O8ZA 1GW3A 1IFDA 1FZAC 4DOJA 2BASA 3HE5A 1FZEB 1KILD 3HD7D 1DH3A 3V2QA 2E43A 2YO3A 1JOCA 4XE5B 1N2DC 1VDFA 2WPSA 1LTJA 3RK2B 3MD0A 1WRGA 5KTBA 5AVXB 3M06A 1IFMA 3VP9A 2PP6A 4JF7A 1FZBB 2H43C 2N1TC 3EFGA 5APQA 1GTWA 1RF0B 5CCHC 2HODB 2NPSD 5AW2B 4HH2A 1JY2P 3HE4A 3L37A 2KOGA 2J0GA 1T8ZA 5KJ7A 2HLOA 2J5ZA 3BASA 2JHMF 2Q5UA 2OARA 3P8CD 1SFCA 2IPPA 1JY2N 4I6MC 1N86A 1L4AD 4JYCA 1JNMA 1GL2D 3U1AA 2WT7B 1JY2O 3TNUA 2J59M 1LGHB 1JO5A 5KLVK 4I2LC 2Q7CA 1URQD 4R9JA 5AW7B 2KSJA 3HTKB 3IFMA 1LT9C 5AW8B 1S9KE 1H89A 2FIBA 1G2CB 1N86C 2HFED 2KYVA 1LTIC 3H6PA 2FKWB 1N73C 4B86A 1FZBA 1FJKA 5CMZA 2R32A 5KJ7D 4ZKUA 1RF0A 5AW9B 2A45H 1NAFA 2JHKF 1KZUB 3B5NB 2POHA 1GZLA 2H43B 2N1TB 2W27A 1Z3SA 1SQBK 4O9BA 2OYIC 1HWTC 1Z3UA 1G1JA 1X79B 3KDPB 1FZDA 3A5TA 1FBMA 2GUSA 5AVWB 1LTAC 2C0XA 1X8YA 1NTZK 2WT7A 1HVVA 1N7LA 2W6BA 1FOSE 1M1JC 3RK2D 1YTZT 5CJ0A 3BVHA 2R3CA 3B8EB 1IJDB 3IR9A 4IFMA 4GKGA 4N3YB 1FZAA 5APWA 4C7NB 2P67A 3PP5A 1G2CA 3P32A 3HE4B 4C46A 4ZKPA 3G3ZA 4WB4A 1N7SA 1LT9B 1A02F 1FIBA 4JYBA 3BVHC 1NWQA 1N86B 1GU5A 1RF1C 1YTZI 5AVSB 1RE4C 2PAJA 3TNUB 3MGNA 1N73B 1FOSF 2H43A 2N1TA 5CCHA 1CI6B 3LIEA 2J2PA 1N7SC 2QM7A 1KILC 1IK9A 1LTGC 2P7JA 3M9HA 4WY4D 4AUWA 1NHLA 4NYTA 2XDJA 1DX7A 5AVYB 2XNXC 2YO2A 3L36A 5CHXA 1NTMK 2YMYA 1M1JB 1SP4A 1LWUC 3SWYA 1ZN5A 2J60A 4C7NA 2Q9IC 3VMYA 1YYCA 1H8AA 1KFMA 1XTGB 2IX7C 3RK3C 3V2RA 2XU6A 2KB7P 3M0AA 5APYA 3B5ND 5BU5A 1LTSC 2NPSC 3NMDA 2KLVA 2XKMA 1LT9A 2C0WA 2N1TD 3A7OA 2GM4A 4N78E 5AW6B 1XTCC 1OWAA 2WSCH 2YKPA 2YNYA 3HUSC 5CCHD 4XA4A 1H88A 1JC9A 2R5BA 2XV5A 2XZRA 4I1LA 3OJAB 2J1GA 1N73A 3LIDA 2GY7A 3BVHB 1FZCC 1E5WA 1T2KC 4LC1A 2MJZA 1GL2C 1CI6A 3CL3D 3N4XA 1RF1B 1RE4B 2L5GB 5AVQB 5AVZB 1FZAB 2H7HA 1VPCA 1URQC 1A02J 3UIAA 2FFDC 2M3BA 4EIJA 1AQ5A 5AVUB 2OYIA 1ZR2A 2J3OA 2CPSA 2IFNA 1N7SB 2FYZA 1KILB 1T3JA 1EQ7A 3CLQA 1PFIA 1M1JA 1RE3C 1SQXK 1GU4A 1HGVA 2YKOA 1SFCD 1FZFC 3V4QA 3GHGC 4IFFA 2WTYA 1FZGA 2XNXB 2J3FA 3OAKA 1IO4A 1LWUB 1SQPK 1L0NK 2Q9IB 1IFNA 1SQVK 5AVRB 2A45I 3C9IA 1GK6A 3RK3B 3CI9A 1RY3A 4EOTA 1G1IA 2NPSB 1FZEC 2VRSA 3TK1A 2WWWA 1M7LA 5AW4B 2H8PD 3A2AA 4WBAA 1FZGC 1IC2A 4DZOA 1RF1A 1RE4A 3V2NA 3M0DC 4IFDK 1Z56A 3FIBA 2P2UA 1JCDA 1FIDA 2KP8A 1GL2B 1NOHA 1KQLA 3BRTB 1KILA 1S9KD 2WNPF 2O1JA 1GW4A 3E1IA 5AW0B 1FJPA 2FFDB 2HODC 2J3FD 3V5BA 2D39A 1HBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 O;  4NYT A;  1FIC A;  2HOD A;  2XNX C;  2Z4E C;  2J3G A;  3HUS B;  1M1J B;  1LWU C;  2JHH C;  4R9J A;  2XNX A;  2Z4E A;  2A45 G;  2J60 A;  2Q9I C;  4EPU A;  1RE3 B;  1LWU A;  2Q9I A;  2J0Y A;  1LT9 C;  1FZC B;  1FZF B;  2FIB A;  3GHG B;  4ZFG A;  1N86 C;  1LT9 A;  3H32 C;  1LTJ B;  1FZB C;  3E1I C;  1W2E A;  3HUS C;  1RF0 C;  1N73 C;  2OYI B;  4JYO X;  3H32 A;  1JC9 A;  1FZB A;  2HPC C;  2J64 A;  3HUS A;  2J1G A;  1RF0 A;  1N73 A;  2A45 H;  2HPC A;  2GY7 A;  3BVH B;  1FZC C;  4JZC A;  1T3U A;  2JHK F;  1RF1 B;  2JHL F;  4R9T A;  1FZC A;  2H43 B;  1RE4 B;  1Z3S A;  2J0H A;  1FZA B;  1FZG B;  2OYI C;  1Z3U A;  2OYH C;  2FFD C;  1FZD A;  2OYI A;  2HLO B;  2J3U A;  2J3O A;  2OYH A;  4M7F A;  2FFD A;  2J61 A;  1M1J C;  3BVH A;  1M1J A;  1RE3 C;  2JHI F;  1FZA C;  1FZF C;  3GHG C;  1RE3 A;  1FZE B;  1FZA A;  1FZG A;  4M7H A;  2XNX B;  2Z4E B;  1LTJ C;  1FZF A;  2J3F A;  3GHG A;  1LWU B;  2Q9I B;  1LTJ A;  2A45 I;  1LT9 B;  1FIB A;  3BVH C;  1FZE C;  1N86 B;  3H32 B;  1RF1 C;  1FZB B;  3E1I B;  2H43 C;  1RE4 C;  1FZE A;  1JY3 P;  1RF0 B;  1N73 B;  1FZG C;  1RF1 A;  2HPC B;  2H43 A;  1RE4 A;  2HOD B;  1JY2 P;  3FIB A;  2HLO C;  2J0G A;  1FID A;  2J2P A;  1JY3 N;  2HLO A;  2J5Z A;  2JHM F;  1JY2 N;  1JY3 O;  1N86 A;  2WNP F;  2OYH B;  3E1I A;  2J3F D;  2HOD C;  2FFD B;  2D39 A;  2J61 B; 
#chains in the Genus database with same CATH topology
 2WVR A;  1JTH A;  1BGY G;  3JSV C;  3D6Y A;  3GF3 A;  1PPJ G;  2Z4E C;  5M1B A;  4KJM A;  3KZI H;  3CC4 P;  2J0Y A;  1OVR A;  4RKU J;  3I5C A;  2A06 D;  4L76 A;  3H1H J;  2Q1K A;  2HPC C;  5KKZ C;  2W6A A;  2KLU A;  1N8R Q;  4JZC A;  5AW5 B;  2FXO A;  2WSC J;  4HYT B;  2OGU A;  1E79 H;  2KIK A;  3TSI A;  1YJW P;  2RKL A;  4C7R A;  1YHQ P;  4PD4 E;  4MN4 C;  2OYO A;  2J3U A;  2Q6Q A;  4M7F A;  2FYU D;  1QX8 A;  3B5N C;  2E75 C;  1NVO A;  1HTL C;  2JHI F;  1L4A C;  1BGY J;  1JMM A;  1SQP G;  1FZF A;  3RL0 B;  1SQV G;  5CJ4 A;  1ZRT E;  3BAT A;  4TLF A;  1KMI Z;  1NH4 A;  4WWI A;  1KQF B;  3VYI A;  1T2K D;  3H32 B;  1JY3 P;  3AE5 C;  2FYU K;  3VMA A;  2H89 C;  1NGM B;  3M9Q A;  1SFC C;  3EQ2 A;  2ZT9 D;  3CX5 E;  2JJL A;  3T97 A;  2WMM A;  2J61 B;  1FIC A;  3NTN A;  3NXS A;  4N78 D;  2JEE A;  3HUS B;  2NZ2 A;  1OMI A;  2I1J A;  2Z4E A;  1W5C E;  2WZ7 A;  2WQY C;  1AFO A;  3AE6 C;  1NTK G;  4RES B;  1FZC B;  3KPE A;  1SQP J;  1SQV J;  4KHX A;  1RF0 C;  1URQ B;  2D2C C;  3A0B H;  4N6J A;  1RHZ B;  2Y0C A;  2HPC A;  1EZV G;  1KB9 E;  3L75 G;  1NO4 A;  3SWF A;  1GD2 E;  2LKM A;  3O6Q A;  1JUN A;  2O3J A;  1S2E A;  3CXH E;  4W80 A;  2Z5I A;  4H0L B;  1IFI A;  3JC2 2;  2M8R A;  3CCE P;  3R4Y A;  1YIJ P;  3CPW O;  5CCG D;  2C9L Y;  3B5N A;  5B5E H;  1GW3 A;  1VQK P;  4DOJ A;  2FYN C;  3HE5 A;  1FZE B;  1DH3 A;  2E43 A;  2YO3 A;  4IL6 E;  4XE5 B;  3MD0 A;  1NTK J;  5KTB A;  1EC5 A;  3GF7 A;  3G71 P;  1L0L G;  4JQ0 D;  1FZB B;  1YQ4 C;  2KZJ A;  3WUV A;  1QEX A;  2HOD B;  1PP9 D;  4HH2 A;  4CPG A;  3L37 A;  3AE4 C;  3L75 J;  4U7J A;  3P8C D;  4L74 A;  1SFC A;  5H2F E;  4ASW A;  2OTK E;  1JNM A;  1ZOY C;  2J59 M;  4U3F E;  3FXE A;  2BCC G;  3HTK B;  1H89 A;  5AW8 B;  1S9K E;  4L75 A;  3CME P;  2QSI A;  1VQ5 P;  2W8Z A;  5KAF H;  4GOF A;  1FJK A;  2R32 A;  5KJ7 D;  4XFJ A;  4ZKU A;  1RF0 A;  3H1H D;  3RL0 g;  2JHK F;  1KZU B;  1L0L J;  2LXC B;  1M8O B;  1KYO D;  2ZYD A;  3KDP B;  1Y8A A;  4I7Z C;  5AVW B;  1X8Y A;  2WT7 A;  2ZYA A;  3L74 G;  2HR3 A;  3SWK A;  2DW3 A;  3S9O A;  3BVH A;  3B8E B;  1IJD B;  2WSS H;  5TIS H;  1VF5 D;  3IR9 A;  3H1J G;  2OQQ A;  4PJ0 H;  1BCC G;  5GTI H;  2P67 A;  3PP5 A;  2E76 D;  1G2C A;  1BGY D;  3G3Z A;  1PPJ D;  5CBN A;  2BCC J;  1N7S A;  1HF9 A;  3RK3 E;  4BRY B;  4JYB A;  3BCC E;  3CWB E;  4OWF A;  4QMA A;  3E1R A;  1YTZ I;  5AVS B;  1RE4 C;  2B9B A;  2QJP C;  3L71 G;  1FOS F;  3PLN A;  4JBZ A;  1CI6 B;  3W68 A;  2IBZ G;  1LNQ A;  3GG2 A;  1LTG C;  1NHL A;  2YO2 A;  3L36 A;  5CHX A;  3L74 J;  1M1J B;  3SWY A;  1ZN5 A;  2J60 A;  1LT1 A;  2Q9I C;  1H8A A;  3CCL P;  3AE3 C;  1H0T B;  3V2R A;  3H1J J;  4WVZ A;  3B5N D;  1LTS C;  1BCC J;  2E75 D;  3H1K G;  3A7O A;  4KT0 J;  2GM4 A;  5AW6 B;  1XTC C;  2Y0D A;  4H44 D;  1SQQ E;  2YXR B;  1SQX G;  1KQG B;  1SQP D;  1SQV D;  3LID A;  1T2K C;  2MJZ A;  1GL2 C;  3B4S A;  1RF1 B;  5KLI C;  1SQB G;  3KXD A;  3L71 J;  3I55 P;  4HKZ H;  1AQ5 A;  2R3S A;  1ZR2 A;  1DD4 A;  2O01 J;  1T3J A;  3CLQ A;  2ZT9 C;  1SFC D;  3OW2 O;  1FZG A;  3CX5 H;  3Q5R A;  2QJK B;  1SQP K;  1NAY A;  1SQV K;  1OZH A;  1BSH A;  3RK3 B;  3D6Z A;  3TF5 A;  1S5L E;  3H1K J;  1NTK D;  3L73 E;  1SQX J;  1RE4 A;  3V2N A;  3M0D C;  5KLV E;  1T6A A;  3A0B E;  2M3E A;  2I8D A;  1FID A;  1SQB J;  1ZXG A;  1EZV D;  3L75 D;  1KB9 H;  3CC7 P;  3E1I A;  1PL5 A;  2YMK A;  5BU8 B;  3V4W A;  3CXH H;  1FDM A;  2A45 G;  3AEF C;  5CCG C;  3MUD C;  2Q9I A;  1FZF B;  2RH0 A;  1NTK K;  1SQP E;  3M9B A;  2Q3E A;  2GUV A;  2ZXE B;  2OYI B;  2QJY B;  1DEE G;  4IL6 H;  2QM8 A;  4OGQ D;  1N7S D;  1HUC A;  3TGU G;  3M91 A;  2JHL F;  3A3Y B;  2J0H A;  1GL2 A;  3C1L A;  1L0L D;  2JWA A;  2OYH C;  1J1D C;  1OVU A;  4PD4 I;  1FU1 A;  1VQ7 P;  2Z5H A;  1GK4 A;  2KS1 A;  2R5D A;  1Y47 A;  2E74 D;  1BE3 G;  3BRV B;  1SLQ A;  2WPR A;  2W90 A;  1MFZ A;  5BVZ A;  4YPC A;  1OIP A;  2Z4E B;  1L0N G;  5K5G B;  1VQO P;  3AEA C;  3S1K A;  1Q2N A;  1CZQ A;  1QLE D;  1Q90 D;  4R4L A;  4AQR D;  5AVT B;  1ZLL A;  2Y9Z A;  3AEE C;  2BCC D;  2HYN A;  3L72 E;  1L0L K;  4LGD E;  5AW3 B;  4Y99 C;  1JCC A;  2HPC B;  1NTM E;  5KKZ B;  4L73 A;  5KJ7 C;  5KAF E;  3M0D A;  3O6Q B;  2Q3I A;  2V7Q J;  3TGU J;  2AXT E;  5APV A;  1CSB A;  1MZ9 A;  3U1C A;  1NU1 G;  3WMM 0;  3CX5 I;  3LW5 H;  1GMJ A;  1MUU A;  4RO0 A;  1M56 D;  5APT A;  1BE3 J;  3WUT A;  3HE5 B;  3L74 D;  2I1K A;  1L4A B;  2P1J A;  5CCG A;  1GDT A;  3VP8 A;  3MUD A;  3VTP C;  4PJ0 E;  1L0N J;  5APS A;  3H1J D;  5GTI E;  2E76 C;  1ZR4 A;  1BCC D;  3H1L E;  4D6T E;  1T3U A;  4PV1 C;  1S72 P;  4R9T A;  1KB9 I;  1P84 D;  3USS A;  5APX A;  3L71 D;  3CXH I;  2OYH A;  3MTU E;  1SFC B;  2WPV B;  3I56 P;  3O8Z A;  2IBZ D;  1NU1 J;  3H1I G;  1QVG O;  3HD7 D;  5CBO A;  1N2D C;  1FE6 A;  2JDI H;  1IFM A;  3G9R A;  2PP6 A;  5KAI E;  5APQ A;  1RF0 B;  1KC8 Q;  4H44 C;  2D2C B;  3H1K D;  2OTL P;  3HE4 A;  2J0G A;  1SQX D;  2BEQ D;  5KJ7 A;  2J5Z A;  2JHM F;  2Q5U A;  2OAR A;  2IPP A;  2ZYG A;  1N86 A;  3GW6 A;  1NJI Q;  1SQB D;  1GL2 D;  2WT7 B;  2PGD A;  1JY2 O;  3TNU A;  3L74 E;  1JO5 A;  4I2L C;  2UWJ E;  2KNC B;  3H1I J;  3E7K A;  2FYN B;  3CCM P;  1G2C B;  3IAO A;  1EDI A;  2FKW B;  3AE2 C;  5AW9 B;  2IZ0 A;  2IDB A;  1OVV A;  2K9Y A;  1GZL A;  2A06 E;  1Z3S A;  1SQB K;  1KN7 A;  1AJY A;  1S5L H;  1G1J A;  1X79 B;  3F89 A;  1VQ6 P;  3KHU A;  1LTA C;  2C0X A;  2W6B A;  1FS0 E;  3RK2 D;  3RGU A;  1YJN P;  1YTZ T;  3CCR P;  1ZME C;  2B89 A;  2ZVN B;  4IFM A;  4GKG A;  1D7M A;  2FYU E;  1FDI A;  1VQN P;  4WB4 A;  3BVH C;  4OVN F;  3H1K E;  1NWQ A;  4DCK A;  1GU5 A;  2PAJ A;  3LIE A;  2J2P A;  4OGQ C;  1N7S C;  3AE9 C;  2JO1 A;  3TGU D;  2P7J A;  4NYT A;  2XDJ A;  4I7Z B;  4ZNC A;  1DX7 A;  5AVY B;  1DD3 A;  4GOD A;  4C7N A;  3VMY A;  1YYC A;  2G8Y A;  2QIW A;  2E74 C;  1XTG B;  2XU6 A;  2KB7 P;  1OW7 A;  1BE3 D;  2KLV A;  2C0W A;  2N1T D;  4N78 E;  2YNY A;  2YXQ B;  3HUS C;  5CCH D;  1H88 A;  1KTM A;  1L0N D;  1YIT P;  2J1G A;  2WSE J;  2GY7 A;  1FZC C;  3WU2 H;  1RE4 B;  2QRX A;  1FZA B;  1UII A;  1VPC A;  1URQ C;  1A02 J;  3UIA A;  2FFD C;  3ZDM A;  2J3O A;  2Y0E A;  1K05 A;  1EQ7 A;  4BWN A;  1PFI A;  1RE3 C;  2WSF J;  1HGV A;  3QWO C;  4RJT A;  3V4Q A;  2AXT H;  3GHG C;  2WTY A;  1NU1 D;  1L0N K;  2Q9I B;  1IFN A;  2JKV A;  2W83 C;  1G1I A;  3AEC C;  1FZE C;  2VRS A;  5AW4 B;  1M1K Q;  1LJ2 A;  1FZG C;  4DZO A;  3CCU P;  1K04 A;  2P58 A;  2K88 A;  1GL2 B;  5KLI B;  1KQL A;  3BRT B;  1M57 D;  2WNP F;  4PV1 D;  1GW4 A;  5AW0 B;  2HOD C;  1PP9 E;  2D39 A;  1PGO A;  1HBW A;  2PFX A;  2FXP A;  2KS1 B;  1IK7 A;  3MIW A;  3P8C E;  2ZT9 B;  1YI2 P;  4R4M A;  4GIF A;  3HD7 C;  3H1I D;  3E1I C;  1QL1 A;  1FDO A;  3U59 A;  4GT1 A;  1HJB A;  3HUS A;  2CPB A;  3CC2 P;  3L4F A;  3L35 A;  4WY4 C;  1Q81 Q;  2ZVO B;  1K9M Q;  1FZC A;  4IOI H;  1PGP A;  5KAI H;  5C39 A;  3GLM A;  1URQ A;  2QA4 P;  3H1H E;  2FFD A;  1QL2 A;  4EYY Q;  2KXP B;  1KYO E;  2KUB A;  4H13 D;  2KZI A;  1RE3 A;  4M7H A;  1ZV8 A;  1IZN B;  1LTJ C;  3GHG A;  3FWL A;  5DJT B;  4W7Z A;  1MFT A;  4EDF A;  1FAV A;  3CCS P;  1CW5 A;  1PGJ A;  2B88 A;  3D71 A;  2B87 A;  1FZE A;  3FWN A;  1JTH B;  1BGY E;  3FX0 A;  1PPJ E;  2HLO C;  1J2J B;  1J1E C;  3OA7 A;  1MKM A;  1JY3 O;  1WT6 A;  2OYH B;  3P7K A;  4M3L A;  1J1D B;  1S4X A;  2QVA A;  2AEM A;  2HOD A;  1DEB A;  3TYY A;  2J3G A;  4DT0 A;  4TT3 H;  2N9B A;  3RK2 C;  5DJU B;  3VN0 A;  4EPU A;  2O01 H;  1VQM P;  5APU A;  5GTH E;  1SVF A;  4JYO X;  3HD7 A;  5E79 E;  1PZQ A;  1PGQ A;  1HH0 A;  2Y9Y A;  1YJ9 P;  1AVY A;  2P10 A;  3HTK A;  3Q5S A;  4WY4 A;  3Q5P A;  1WMK A;  3JCU E;  4Y99 B;  3PH0 A;  1SQV E;  3MHV A;  3RL0 D;  2CK3 H;  2WIT A;  2E42 A;  2KI7 B;  3G4S P;  1VQL P;  1UIX A;  3TDK A;  2ZFC A;  2LXB A;  5B66 E;  3AEB C;  2BAS A;  3V2Q A;  1LTJ A;  2NRG A;  5AVX B;  1VF5 B;  3M06 A;  3VP9 A;  2SPZ A;  3T97 B;  2H43 C;  2N1T C;  2E76 B;  4U3F J;  5CCH C;  5AW2 B;  2IYP A;  4PV1 B;  1T8Z A;  2RN0 A;  2HLO A;  3BCC G;  1NTK E;  3CWB G;  3AED C;  4YXW H;  1JY2 N;  4I6M C;  3WU2 E;  4JYC A;  2OTJ P;  1URQ D;  3W67 A;  1EZV E;  3IFM A;  3L75 E;  2BEZ F;  1LT9 C;  1QVF O;  2FIB A;  1N86 C;  1BSN A;  1LTI C;  1N73 C;  4PD4 D;  5CMZ A;  2A45 H;  3MZW B;  2M5A A;  3B5N B;  1EXI A;  2E75 B;  2POH A;  3C8V A;  1RH5 B;  2OYI C;  4H44 B;  2FBW C;  1Z3U A;  1SQQ G;  3A0H H;  2GUS A;  1ZRT D;  1HVV A;  1N7L A;  3BCC J;  2IBZ I;  5CJ0 A;  3CWB J;  2R3C A;  1ZP0 C;  3V6I A;  3FXD A;  1VQP P;  1L0L E;  4N3Y B;  4UB8 E;  1JMB A;  4C7N B;  3P32 A;  4C46 A;  3PTZ A;  1FIB A;  1PV3 A;  3CX5 D;  2H43 A;  3RBZ A;  2N1T A;  2K9J A;  4ZMD A;  4ASV A;  5CCH A;  3CD6 P;  4GOE A;  2QM7 A;  2RMZ A;  1KIL C;  2BCC E;  3FGA D;  1IK9 A;  4HJG H;  1JEK A;  2YIU C;  3L73 G;  4WY4 D;  1SQQ J;  2JWD A;  5KLV G;  2XNX C;  2E5Y A;  2YMY A;  1SP4 A;  1Y9B A;  1LWU C;  3K5B A;  2K1A A;  2IX7 C;  4H13 C;  1KB9 D;  1VQ8 P;  5L8R J;  2NPS C;  3NMD A;  3CCQ P;  1KYO H;  1LT9 A;  2WSC H;  2YKP A;  3CXH D;  1JC9 A;  2R5B A;  2XZR A;  1K8A Q;  3OJA B;  1N73 A;  2J5U A;  4GDO A;  3BVH B;  1E5W A;  1RQU A;  1S1C X;  2L5G B;  3H1J E;  2H7H A;  4NPF X;  1BCC E;  2M3B A;  5AVU B;  4NPD A;  1LP1 A;  2OYI A;  1NTZ G;  4OGQ B;  1N7S B;  1IFP A;  3CCJ P;  1SQX K;  3D70 A;  1W2B O;  1P84 E;  3L73 J;  2YKO A;  2E5T A;  4IFF A;  1U7M A;  5KLV J;  3L71 E;  1R5L A;  3OAK A;  4HB1 A;  1IO4 A;  2K37 A;  3PRJ A;  5AVR B;  3L70 G;  2A45 I;  2E74 B;  3C9I A;  2IBZ E;  4EOT A;  1YQ3 C;  4JPZ B;  1VL2 A;  2IZ1 A;  3TK1 A;  2WWW A;  1Q82 Q;  3A2A A;  4WBA A;  1IC2 A;  1OFC X;  5GTH H;  3FIB A;  4U3F D;  3AE7 C;  2P2U A;  1JCD A;  3EWK A;  5E79 H;  2ZAE B;  1NOH A;  3L72 G;  1KIL A;  3H25 A;  1S9K D;  1Q7Y Q;  1FJP A;  2J3F D;  2FFD B;  1NTZ J;  1NTM G;  1OW6 A;  1NKN A;  3JCU H;  3CCV P;  3VOP A;  1SQX E;  3RL0 C;  2ITA A;  1HGZ A;  4W7Y A;  2YKQ A;  3SFD C;  2XNX A;  1RE3 B;  1LWU A;  4AYC A;  4YTP C;  1USD A;  3GHG B;  1SQB E;  4ZFG A;  2J58 A;  3H32 C;  2NPS A;  1OX3 A;  1W2E A;  2H88 C;  5B66 H;  1KV4 A;  3L70 J;  2B87 B;  1IFJ A;  1LTB C;  4Y28 J;  4LLH A;  1LTT C;  1L4A A;  1FZG B;  2PRR A;  3PHL A;  4BXL A;  4IL6 X;  3VMX A;  3H1L G;  4D6T G;  2O1K A;  3L72 J;  5AVV B;  2HG5 D;  3RK3 D;  3BCC D;  1KYO I;  3CMA P;  3CWB D;  1NTM J;  4A7P A;  4UB6 E;  2QJP B;  2C9N Y;  3G6E P;  2AEJ A;  3WUU A;  4Z1M H;  1EDK A;  3HD7 B;  1RQV A;  3E1I B;  3EFF K;  1KFN A;  1BDD A;  3GMA A;  4H0L C;  1U7J A;  1SS1 A;  3II6 A;  1NKZ B;  4WY4 B;  1JY3 N;  2WSE H;  2IFM A;  3AE8 C;  3IF4 A;  3N7N A;  3HRN A;  4OH8 B;  2FY8 A;  1AV1 A;  1DIP A;  3P8M C;  3A0H E;  3H1L J;  2QE7 H;  3VMZ A;  1SQQ D;  2AEF A;  4D6T J;  2JHH C;  2FXM A;  1NYH A;  1K73 Q;  1KOR A;  1USE A;  3TGU E;  4K3A A;  1X22 A;  2WSF H;  1MV8 A;  4K35 A;  1LTJ B;  5AW1 B;  1FZB C;  3KQG A;  4UB8 H;  3H32 A;  1AA0 A;  2J64 A;  1EXJ A;  2IYO A;  1NU1 K;  3KYQ A;  1PIX A;  2WPQ A;  2KNC A;  1BE3 E;  3QH9 A;  1JB0 J;  2W6J H;  3NFQ A;  1X9V A;  1L0N E;  2HLO B;  3RBX A;  1SQQ K;  1J1E B;  3KZI E;  2J61 A;  3V2P A;  1S3J A;  2R44 A;  1OXZ A;  3R2P A;  1IFD A;  1FZA C;  2A06 G;  4DJG A;  2V4H A;  3AE1 C;  1KIL D;  3ABV C;  3L73 D;  3Q2Y A;  1JOC A;  1VDF A;  2WPS A;  3RK2 B;  5KLV D;  1WRG A;  2JP3 A;  3S4R A;  4JF7 A;  2ZXX A;  3Q3D A;  3EFG A;  4PD4 H;  1GTW A;  1NU1 E;  2FYU G;  2NPS D;  1JY2 P;  2QG4 A;  2M5A B;  2KOG A;  1Q86 Q;  1ZW0 A;  1FC2 C;  1R5S A;  3BAS A;  1VQ4 P;  2O01 N;  2GA1 A;  1L4A D;  1EDJ A;  3U1A A;  2KK7 A;  1L2P A;  1LGH B;  5KLV K;  1HJ0 A;  2Q7C A;  2K3R A;  2L91 A;  4R9J A;  1NTZ D;  5AW7 B;  2KSJ A;  4YXD C;  1KQS O;  1OW8 A;  1JM0 A;  1EZV I;  2HFE D;  1P84 H;  2KYV A;  3H6P A;  4B86 A;  1FZB A;  2KSE A;  1EDL A;  1NAF A;  3SFE C;  3L70 D;  2N9Y B;  2H43 B;  2N1T B;  2W27 A;  3H1I E;  2K9J B;  4O9B A;  2FYU J;  1HWT C;  1M90 Q;  1FZD A;  4NPE A;  3A5T A;  1FBM A;  1NTZ K;  1FOS E;  2XND H;  1M1J C;  1KIL E;  4U3F G;  1S5L X;  1FZA A;  5APW A;  3L72 D;  3MP7 B;  3HE4 B;  2JR8 A;  1NTM D;  2D2C D;  4ZKP A;  2AXC A;  1LT9 B;  1A02 F;  5EFW B;  1N86 B;  1RF1 C;  2MKV A;  3TNU B;  3ITK A;  3MGN A;  1N73 B;  1X0T A;  1TU3 F;  5B5E E;  2M0B A;  1LP1 B;  3M9H A;  1NTZ E;  4AUW A;  3F5H A;  1BDC A;  5TJH A;  1NTM K;  2QJK C;  3PJS K;  1KFM A;  3H1L D;  3RK3 C;  3AEG C;  4D6T D;  3M0A A;  5APY A;  5BU5 A;  4BRY A;  2XKM A;  1PP9 G;  1OWA A;  2ZJS E;  4XA4 A;  3L70 E;  2XV5 A;  4I1L A;  2QEX P;  4UB6 H;  1R8E A;  3SSU A;  4LC1 A;  1CI6 A;  3CL3 D;  3N4X A;  1AQT A;  5H2F H;  5AVQ B;  5AVZ B;  3LW5 J;  3B71 A;  4EIJ A;  2CPS A;  4EI2 A;  2IFN A;  2FYZ A;  1KIL B;  4H0L D;  3IN6 A;  1M1J A;  2YIU B;  1GU4 A;  1FZF C;  1H0T A;  1P84 I;  2XNX B;  1AVO A;  3Q1M A;  2J3F A;  1LWU B;  3H1H G;  1KD1 Q;  1GK6 A;  2QJY C;  3CI9 A;  1RY3 A;  4H13 B;  1YBK A;  2NPS B;  1PP9 J;  1QGK B;  1M7L A;  2H8P D;  2V7Q H;  1RF1 A;  4IFD K;  1Z56 A;  1U57 A;  1VF5 C;  5TIS E;  2KP8 A;  1VQ9 P;  2O1J A;  2LR2 A;  2G3A A;  3V5B A; 
#chains in the Genus database with same CATH homology
 1JTH A;  5BU8 B;  3V4W A;  1NKN A;  2Z4E C;  3VOP A;  3RL0 C;  1HGZ A;  4W7Y A;  2YKQ A;  3MIW A;  2XNX A;  1FDM A;  2A45 G;  5CCG C;  3P8C E;  1RE3 B;  1LWU A;  4AYC A;  2Q9I A;  2J0Y A;  1FZF B;  3GHG B;  1NTK K;  3M9B A;  4ZFG A;  2J58 A;  4GIF A;  3HD7 C;  2GUV A;  3H32 C;  3I5C A;  2ZXE B;  3E1I C;  1QL1 A;  2NPS A;  3U59 A;  1W2E A;  2OYI B;  4GT1 A;  1HJB A;  2HPC C;  2W6A A;  3HUS A;  1IFJ A;  1LTB C;  4LLH A;  2CPB A;  2QM8 A;  3L35 A;  1N7S D;  1LTT C;  1HUC A;  3L4F A;  4HYT B;  4WY4 C;  5AW5 B;  4JZC A;  1L4A A;  3M91 A;  3TSI A;  2JHL F;  3A3Y B;  1FZC A;  2J0H A;  1GL2 A;  4C7R A;  1FZG B;  2OYH C;  1J1D C;  3VMX A;  2J3U A;  1URQ A;  4M7F A;  2FFD A;  1FU1 A;  1QL2 A;  2Z5H A;  3B5N C;  1GK4 A;  2O1K A;  2R5D A;  1HTL C;  5AVV B;  2HG5 D;  3BRV B;  3RK3 D;  2JHI F;  1L4A C;  1SLQ A;  2WPR A;  1RE3 A;  1MFZ A;  5BVZ A;  4M7H A;  1ZV8 A;  1JMM A;  1LTJ C;  2Z4E B;  1FZF A;  3GHG A;  3RL0 B;  5CJ4 A;  2C9N Y;  3BAT A;  4W7Z A;  1CZQ A;  1FAV A;  1NH4 A;  4AQR D;  1CW5 A;  5AVT B;  1ZLL A;  3VYI A;  1T2K D;  2HYN A;  3HD7 B;  3H32 B;  3E1I B;  1KFN A;  1L0L K;  4LGD E;  1FZE A;  1JY3 P;  5AW3 B;  1JTH B;  4Y99 C;  1JCC A;  2HPC B;  5KJ7 C;  2FYU K;  2HLO C;  1J2J B;  3II6 A;  3M0D A;  1NKZ B;  4WY4 B;  1J1E C;  3M9Q A;  1SFC C;  2Q3I A;  1JY3 N;  3EQ2 A;  2WSE H;  2IFM A;  5APV A;  1CSB A;  3OA7 A;  2JJL A;  1JY3 O;  1WT6 A;  3N7N A;  1MZ9 A;  3U1C A;  3HRN A;  3P7K A;  4M3L A;  4OH8 B;  3T97 A;  1J1D B;  3WMM 0;  2OYH B;  2J61 B;  3LW5 H;  1MUU A;  1FIC A;  3NTN A;  3P8M C;  2HOD A;  1DEB A;  3NXS A;  4N78 D;  2JEE A;  3TYY A;  2J3G A;  3HUS B;  3VMZ A;  5APT A;  2N9B A;  2JHH C;  2FXM A;  2I1J A;  3RK2 C;  2Z4E A;  3VN0 A;  2WZ7 A;  4EPU A;  3HE5 B;  1AFO A;  2O01 H;  2I1K A;  1L4A B;  2P1J A;  4RES B;  5CCG A;  1GDT A;  3VP8 A;  1FZC B;  3MUD A;  3VTP C;  3KPE A;  2WSF H;  1MV8 A;  5APU A;  1LTJ B;  5AW1 B;  5APS A;  1FZB C;  3KQG A;  4KHX A;  1SVF A;  1RF0 C;  4JYO X;  3HD7 A;  3H32 A;  1ZR4 A;  1URQ B;  1HH0 A;  2J64 A;  4N6J A;  1NU1 K;  3KYQ A;  2HPC A;  2WPQ A;  1T3U A;  1NO4 A;  3HTK A;  3SWF A;  1GD2 E;  4R9T A;  2LKM A;  4WY4 A;  1JUN A;  3NFQ A;  4Y99 B;  4W80 A;  2Z5I A;  1X9V A;  1IFI A;  5APX A;  2HLO B;  1SQQ K;  2M8R A;  3MTU E;  2OYH A;  3RL0 D;  1J1E B;  1SFC B;  2WIT A;  2J61 A;  3V2P A;  2E42 A;  5CCG D;  2C9L Y;  1OXZ A;  3R2P A;  2ZFC A;  3B5N A;  3O8Z A;  1GW3 A;  1IFD A;  1FZA C;  4DOJ A;  2BAS A;  3HE5 A;  1FZE B;  1KIL D;  3HD7 D;  1DH3 A;  3V2Q A;  2E43 A;  2YO3 A;  1JOC A;  4XE5 B;  1N2D C;  1VDF A;  2WPS A;  1LTJ A;  3RK2 B;  3MD0 A;  1WRG A;  5KTB A;  5AVX B;  3M06 A;  1IFM A;  3VP9 A;  2PP6 A;  4JF7 A;  1FZB B;  2H43 C;  2N1T C;  3EFG A;  5APQ A;  1GTW A;  1RF0 B;  5CCH C;  2HOD B;  2NPS D;  5AW2 B;  4HH2 A;  1JY2 P;  3HE4 A;  3L37 A;  2KOG A;  2J0G A;  1T8Z A;  5KJ7 A;  2HLO A;  2J5Z A;  3BAS A;  2JHM F;  2Q5U A;  2OAR A;  3P8C D;  1SFC A;  2IPP A;  1JY2 N;  4I6M C;  1N86 A;  1L4A D;  4JYC A;  1JNM A;  1GL2 D;  3U1A A;  2WT7 B;  1JY2 O;  3TNU A;  2J59 M;  1LGH B;  1JO5 A;  5KLV K;  4I2L C;  2Q7C A;  1URQ D;  4R9J A;  5AW7 B;  2KSJ A;  3HTK B;  3IFM A;  1LT9 C;  5AW8 B;  1S9K E;  1H89 A;  2FIB A;  1G2C B;  1N86 C;  2HFE D;  2KYV A;  1LTI C;  3H6P A;  2FKW B;  1N73 C;  4B86 A;  1FZB A;  1FJK A;  5CMZ A;  2R32 A;  5KJ7 D;  4ZKU A;  1RF0 A;  5AW9 B;  2A45 H;  1NAF A;  2JHK F;  1KZU B;  3B5N B;  2POH A;  1GZL A;  2H43 B;  2N1T B;  2W27 A;  1Z3S A;  1SQB K;  4O9B A;  2OYI C;  1HWT C;  1Z3U A;  1G1J A;  1X79 B;  3KDP B;  1FZD A;  3A5T A;  1FBM A;  2GUS A;  5AVW B;  1LTA C;  2C0X A;  1X8Y A;  1NTZ K;  2WT7 A;  1HVV A;  1N7L A;  2W6B A;  1FOS E;  1M1J C;  3RK2 D;  1YTZ T;  5CJ0 A;  3BVH A;  2R3C A;  3B8E B;  1IJD B;  3IR9 A;  4IFM A;  4GKG A;  4N3Y B;  1FZA A;  5APW A;  4C7N B;  2P67 A;  3PP5 A;  1G2C A;  3P32 A;  3HE4 B;  4C46 A;  4ZKP A;  3G3Z A;  4WB4 A;  1N7S A;  1LT9 B;  1A02 F;  1FIB A;  4JYB A;  3BVH C;  1NWQ A;  1N86 B;  1GU5 A;  1RF1 C;  1YTZ I;  5AVS B;  1RE4 C;  2PAJ A;  3TNU B;  3MGN A;  1N73 B;  1FOS F;  2H43 A;  2N1T A;  5CCH A;  1CI6 B;  3LIE A;  2J2P A;  1N7S C;  2QM7 A;  1KIL C;  1IK9 A;  1LTG C;  2P7J A;  3M9H A;  4WY4 D;  4AUW A;  1NHL A;  4NYT A;  2XDJ A;  1DX7 A;  5AVY B;  2XNX C;  2YO2 A;  3L36 A;  5CHX A;  1NTM K;  2YMY A;  1M1J B;  1SP4 A;  1LWU C;  3SWY A;  1ZN5 A;  2J60 A;  4C7N A;  2Q9I C;  3VMY A;  1YYC A;  1H8A A;  1KFM A;  1XTG B;  2IX7 C;  3RK3 C;  3V2R A;  2XU6 A;  2KB7 P;  3M0A A;  5APY A;  3B5N D;  5BU5 A;  1LTS C;  2NPS C;  3NMD A;  2KLV A;  2XKM A;  1LT9 A;  2C0W A;  2N1T D;  3A7O A;  2GM4 A;  4N78 E;  5AW6 B;  1XTC C;  1OWA A;  2WSC H;  2YKP A;  2YNY A;  3HUS C;  5CCH D;  4XA4 A;  1H88 A;  1JC9 A;  2R5B A;  2XV5 A;  2XZR A;  4I1L A;  3OJA B;  2J1G A;  1N73 A;  3LID A;  2GY7 A;  3BVH B;  1FZC C;  1E5W A;  1T2K C;  4LC1 A;  2MJZ A;  1GL2 C;  1CI6 A;  3CL3 D;  3N4X A;  1RF1 B;  1RE4 B;  2L5G B;  5AVQ B;  5AVZ B;  1FZA B;  2H7H A;  1VPC A;  1URQ C;  1A02 J;  3UIA A;  2FFD C;  2M3B A;  4EIJ A;  1AQ5 A;  5AVU B;  2OYI A;  1ZR2 A;  2J3O A;  2CPS A;  2IFN A;  1N7S B;  2FYZ A;  1KIL B;  1T3J A;  1EQ7 A;  3CLQ A;  1PFI A;  1M1J A;  1RE3 C;  1SQX K;  1GU4 A;  1HGV A;  2YKO A;  1SFC D;  1FZF C;  3V4Q A;  3GHG C;  4IFF A;  2WTY A;  1FZG A;  2XNX B;  2J3F A;  3OAK A;  1IO4 A;  1LWU B;  1SQP K;  1L0N K;  2Q9I B;  1IFN A;  1SQV K;  5AVR B;  2A45 I;  3C9I A;  1GK6 A;  3RK3 B;  3CI9 A;  1RY3 A;  4EOT A;  1G1I A;  2NPS B;  1FZE C;  2VRS A;  3TK1 A;  2WWW A;  1M7L A;  5AW4 B;  2H8P D;  3A2A A;  4WBA A;  1FZG C;  1IC2 A;  4DZO A;  1RF1 A;  1RE4 A;  3V2N A;  3M0D C;  4IFD K;  1Z56 A;  3FIB A;  2P2U A;  1JCD A;  1FID A;  2KP8 A;  1GL2 B;  1NOH A;  1KQL A;  3BRT B;  1KIL A;  1S9K D;  2WNP F;  2O1J A;  1GW4 A;  3E1I A;  5AW0 B;  1FJP A;  2FFD B;  2HOD C;  2J3F D;  3V5B A;  2D39 A;  1HBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...