1M1JC

Crystal structure of native chicken fibrinogen with two different bound ligands
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
390
structure length
390
Chain Sequence
TRENCCILDERFGSYCPTTCGIADFFNKYRLTTDGELLEIEGLLQQATNSTGSIEYLIQHIKTIYPSEKQTLPQSIEQLTQKSKKIIEEIIRYENTILAHENTIQQLTDMHIMNSNKITQLKQKIAQLESHCQEPCKDTAEIQETTGRDCQDIANKGARKSGLYFIKPQKAKQSFLVYCEIDTYGNGWTVLQRRLDGSEDFRRNWVQYKEGFGHLSPDDTTEFWLGNEKIHLITTQSTLPYALRIELEDWSGKKGTADYAVFKVGTEEDKYRLTYAYFIGGEAGDAFDGFNFGDDPSDKSYTYHNGMRFSTFDNDNDNFEGNCAEQDGSGWWMNRCHAGHLNGPYYIGGVYSRDTGTNSYDNGIIWATWRDRWYSMKKTTMKIIPFNRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha subunit
publication title Crystal Structure of Native Chicken Fibrinogen at 2.7 A Resolution
pubmed doi rcsb
molecule tags Blood clotting
total genus 125
structure length 390
sequence length 390
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
C PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m1jC03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1m1jC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1m1jC02
1LWUC 3BVHB 1JC9A 3E1IA 3GHGC 2JHMF 1JY3O 2J0YA 1FZEA 1FZBA 3H32C 3HUSA 1FZGC 2J3GA 2JHKF 2Q9IC 2FFDB 2HPCA 1LTJC 2HODC 2OYIB 2XNXA 2OYHC 1JY2N 1FZBB 1FZEB 3HUSB 1FZAB 2HLOC 2JHIF 2J3FA 4R9JA 1LT9A 2H43A 1N73A 2A45H 2J0HA 1RE3A 1M1JC 1N86A 4R9TA 1LWUA 3GHGA 2J2PA 2GY7A 1LT9B 2Z4EC 2JHLF 2J3FD 1N73B 2H43B 3BVHC 1RF0A 3E1IB 1RE3B 2Q9IA 2A45I 1N86B 1JY2O 1RE4A 2FIBA 3FIBA 4JZCA 2FFDC 1RF0B 1FZCA 2HPCB 2OYIC 1FZEC 1FZBC 1Z3UA 2XNXB 3HUSC 4NYTA 1JY3P 1FZAC 1FZFA 1RE4B 1FIDA 2J5ZA 1RF1C 1FZDA 2J64A 1FZCB 4M7FA 2J3UA 2J3OA 4ZFGA 3H32A 1FZFB 1FZGA 4M7HA 1LWUB 2HODA 1LTJA 1FICA 3GHGB 1LT9C 1N73C 2J60A 2OYHA 3H32B 3E1IC 1RE3C 2HLOA 1FZGB 2A45G 1N86C 2Q9IB 2WNPF 2HODB 1LTJB 2OYIA 2J0GA 1JY3N 1FZAA 1RF0C 2OYHB 1T3UA 2HPCC 2J61A 2HLOB 1M1JA 1RF1A 2XNXC 1FIBA 1RE4C 1JY2P 1Z3SA 1W2EA 2Z4EA 3BVHA 1FZCC 4EPUA 2D39A 2J61B 1M1JB 2J1GA 1RF1B 4JYOX 2H43C 1FZFC 2Z4EB 2JHHC 2FFDA
chains in the Genus database with same CATH superfamily
1AQ5A 2M3BA 3OW2O 3GW6A 3KQGA 3H32C 3B5ND 3CI9A 4AUWA 2JHKF 1Y9BA 1AFOA 5CBNA 3JCUE 1DX7A 1X0TA 2POHA 2P67A 4N6JA 1NTZE 1WT6A 1ZLLA 1Q81Q 4NPFX 2JR8A 3VP8A 1SQXK 1QL1A 2J58A 3C9IA 4N78E 5K5GB 1QEXA 2Z4EC 4IL6H 4K3AA 2Q3IA 1SQVG 3E1IB 1NU1E 1RE4A 2YXQB 2YIUC 1PPJD 1L0ND 4HJGH 1SQBJ 1EDLA 5KAFH 1RE4B 2W90A 1GL2D 1NKNA 3RK2D 1NGMB 1FZDA 1J1EB 2XV5A 1YQ4C 2K9YA 2WTYA 2WSEJ 3L75D 1HH0A 1SQXE 2OGUA 3MP7B 3G6EP 5KJ7A 2J61A 2B88A 1SQPD 3PH0A 2WSEH 3MIWA 4H0LD 2J61B 3IN6A 1URQA 5CCGD 1AV1A 2QEXP 1JC9A 5KLIC 3VMXA 1IO4A 1FZBA 2G8YA 2E74B 2KNCA 1URQB 3VMZA 3H1LG 1PGPA 2IDBA 3CXHD 1LTJC 3AEBC 2HPCA 4U3FJ 1FZBB 3H1IE 5APVA 2E43A 3MZWB 1KILC 1NTKD 3H6PA 2IBZG 5DJTB 2H43A 2A45H 3MHVA 1VQ6P 1N86A 2XU6A 2GM4A 4C46A 4Y28J 4DJGA 1L0LK 2H43B 3RL0D 1OZHA 1BGYE 1N86B 3A0HE 2O1JA 3P32A 3H1HG 2FIBA 1FDMA 4GODA 1ZR4A 1QVFO 1NTZJ 1X8YA 1G2CA 5L8RJ 3ITKA 3AEFC 2P1JA 3RBZA 1ZV8A 1G2CB 4ZFGA 3JCUH 1S1CX 3TYYA 2R3CA 3SFDC 4L74A 1NTMD 5CHXA 3WMM0 1T6AA 1NU1J 1PGQA 2RN0A 2W83C 3G9RA 1RE3C 3CX5I 3BATA 3HD7A 2FYNB 3AE1C 1OIPA 3AE4C 1FZAA 1FBMA 3GG2A 1T3UA 1SS1A 3CL3D 3Q5RA 1T2KD 1MFTA 1OW8A 3HD7B 1JY2P 3AE2C 3RK3D 2IBZI 2QM8A 2M3EA 2Y0DA 3P7KA 4EPUA 1NAYA 1PPJG 1L0NG 1FZFC 5KLVK 1M1KQ 3D6YA 1GW4A 3Q5SA 1SQXJ 2AEMA 5KAIH 1K73Q 2K88A 1FZGC 3OJAB 3I55P 2KZJA 2OTJP 1PGOA 3L73E 2E75B 2XNDH 3L75G 2HLOC 3H1HE 3PRJA 1LT9A 1A02F 1KQSO 3I5CA 1IFJA 1ZRTE 2YKQA 2Y0EA 3A3YB 1FC2C 5APXA 1SQPG 1LT9B 3AE3C 4AQRD 3FWNA 2FKWB 3BASA 5KLVE 1JMBA 5TJHA 2LXBA 3H1IJ 4D6TE 1NAFA 1GU5A 1KB9E 2OTLP 1SQPK 2B87A 4M7HA 2R32A 1MKMA 3FGAD 1R8EA 1BGYJ 1NTKG 3KYQA 1MZ9A 2IFNA 4JPZB 2A06E 3FXDA 3CC7P 1LP1B 4I7ZB 1FIBA 3L70D 3L71E 3A0HH 3BVHA 2DW3A 2Q1KA 4B86A 2J1GA 1D7MA 1NTKK 1VQ8P 2KIKA 3BVHB 3W68A 4W80A 1FZEA 3HUSA 3Q1MA 1S9KD 2G3AA 1SQPE 3BCCE 5AW2B 3P8MC 1NTMG 1L0LJ 1FZEB 2WPSA 3HUSB 2JHIF 4R9JA 2I1KA 1Q82Q 4OVNF 3CXHI 3M9HA 2AEFA 1QGKB 1BSHA 1HVVA 2JHLF 2AXTE 3CXHE 3O8ZA 1Q7YQ 1CZQA 1VQ4P 1G1JA 3U1AA 4BWNA 1K9MQ 1JCDA 3L73J 2Z5HA 1NTKE 4H44D 3LIEA 3V5BA 3TDKA 1OVUA 3B5NC 4Z1MH 4WWIA 3G71P 1LWUB 2QSIA 2RKLA 2J60A 2BCCD 1BCCD 1IFDA 4OWFA 1VPCA 5APSA 3CCEP 3A2AA 5KLVJ 1USEA 4WY4D 1JY3N 1M57D 4OGQB 2W6AA 5APYA 3H25A 2QJYB 4D6TJ 2M5AA 2H8PD 5AVZB 2GUVA 1KFMA 1T8ZA 3CCJP 2M5AB 2FFDA 2FYUD 1FOSE 3MTUE 3CWBD 1N7SD 4IFFA 2P7JA 1KB9H 3AE6C 1KTMA 2Q9IC 3TSIA 2FFDB 1GL2C 3RK2C 3G3ZA 2N1TD 1IFNA 3H1KD 4UB6E 2WPQA 1IK9A 3L71J 1JUNA 3L74E 1LNQA 1VQOP 2K9JA 5CCHD 2WSFJ 2HR3A 1LTAC 2BASA 1U7JA 2ZYGA 3MD0A 5KAFE 1AJYA 1H8AA 4ASWA 2K9JB 1S72P 1VQ9P 2PRRA 3L70G 4L73A 4L76A 1IC2A 1JY2O 4K35A 1SQPJ 2ZJSE 3BCCJ 3FIBA 2Y9YA 4H0LC 2OYIC 1Z3UA 5CCGC 1HJ0A 4O9BA 1X22A 1QL2A 3JC22 2YXRB 2D2CD 1N73C 2JO1A 2WSCJ 2ITAA 1S4XA 2Y9ZA 2WNPF 3U59A 4M3LA 1NTKJ 1DD4A 3H1JD 2AXTH 3CXHH 3VMYA 4EIJA 4GT1A 4GIFA 4WVZA 3RL0C 3D71A 4AYCA 2WSSH 3K5BA 2CPBA 3GHGC 2JDIH 3I56P 1AA0A 4CPGA 1AVOA 3SWYA 4HKZH 1PP9D 1Z56A 2E76B 1PZQA 1RH5B 3AEDC 2QRXA 3AE5C 1NOHA 1KILE 2BCCG 1BCCG 2Q6QA 2YKOA 1PGJA 4JBZA 2WWWA 4C7NA 2J3FD 1RY3A 1WMKA 1RF0A 4C7NB 3UIAA 1T2KC 3AEGC 5AW3B 3RK3C 3AEEC 1RF0B 1FJKA 2FYUG 3L72E 4RJTA 3CWBG 3L74J 1L4AA 2ZT9B 3H1KG 3SWFA 2WVRA 2ZYDA 4UB6H 1YQ3C 2IYOA 2L91A 1L4AB 1IFIA 2FYUK 1UIIA 2KLUA 2KS1A 1MUUA 2O01J 1RQUA 5KAIE 1N8RQ 1M1JA 1PV3A 2E74D 3TK1A 1URQD 2KS1B 1VF5B 3BRVB 1SQVK 1YBKA 4WBAA 1HTLC 1M1JB 2RH0A 4LGDE 2O01H 1EDKA 2FBWC 2W6JH 2YMKA 2O1KA 3F89A 2WQYC 2KSEA 2J3GA 2JWDA 1SFCC 2ZVOB 2E42A 5B66E 4EYYQ 1OMIA 3CCRP 1MFZA 2QE7H 4PV1D 5B5EE 3G4SP 2FYUE 1DIPA 1EZVD 4PJ0E 3CWBE 2QJPC 3H1JG 1N2DC 1YITP 2GY7A 3TGUD 2N9BA 2Q9IA 3H1KE 1KYOD 1GL2A 1SQVE 3JSVC 3GF7A 2KNCB 4ZMDA 2AEJA 3C1LA 2JKVA 5AVQB 1FZCA 2HPCB 2CPSA 3D70A 3M0DC 3V2QA 3B4SA 3HE5A 2KK7A 2J64A 1PP9G 1FZCB 1CI6A 3CD6P 3CMEP 3AE7C 2QM7A 3HE5B 1R5LA 2I1JA 4Y99B 1NH4A 1X79B 3HTKA 1CI6B 3P8CD 2WZ7A 1S5LE 2XKMA 4ZKPA 2OYIA 3HTKB 4HH2A 1IFMA 2H7HA 3L72J 2QJKB 2KZIA 2XNXC 3R4YA 2AXCA 5KKZC 1JO5A 2E75D 1GK6A 3MUDC 1XTGB 2KXPB 4H44C 1HUCA 2Q5UA 2PFXA 5BVZA 4IL6X 5E79E 1KD1Q 1HWTC 3CX5E 4RESB 2HODC 3H1LE 3S1KA 2OYHC 1FZAB 1NVOA 1SQQD 1TU3F 3USSA 3AE9C 2FXMA 2IBZE 2KP8A 4EDFA 3GHGA 2NPSA 4H13B 2I8DA 4WY4C 4KHXA 3F5HA 4GOEA 2B89A 3VP9A 1J1DC 4JZCA 1VQMP 2NPSB 1DEBA 1L0NK 5H2FE 1JM0A 1YJWP 1RF1C 2FYUJ 3CWBJ 1FAVA 3SFEC 3H32A 1N7SC 5B66H 2VRSA 1ZP0C 1GZLA 1FICA 2N1TC 3N4XA 3H1KJ 5B5EH 1SQVJ 3H32B 1LTSC 1EZVG 1LTIC 3EQ2A 1Q86Q 3TF5A 4PJ0H 1MV8A 1QVGO 5CCHC 3S4RA 1SFCD 3TGUG 1GDTA 2Z4EA 3NMDA 5CBOA 2C9NY 3WUTA 2P58A 1PPJE 1L0NE 2B87B 2Z4EB 4YXWH 1ZOYC 1K05A 5APUA 2OTKE 1E5WA 3B71A 1EDIA 4PD4D 1NHLA 1H89A 3VMAA 2YIUB 1LGHB 3SWKA 1LTTC 1IJDB 1QLED 3L75E 3CCVP 1DD3A 2D2CC 1VQ7P 1EXIA 3GLMA 1S5LH 2J0HA 2CK3H 3IR9A 1VDFA 4U3FD 2OARA 3VOPA 1EXJA 1EZVI 4DCKA 1YTZT 3H1LJ 2NZ2A 1FOSF 1PFIA 1KYOI 3A5TA 2QVAA 5E79H 1BDCA 3CX5H 4EI2A 1T3JA 2J3OA 1Q90D 1FDOA 3TGUE 1M56D 4OGQD 1WRGA 3ABVC 1LTJA 1NTZD 1NTMK 1ZN5A 3E7KA 3M06A 5KLIB 1SQQG 5AVUB 3E1IC 5M1BA 1LTJB 3H1HJ 4N78D 1KILA 1GK4A 3M0DA 2R5BA 4I2LC 4EOTA 2LKMA 3V4QA 4A7PA 2K37A 1RE4C 1OW6A 1NU1D 1KILB 1W2EA 2MKVA 3Q3DA 1J1EC 3L36A 1SQQK 3P8CE 4JF7A 2JWAA 5H2FH 3T97A 2JHHC 1KQFB 1HBWA 3OA7A 3SSUA 1VL2A 1M90Q 1W5CE 1G1IA 3T97B 1IZNB 4RO0A 2XNXA 1NTME 1X9VA 1XTCC 1SQXD 3KHUA 3CCUP 1LT1A 5AW6B 4DOJA 1LJ2A 1RE3A 1L0NJ 4IFMA 1YIJP 3CCLP 1RE3B 3RK3E 1KC8Q 2E74C 1URQC 5AW5B 1KZUB 1SQQE 5EFWB 2LXCB 1FZBC 4RKUJ 3L75J 1JY3P 1FZFA 4NPEA 3RGUA 3CCSP 4KJMA 1FZFB 1FZGA 1FU1A 1JTHA 3BRTB 1E79H 3H1ID 3HE4A 1JOCA 3NFQA 2HLOA 1FZGB 2A45G 1N86C 4PV1C 1GU4A 1JTHB 2J0GA 4U3FG 3HE4B 2BEZF 2HLOB 2JJLA 1RQVA 1RF1A 3GMAA 1BGYD 2E76D 4QMAA 1OX3A 1RF1B 2IYPA 1GTWA 1ZR2A 2N1TA 3CPWO 1H0TA 2RMZA 3RL0g 5GTIE 3TNUA 5CCHA 2GA1A 4ZNCA 2FYNC 1H0TB 3V2RA 1KYOH 1L2PA 1LTGC 1NO4A 1NTZG 4BRYA 2BEQD 2FYZA 4PD4I 2OQQA 2GUSA 2H89C 3M0AA 3PHLA 4BRYB 2LR2A 2YO2A 4R9TA 1IFPA 1L0LD 4IFDK 1ZXGA 1NU1G 2KUBA 1NJIQ 1JNMA 2WT7A 1VQ5P 3L70E 2A45I 2ZT9D 3S9OA 3R2PA 1Y8AA 1NTMJ 2WT7B 2E75C 5BU8B 1FIDA 3NTNA 1S9KE 1BE3D 4M7FA 1K04A 4UB8H 1HGZA 3L73D 3CCMP 1AQTA 5DJUB 1KV4A 1P84D 1VF5D 1LT9C 2YO3A 1SQXG 5AVSB 5GTHH 3E1RA 1RHZB 1ZRTD 1SQQJ 1KN7A 3LW5J 1ZW0A 3A0BE 2ZFCA 1USDA 5KJ7D 5AVXB 4TLFA 5KLVD 3II6A 1K8AQ 1CW5A 4KT0J 3E1IA 1SVFA 2YKPA 2J0YA 4D6TD 3M9BA 3CCQP 3WUVA 3C8VA 3LW5H 1KB9D 3KZIE 1OFCX 3H1IG 5AVWB 3B5NA 4I7ZC 2J3FA 2BCCE 1BCCE 1JMMA 3V6IA 3B5NB 2A06D 1SLQA 2KOGA 2W27A 3BVHC 1BGYG 3L71D 4I6MC 4N3YB 1PIXA 1VQLP 1AVYA 1FZEC 5AVYB 2E5TA 3HUSC 3WUUA 3WU2H 1FDIA 5GTIH 3Q2YA 2J3UA 3BCCD 1SP4A 1S3JA 4HYTB 2Q7CA 4ASVA 3L70J 3L4FA 3D6ZA 1VQKP 2Q9IB 1GL2B 3RK2B 2W8ZA 1VQPP 1L0LG 5CMZA 4PD4H 1EDJA 1EQ7A 1FE6A 3HD7D 3N7NA 3IFMA 4YTPC 4YXDC 1LWUC 2QA4P 2K3RA 2Y0CA 1JY3O 1BE3G 5CCGA 3L73G 4H0LB 2C9LY 5AW9B 2OYIB 4PV1B 4H13D 3RBXA 2P10A 1EC5A 3HRNA 1JY2N 4OGQC 3Q5PA 2M0BA 2WMMA 3QH9A 5CJ0A 3CMAP 2QJYC 1YTZI 1KMIZ 3KDPB 2NPSD 2SPZA 1N73A 1KQGB 1LTBC 3KXDA 3H1JE 1N73B 1KORA 4I1LA 4NPDA 3A0BH 5TISE 5KLVG 2FFDC 3QWOC 1GD2E 5APTA 3B8EB 4JYBA 4XE5B 2BCCJ 4D6TG 1BCCJ 2KYVA 1YYCA 1L0LE 1R5SA 3RL0B 5AVVB 4TT3H 1PP9E 1JCCA 3AECC 3KZIH 2ZAEB 1GMJA 1OVRA 3V2PA 3VN0A 3GHGB 2O3JA 3L74D 1YI2P 3IF4A 2ZYAA 2A06G 1S2EA 1P84I 5AVTB 4JYCA 1BE3E 1OWAA 2P2UA 2W6BA 1YHQP 2J5UA 1GW3A 3L71G 4XA4A 4JQ0D 1NYHA 1P84E 1BDDA 2JEEA 2KLVA 4DT0A 1M7LA 5AW0B 4GOFA 1SQBD 2QIWA 1DEEG 2JHMF 3BCCG 3RK3B 2XDJA 1OW7A 5AW4B 5AW8B 2V4HA 1KB9I 3EFGA 1FJPA 2OYOA 2C0WA 4OH8B 3AEAC 3ZDMA 2J2PA 2IZ0A 3IAOA 5BU5A 2Z5IA 2V7QJ 4XFJA 1OXZA 1NKZB 2E76C 1KQLA 2PGDA 1LP1A 4GDOA 3GF3A 2KSJA 1FS0E 2IFMA 2V7QH 2XZRA 1BSNA 1HF9A 2ZXEB 3H1JJ 1YJNP 3PP5A 1KILD 4DZOA 2WPVB 1SFCA 2JP3A 1IK7A 2HFED 1J2JB 1VQNP 4R4LA 5KTBA 3FWLA 1EZVE 4YPCA 2K1AA 1N7LA 1SFCB 2M8RA 1RF0C 3PTZA 2O01N 4MN4C 1NWQA 2E5YA 1KYOE 3PLNA 1PP9J 2PAJA 5TISH 2D39A 2ZT9C 2QJPB 2KB7P 3CC4P 2YMYA 3L72D 1L4AC 5APQA 1BE3J 4HB1A 3EWKA 2MJZA 2R5DA 4C7RA 5APWA 3L74G 1VF5C 1M8OB 3OAKA 1PL5A 1M1JC 2PP6A 1LWUA 2IZ1A 2WPRA 2IPPA 4UB8E 4U7JA 1P84H 1Y47A 2R3SA 1SQBG 5KJ7C 2XNXB 5GTHE 1CSBA 4R4MA 5C39A 5KKZB 3MUDA 3U1CA 3O6QA 2HODA 1OVVA 4H44B 1SQBK 2OYHA 3O6QB 2Q3EA 2QG4A 2HODB 1Q2NA 3PJSK 2OYHB 2IX7C 2HPCC 1UIXA 4IL6E 2WITA 1Z3SA 1H88A 1JB0J 1SQVD 4WY4A 1FZCC 1HGVA 4JYOX 2H43C 3M9QA 1S5LX 4WY4B 4Y99C 3CC2P 3M91A 1KFNA 1J1DB 1W2BO 2FY8A 1U57A 1A02J 2KI7B 2QJKC 1N7SA 2C0XA 3V4WA 2H88C 2WSFH 3TGUJ 1SQBE 3VYIA 1ZMEC 4ZKUA 1N7SB 2UWJE 3WU2E 2N1TB 4W7YA 3NXSA 2ZXXA 1U7MA 1JEKA 1YJ9P 4IOIH 1HJBA 3TNUB 3HD7C 3L72G 3KPEA 4NYTA 1FZAC 2J5ZA 2R44A 3VTPC 3LIDA 4W7ZA 2ZVNB 1QX8A 3W67A 4PD4E 4LC1A 3CX5D 5AW7B 3H1LD 2WSCH 2N9YB 2FXOA 5CJ4A 2L5GB 5AW1B 1NTZK 2J59M 4H13C 4LLHA 3L37A 3AE8C 1L4AD 2IBZD 2FXPA 5AVRB 3EFFK 3L35A 2NPSC 3MGNA 2YNYA 3CLQA 4U3FE 2HG5D 3FX0A 4GKGA 2D2CB 1NU1K 2B9BA 2NRGA 4BXLA 3V2NA 3FXEA 3H1HD 1DH3A 3A7OA 4WB4A 4L75A 2HYNA
chains in the Genus database with same CATH topology
1AQ5A 1LWUC 2M3BA 1FOSE 1JY3O 3MTUE 5APUA 1E5WA 3KQGA 3H32C 1N7SD 3B5ND 4IFFA 2P7JA 3CI9A 5CCGA 4AUWA 1NHLA 1H89A 3TSIA 2JHKF 2FFDB 1AFOA 1GL2C 2Q9IC 3RK2C 3G3ZA 2C9LY 5AW9B 2N1TD 1LGHB 2OYIB 1DX7A 2POHA 2P67A 1IFNA 3HRNA 1JY2N 4N6JA 1LTTC 2WPQA 1IJDB 1IK9A 1WT6A 1ZLLA 5CJ0A 1JUNA 1YTZI 3KDPB 3VP8A 1SQXK 2NPSD 5CCHD 1N73A 1QL1A 2J58A 3C9IA 2J0HA 1LTBC 4N78E 1LTAC 2BASA 3MD0A 3IR9A 1VDFA 1H8AA 2OARA 2Z4EC 1N73B 2Q3IA 4I1LA 1IC2A 3VOPA 3E1IB 1JY2O 1RE4A 1YTZT 3FIBA 2FFDC 1FOSF 5APTA 1GD2E 1PFIA 3B8EB 4JYBA 4XE5B 2OYIC 1Z3UA 3A5TA 1RE4B 5CCGC 1GL2D 1NKNA 2KYVA 1YYCA 3RK2D 3RL0B 1FZDA 5AVVB 1T3JA 4O9BA 2J3OA 1JCCA 1J1EB 2FFDA 2XV5A 1WRGA 3V2PA 1QL2A 1LTJA 3VN0A 1NTMK 1ZN5A 3GHGB 3M06A 2WTYA 1N73C 1HH0A 5AVUB 3E1IC 2WNPF 3U59A 1LTJB 4N78D 4M3LA 1KILA 5KJ7A 5AVTB 1GK4A 3M0DA 2R5BA 4I2LC 4JYCA 4EOTA 1OWAA 2P2UA 2J61A 2LKMA 2W6BA 3V4QA 3VMYA 1GW3A 4XA4A 2WSEH 1RE4C 4EIJA 1KILB 3MIWA 1W2EA 4GIFA 4GT1A 2JEEA 3RL0C 2KLVA 1M7LA 5AW0B 2J61B 4AYCA 1J1EC 3L36A 1SQQK 1URQA 3P8CE 4JF7A 5CCGD 3T97A 2CPBA 2JHHC 1JC9A 1HBWA 3OA7A 3GHGC 2JHMF 3VMXA 1IO4A 1FZBA 1URQB 3VMZA 3SWYA 1G1IA 1Z56A 3RK3B 2XDJA 2HPCA 1LTJC 2XNXA 1FZBB 5AW4B 1NOHA 5AW8B 5APVA 1X9VA 2E43A 1XTCC 1KILC 3H6PA 3EFGA 2H43A 1FJPA 2A45H 2YKOA 2C0WA 5AW6B 4DOJA 2WWWA 1RE3A 4C7NA 1N86A 2XU6A 4OH8B 4IFMA 4C46A 2GM4A 2J2PA 1L0LK 2J3FD 2H43B 1RY3A 3RL0D 1RF0A 5BU5A 2Z5IA 1RE3B 4C7NB 3UIAA 1T2KC 1N86B 2O1JA 3P32A 1URQC 1OXZA 2FIBA 1NKZB 5AW5B 1FDMA 1KQLA 5AW3B 3RK3C 1KZUB 1ZR4A 1RF0B 1FJKA 2KSJA 1X8YA 1FZBC 1G2CA 1JY3P 1FZFA 2IFMA 2P1JA 2XZRA 1L4AA 1ZV8A 1G2CB 4ZFGA 1FZFB 1FZGA 1FU1A 2ZXEB 3TYYA 2R3CA 3SWFA 3PP5A 1JTHA 3BRTB 1KILD 4DZOA 1SFCA 5CHXA 1L4AB 3WMM0 3HE4A 1JOCA 2HFED 3NFQA 1RE3C 2HLOA 1IFIA 1FZGB 2A45G 1N86C 1J2JB 2FYUK 3BATA 3HD7A 1GU4A 5KTBA 1JTHB 2J0GA 1MUUA 1N7LA 1SFCB 2M8RA 3HE4B 1FZAA 1RF0C 1FBMA 1T3UA 3CL3D 2JJLA 1M1JA 1T2KD 2HLOB 1NWQA 1RF1A 3HD7B 3TK1A 1URQD 1JY2P 3RK3D 2QM8A 3BRVB 1SQVK 4WBAA 3P7KA 2PAJA 4EPUA 2D39A 1HTLC 1M1JB 1RF1B 1GTWA 4LGDE 1ZR2A 2O01H 1FZFC 5KLVK 2KB7P 2N1TA 2YMYA 1GW4A 2O1KA 1L4AC 5APQA 3TNUA 1FZGC 5CCHA 2J3GA 3OJAB 3V2RA 1LTGC 1SFCC 1NO4A 2E42A 2MJZA 2R5DA 4C7RA 2HLOC 1MFZA 5APWA 2FYZA 2GUSA 1LT9A 1A02F 3OAKA 3M0AA 3I5CA 1IFJA 2YO2A 1M1JC 2YKQA 2PP6A 4R9TA 1LWUA 3A3YB 5APXA 4IFDK 1N2DC 2IPPA 2WPRA 2GY7A 1LT9B 1JNMA 2N9BA 2WT7A 2A45I 2Q9IA 1GL2A 3R2PA 4AQRD 2FKWB 3BASA 5AVQB 1FZCA 2HPCB 2WT7B 2CPSA 5KJ7C 2XNXB 3M0DC 1CSBA 5BU8B 3V2QA 1FIDA 3HE5A 3NTNA 3MUDA 2J64A 1NAFA 1GU5A 1S9KE 1FZCB 4M7FA 1CI6A 3U1CA 1SQPK 1HGZA 2QM7A 4M7HA 3HE5B 2R32A 2HODA 2I1JA 4Y99B 1NH4A 1X79B 1LT9C 3HTKA 1CI6B 2YO3A 1SQBK 2OYHA 5AVSB 3KYQA 3P8CD 2WZ7A 1MZ9A 2HODB 2XKMA 4ZKPA 2IFNA 2OYIA 3HTKB 4HH2A 1IFMA 2H7HA 2OYHB 2IX7C 2HPCC 2XNXC 2WITA 1FIBA 1Z3SA 1H88A 4WY4A 3BVHA 1JO5A 1FZCC 2ZFCA 1HGVA 4B86A 2J1GA 5KJ7D 5AVXB 4JYOX 2H43C 3M9QA 3II6A 1CW5A 1NTKK 1GK6A 4WY4B 3BVHB 1XTGB 3E1IA 4Y99C 1SVFA 2YKPA 4W80A 2J0YA 1HUCA 2Q5UA 1FZEA 3M9BA 3HUSA 5BVZA 1S9KD 3LW5H 3M91A 1KFNA 1J1DB 1HWTC 5AW2B 4RESB 2HODC 1A02J 3P8MC 2OYHC 1FZEB 5AVWB 2WPSA 3HUSB 1N7SA 2C0XA 3B5NA 3V4WA 1FZAB 2JHIF 2WSFH 2J3FA 3VYIA 1JMMA 4R9JA 2I1KA 4ZKUA 2FXMA 1N7SB 3B5NB 2KP8A 1SLQA 3M9HA 2KOGA 3GHGA 1HVVA 2N1TB 2W27A 2NPSA 4WY4C 3O8ZA 2JHLF 3BVHC 4KHXA 1CZQA 4W7YA 3NXSA 4I6MC 1G1JA 3U1AA 4N3YB 3VP9A 1J1DC 1HJBA 1JCDA 3TNUB 4JZCA 2NPSB 1DEBA 2Z5HA 3HD7C 3KPEA 3LIEA 1L0NK 1FZEC 5AVYB 3HUSC 4NYTA 1FZAC 2J5ZA 1RF1C 3VTPC 3LIDA 4W7ZA 3V5BA 2J3UA 4LC1A 5AW7B 1FAVA 3H32A 1N7SC 3B5NC 1SP4A 2WSCH 2VRSA 5CJ4A 1LWUB 1GZLA 4HYTB 1FICA 2L5GB 2Q7CA 5AW1B 1NTZK 2N1TC 2J59M 3N4XA 2J60A 4LLHA 1IFDA 3L37A 3H32B 1LTSC 1VPCA 3L4FA 1L4AD 1LTIC 3EQ2A 5APSA 2Q9IB 1GL2B 3RK2B 5AVRB 3A2AA 1MV8A 3L35A 2NPSC 4WY4D 1JY3N 5CCHC 3MGNA 5CMZA 2YNYA 3CLQA 2W6AA 5APYA 2HG5D 1SFCD 4GKGA 1GDTA 1EQ7A 2Z4EA 1NU1K 2H8PD 5AVZB 3HD7D 2GUVA 3NMDA 1KFMA 3N7NA 3IFMA 1T8ZA 3V2NA 2C9NY 1DH3A 3A7OA 4WB4A 2Z4EB 2HYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWU C;  3BVH B;  1JC9 A;  3E1I A;  3GHG C;  2JHM F;  1JY3 O;  2J0Y A;  1FZE A;  1FZB A;  3H32 C;  3HUS A;  1FZG C;  2J3G A;  2JHK F;  2Q9I C;  2FFD B;  2HPC A;  1LTJ C;  2HOD C;  2OYI B;  2XNX A;  2OYH C;  1JY2 N;  1FZB B;  1FZE B;  3HUS B;  1FZA B;  2HLO C;  2JHI F;  2J3F A;  4R9J A;  1LT9 A;  2H43 A;  1N73 A;  2A45 H;  2J0H A;  1RE3 A;  1M1J C;  1N86 A;  4R9T A;  1LWU A;  3GHG A;  2J2P A;  2GY7 A;  1LT9 B;  2Z4E C;  2JHL F;  2J3F D;  1N73 B;  2H43 B;  3BVH C;  1RF0 A;  3E1I B;  1RE3 B;  2Q9I A;  2A45 I;  1N86 B;  1JY2 O;  1RE4 A;  2FIB A;  3FIB A;  4JZC A;  2FFD C;  1RF0 B;  1FZC A;  2HPC B;  2OYI C;  1FZE C;  1FZB C;  1Z3U A;  2XNX B;  3HUS C;  4NYT A;  1JY3 P;  1FZA C;  1FZF A;  1RE4 B;  1FID A;  2J5Z A;  1RF1 C;  1FZD A;  2J64 A;  1FZC B;  4M7F A;  2J3U A;  2J3O A;  4ZFG A;  3H32 A;  1FZF B;  1FZG A;  4M7H A;  1LWU B;  2HOD A;  1LTJ A;  1FIC A;  3GHG B;  1LT9 C;  1N73 C;  2J60 A;  2OYH A;  3H32 B;  3E1I C;  1RE3 C;  2HLO A;  1FZG B;  2A45 G;  1N86 C;  2Q9I B;  2WNP F;  2HOD B;  1LTJ B;  2OYI A;  2J0G A;  1JY3 N;  1FZA A;  1RF0 C;  2OYH B;  1T3U A;  2HPC C;  2J61 A;  2HLO B;  1M1J A;  1RF1 A;  2XNX C;  1FIB A;  1RE4 C;  1JY2 P;  1Z3S A;  1W2E A;  2Z4E A;  3BVH A;  1FZC C;  4EPU A;  2D39 A;  2J61 B;  1M1J B;  2J1G A;  1RF1 B;  4JYO X;  2H43 C;  1FZF C;  2Z4E B;  2JHH C;  2FFD A; 
#chains in the Genus database with same CATH topology
 1AQ5 A;  2M3B A;  3OW2 O;  3GW6 A;  3KQG A;  3H32 C;  3B5N D;  3CI9 A;  4AUW A;  2JHK F;  1Y9B A;  1AFO A;  5CBN A;  3JCU E;  1DX7 A;  1X0T A;  2POH A;  2P67 A;  4N6J A;  1NTZ E;  1WT6 A;  1ZLL A;  1Q81 Q;  4NPF X;  2JR8 A;  3VP8 A;  1SQX K;  1QL1 A;  2J58 A;  3C9I A;  4N78 E;  5K5G B;  1QEX A;  2Z4E C;  4IL6 H;  4K3A A;  2Q3I A;  1SQV G;  3E1I B;  1NU1 E;  1RE4 A;  2YXQ B;  2YIU C;  1PPJ D;  1L0N D;  4HJG H;  1SQB J;  1EDL A;  5KAF H;  1RE4 B;  2W90 A;  1GL2 D;  1NKN A;  3RK2 D;  1NGM B;  1FZD A;  1J1E B;  2XV5 A;  1YQ4 C;  2K9Y A;  2WTY A;  2WSE J;  3L75 D;  1HH0 A;  1SQX E;  2OGU A;  3MP7 B;  3G6E P;  5KJ7 A;  2J61 A;  2B88 A;  1SQP D;  3PH0 A;  2WSE H;  3MIW A;  4H0L D;  2J61 B;  3IN6 A;  1URQ A;  5CCG D;  1AV1 A;  2QEX P;  1JC9 A;  5KLI C;  3VMX A;  1IO4 A;  1FZB A;  2G8Y A;  2E74 B;  2KNC A;  1URQ B;  3VMZ A;  3H1L G;  1PGP A;  2IDB A;  3CXH D;  1LTJ C;  3AEB C;  2HPC A;  4U3F J;  1FZB B;  3H1I E;  5APV A;  2E43 A;  3MZW B;  1KIL C;  1NTK D;  3H6P A;  2IBZ G;  5DJT B;  2H43 A;  2A45 H;  3MHV A;  1VQ6 P;  1N86 A;  2XU6 A;  2GM4 A;  4C46 A;  4Y28 J;  4DJG A;  1L0L K;  2H43 B;  3RL0 D;  1OZH A;  1BGY E;  1N86 B;  3A0H E;  2O1J A;  3P32 A;  3H1H G;  2FIB A;  1FDM A;  4GOD A;  1ZR4 A;  1QVF O;  1NTZ J;  1X8Y A;  1G2C A;  5L8R J;  3ITK A;  3AEF C;  2P1J A;  3RBZ A;  1ZV8 A;  1G2C B;  4ZFG A;  3JCU H;  1S1C X;  3TYY A;  2R3C A;  3SFD C;  4L74 A;  1NTM D;  5CHX A;  3WMM 0;  1T6A A;  1NU1 J;  1PGQ A;  2RN0 A;  2W83 C;  3G9R A;  1RE3 C;  3CX5 I;  3BAT A;  3HD7 A;  2FYN B;  3AE1 C;  1OIP A;  3AE4 C;  1FZA A;  1FBM A;  3GG2 A;  1T3U A;  1SS1 A;  3CL3 D;  3Q5R A;  1T2K D;  1MFT A;  1OW8 A;  3HD7 B;  1JY2 P;  3AE2 C;  3RK3 D;  2IBZ I;  2QM8 A;  2M3E A;  2Y0D A;  3P7K A;  4EPU A;  1NAY A;  1PPJ G;  1L0N G;  1FZF C;  5KLV K;  1M1K Q;  3D6Y A;  1GW4 A;  3Q5S A;  1SQX J;  2AEM A;  5KAI H;  1K73 Q;  2K88 A;  1FZG C;  3OJA B;  3I55 P;  2KZJ A;  2OTJ P;  1PGO A;  3L73 E;  2E75 B;  2XND H;  3L75 G;  2HLO C;  3H1H E;  3PRJ A;  1LT9 A;  1A02 F;  1KQS O;  3I5C A;  1IFJ A;  1ZRT E;  2YKQ A;  2Y0E A;  3A3Y B;  1FC2 C;  5APX A;  1SQP G;  1LT9 B;  3AE3 C;  4AQR D;  3FWN A;  2FKW B;  3BAS A;  5KLV E;  1JMB A;  5TJH A;  2LXB A;  3H1I J;  4D6T E;  1NAF A;  1GU5 A;  1KB9 E;  2OTL P;  1SQP K;  2B87 A;  4M7H A;  2R32 A;  1MKM A;  3FGA D;  1R8E A;  1BGY J;  1NTK G;  3KYQ A;  1MZ9 A;  2IFN A;  4JPZ B;  2A06 E;  3FXD A;  3CC7 P;  1LP1 B;  4I7Z B;  1FIB A;  3L70 D;  3L71 E;  3A0H H;  3BVH A;  2DW3 A;  2Q1K A;  4B86 A;  2J1G A;  1D7M A;  1NTK K;  1VQ8 P;  2KIK A;  3BVH B;  3W68 A;  4W80 A;  1FZE A;  3HUS A;  3Q1M A;  1S9K D;  2G3A A;  1SQP E;  3BCC E;  5AW2 B;  3P8M C;  1NTM G;  1L0L J;  1FZE B;  2WPS A;  3HUS B;  2JHI F;  4R9J A;  2I1K A;  1Q82 Q;  4OVN F;  3CXH I;  3M9H A;  2AEF A;  1QGK B;  1BSH A;  1HVV A;  2JHL F;  2AXT E;  3CXH E;  3O8Z A;  1Q7Y Q;  1CZQ A;  1VQ4 P;  1G1J A;  3U1A A;  4BWN A;  1K9M Q;  1JCD A;  3L73 J;  2Z5H A;  1NTK E;  4H44 D;  3LIE A;  3V5B A;  3TDK A;  1OVU A;  3B5N C;  4Z1M H;  4WWI A;  3G71 P;  1LWU B;  2QSI A;  2RKL A;  2J60 A;  2BCC D;  1BCC D;  1IFD A;  4OWF A;  1VPC A;  5APS A;  3CCE P;  3A2A A;  5KLV J;  1USE A;  4WY4 D;  1JY3 N;  1M57 D;  4OGQ B;  2W6A A;  5APY A;  3H25 A;  2QJY B;  4D6T J;  2M5A A;  2H8P D;  5AVZ B;  2GUV A;  1KFM A;  1T8Z A;  3CCJ P;  2M5A B;  2FFD A;  2FYU D;  1FOS E;  3MTU E;  3CWB D;  1N7S D;  4IFF A;  2P7J A;  1KB9 H;  3AE6 C;  1KTM A;  2Q9I C;  3TSI A;  2FFD B;  1GL2 C;  3RK2 C;  3G3Z A;  2N1T D;  1IFN A;  3H1K D;  4UB6 E;  2WPQ A;  1IK9 A;  3L71 J;  1JUN A;  3L74 E;  1LNQ A;  1VQO P;  2K9J A;  5CCH D;  2WSF J;  2HR3 A;  1LTA C;  2BAS A;  1U7J A;  2ZYG A;  3MD0 A;  5KAF E;  1AJY A;  1H8A A;  4ASW A;  2K9J B;  1S72 P;  1VQ9 P;  2PRR A;  3L70 G;  4L73 A;  4L76 A;  1IC2 A;  1JY2 O;  4K35 A;  1SQP J;  2ZJS E;  3BCC J;  3FIB A;  2Y9Y A;  4H0L C;  2OYI C;  1Z3U A;  5CCG C;  1HJ0 A;  4O9B A;  1X22 A;  1QL2 A;  3JC2 2;  2YXR B;  2D2C D;  1N73 C;  2JO1 A;  2WSC J;  2ITA A;  1S4X A;  2Y9Z A;  2WNP F;  3U59 A;  4M3L A;  1NTK J;  1DD4 A;  3H1J D;  2AXT H;  3CXH H;  3VMY A;  4EIJ A;  4GT1 A;  4GIF A;  4WVZ A;  3RL0 C;  3D71 A;  4AYC A;  2WSS H;  3K5B A;  2CPB A;  3GHG C;  2JDI H;  3I56 P;  1AA0 A;  4CPG A;  1AVO A;  3SWY A;  4HKZ H;  1PP9 D;  1Z56 A;  2E76 B;  1PZQ A;  1RH5 B;  3AED C;  2QRX A;  3AE5 C;  1NOH A;  1KIL E;  2BCC G;  1BCC G;  2Q6Q A;  2YKO A;  1PGJ A;  4JBZ A;  2WWW A;  4C7N A;  2J3F D;  1RY3 A;  1WMK A;  1RF0 A;  4C7N B;  3UIA A;  1T2K C;  3AEG C;  5AW3 B;  3RK3 C;  3AEE C;  1RF0 B;  1FJK A;  2FYU G;  3L72 E;  4RJT A;  3CWB G;  3L74 J;  1L4A A;  2ZT9 B;  3H1K G;  3SWF A;  2WVR A;  2ZYD A;  4UB6 H;  1YQ3 C;  2IYO A;  2L91 A;  1L4A B;  1IFI A;  2FYU K;  1UII A;  2KLU A;  2KS1 A;  1MUU A;  2O01 J;  1RQU A;  5KAI E;  1N8R Q;  1M1J A;  1PV3 A;  2E74 D;  3TK1 A;  1URQ D;  2KS1 B;  1VF5 B;  3BRV B;  1SQV K;  1YBK A;  4WBA A;  1HTL C;  1M1J B;  2RH0 A;  4LGD E;  2O01 H;  1EDK A;  2FBW C;  2W6J H;  2YMK A;  2O1K A;  3F89 A;  2WQY C;  2KSE A;  2J3G A;  2JWD A;  1SFC C;  2ZVO B;  2E42 A;  5B66 E;  4EYY Q;  1OMI A;  3CCR P;  1MFZ A;  2QE7 H;  4PV1 D;  5B5E E;  3G4S P;  2FYU E;  1DIP A;  1EZV D;  4PJ0 E;  3CWB E;  2QJP C;  3H1J G;  1N2D C;  1YIT P;  2GY7 A;  3TGU D;  2N9B A;  2Q9I A;  3H1K E;  1KYO D;  1GL2 A;  1SQV E;  3JSV C;  3GF7 A;  2KNC B;  4ZMD A;  2AEJ A;  3C1L A;  2JKV A;  5AVQ B;  1FZC A;  2HPC B;  2CPS A;  3D70 A;  3M0D C;  3V2Q A;  3B4S A;  3HE5 A;  2KK7 A;  2J64 A;  1PP9 G;  1FZC B;  1CI6 A;  3CD6 P;  3CME P;  3AE7 C;  2QM7 A;  3HE5 B;  1R5L A;  2I1J A;  4Y99 B;  1NH4 A;  1X79 B;  3HTK A;  1CI6 B;  3P8C D;  2WZ7 A;  1S5L E;  2XKM A;  4ZKP A;  2OYI A;  3HTK B;  4HH2 A;  1IFM A;  2H7H A;  3L72 J;  2QJK B;  2KZI A;  2XNX C;  3R4Y A;  2AXC A;  5KKZ C;  1JO5 A;  2E75 D;  1GK6 A;  3MUD C;  1XTG B;  2KXP B;  4H44 C;  1HUC A;  2Q5U A;  2PFX A;  5BVZ A;  4IL6 X;  5E79 E;  1KD1 Q;  1HWT C;  3CX5 E;  4RES B;  2HOD C;  3H1L E;  3S1K A;  2OYH C;  1FZA B;  1NVO A;  1SQQ D;  1TU3 F;  3USS A;  3AE9 C;  2FXM A;  2IBZ E;  2KP8 A;  4EDF A;  3GHG A;  2NPS A;  4H13 B;  2I8D A;  4WY4 C;  4KHX A;  3F5H A;  4GOE A;  2B89 A;  3VP9 A;  1J1D C;  4JZC A;  1VQM P;  2NPS B;  1DEB A;  1L0N K;  5H2F E;  1JM0 A;  1YJW P;  1RF1 C;  2FYU J;  3CWB J;  1FAV A;  3SFE C;  3H32 A;  1N7S C;  5B66 H;  2VRS A;  1ZP0 C;  1GZL A;  1FIC A;  2N1T C;  3N4X A;  3H1K J;  5B5E H;  1SQV J;  3H32 B;  1LTS C;  1EZV G;  1LTI C;  3EQ2 A;  1Q86 Q;  3TF5 A;  4PJ0 H;  1MV8 A;  1QVG O;  5CCH C;  3S4R A;  1SFC D;  3TGU G;  1GDT A;  2Z4E A;  3NMD A;  5CBO A;  2C9N Y;  3WUT A;  2P58 A;  1PPJ E;  1L0N E;  2B87 B;  2Z4E B;  4YXW H;  1ZOY C;  1K05 A;  5APU A;  2OTK E;  1E5W A;  3B71 A;  1EDI A;  4PD4 D;  1NHL A;  1H89 A;  3VMA A;  2YIU B;  1LGH B;  3SWK A;  1LTT C;  1IJD B;  1QLE D;  3L75 E;  3CCV P;  1DD3 A;  2D2C C;  1VQ7 P;  1EXI A;  3GLM A;  1S5L H;  2J0H A;  2CK3 H;  3IR9 A;  1VDF A;  4U3F D;  2OAR A;  3VOP A;  1EXJ A;  1EZV I;  4DCK A;  1YTZ T;  3H1L J;  2NZ2 A;  1FOS F;  1PFI A;  1KYO I;  3A5T A;  2QVA A;  5E79 H;  1BDC A;  3CX5 H;  4EI2 A;  1T3J A;  2J3O A;  1Q90 D;  1FDO A;  3TGU E;  1M56 D;  4OGQ D;  1WRG A;  3ABV C;  1LTJ A;  1NTZ D;  1NTM K;  1ZN5 A;  3E7K A;  3M06 A;  5KLI B;  1SQQ G;  5AVU B;  3E1I C;  5M1B A;  1LTJ B;  3H1H J;  4N78 D;  1KIL A;  1GK4 A;  3M0D A;  2R5B A;  4I2L C;  4EOT A;  2LKM A;  3V4Q A;  4A7P A;  2K37 A;  1RE4 C;  1OW6 A;  1NU1 D;  1KIL B;  1W2E A;  2MKV A;  3Q3D A;  1J1E C;  3L36 A;  1SQQ K;  3P8C E;  4JF7 A;  2JWA A;  5H2F H;  3T97 A;  2JHH C;  1KQF B;  1HBW A;  3OA7 A;  3SSU A;  1VL2 A;  1M90 Q;  1W5C E;  1G1I A;  3T97 B;  1IZN B;  4RO0 A;  2XNX A;  1NTM E;  1X9V A;  1XTC C;  1SQX D;  3KHU A;  3CCU P;  1LT1 A;  5AW6 B;  4DOJ A;  1LJ2 A;  1RE3 A;  1L0N J;  4IFM A;  1YIJ P;  3CCL P;  1RE3 B;  3RK3 E;  1KC8 Q;  2E74 C;  1URQ C;  5AW5 B;  1KZU B;  1SQQ E;  5EFW B;  2LXC B;  1FZB C;  4RKU J;  3L75 J;  1JY3 P;  1FZF A;  4NPE A;  3RGU A;  3CCS P;  4KJM A;  1FZF B;  1FZG A;  1FU1 A;  1JTH A;  3BRT B;  1E79 H;  3H1I D;  3HE4 A;  1JOC A;  3NFQ A;  2HLO A;  1FZG B;  2A45 G;  1N86 C;  4PV1 C;  1GU4 A;  1JTH B;  2J0G A;  4U3F G;  3HE4 B;  2BEZ F;  2HLO B;  2JJL A;  1RQV A;  1RF1 A;  3GMA A;  1BGY D;  2E76 D;  4QMA A;  1OX3 A;  1RF1 B;  2IYP A;  1GTW A;  1ZR2 A;  2N1T A;  3CPW O;  1H0T A;  2RMZ A;  3RL0 g;  5GTI E;  3TNU A;  5CCH A;  2GA1 A;  4ZNC A;  2FYN C;  1H0T B;  3V2R A;  1KYO H;  1L2P A;  1LTG C;  1NO4 A;  1NTZ G;  4BRY A;  2BEQ D;  2FYZ A;  4PD4 I;  2OQQ A;  2GUS A;  2H89 C;  3M0A A;  3PHL A;  4BRY B;  2LR2 A;  2YO2 A;  4R9T A;  1IFP A;  1L0L D;  4IFD K;  1ZXG A;  1NU1 G;  2KUB A;  1NJI Q;  1JNM A;  2WT7 A;  1VQ5 P;  3L70 E;  2A45 I;  2ZT9 D;  3S9O A;  3R2P A;  1Y8A A;  1NTM J;  2WT7 B;  2E75 C;  5BU8 B;  1FID A;  3NTN A;  1S9K E;  1BE3 D;  4M7F A;  1K04 A;  4UB8 H;  1HGZ A;  3L73 D;  3CCM P;  1AQT A;  5DJU B;  1KV4 A;  1P84 D;  1VF5 D;  1LT9 C;  2YO3 A;  1SQX G;  5AVS B;  5GTH H;  3E1R A;  1RHZ B;  1ZRT D;  1SQQ J;  1KN7 A;  3LW5 J;  1ZW0 A;  3A0B E;  2ZFC A;  1USD A;  5KJ7 D;  5AVX B;  4TLF A;  5KLV D;  3II6 A;  1K8A Q;  1CW5 A;  4KT0 J;  3E1I A;  1SVF A;  2YKP A;  2J0Y A;  4D6T D;  3M9B A;  3CCQ P;  3WUV A;  3C8V A;  3LW5 H;  1KB9 D;  3KZI E;  1OFC X;  3H1I G;  5AVW B;  3B5N A;  4I7Z C;  2J3F A;  2BCC E;  1BCC E;  1JMM A;  3V6I A;  3B5N B;  2A06 D;  1SLQ A;  2KOG A;  2W27 A;  3BVH C;  1BGY G;  3L71 D;  4I6M C;  4N3Y B;  1PIX A;  1VQL P;  1AVY A;  1FZE C;  5AVY B;  2E5T A;  3HUS C;  3WUU A;  3WU2 H;  1FDI A;  5GTI H;  3Q2Y A;  2J3U A;  3BCC D;  1SP4 A;  1S3J A;  4HYT B;  2Q7C A;  4ASV A;  3L70 J;  3L4F A;  3D6Z A;  1VQK P;  2Q9I B;  1GL2 B;  3RK2 B;  2W8Z A;  1VQP P;  1L0L G;  5CMZ A;  4PD4 H;  1EDJ A;  1EQ7 A;  1FE6 A;  3HD7 D;  3N7N A;  3IFM A;  4YTP C;  4YXD C;  1LWU C;  2QA4 P;  2K3R A;  2Y0C A;  1JY3 O;  1BE3 G;  5CCG A;  3L73 G;  4H0L B;  2C9L Y;  5AW9 B;  2OYI B;  4PV1 B;  4H13 D;  3RBX A;  2P10 A;  1EC5 A;  3HRN A;  1JY2 N;  4OGQ C;  3Q5P A;  2M0B A;  2WMM A;  3QH9 A;  5CJ0 A;  3CMA P;  2QJY C;  1YTZ I;  1KMI Z;  3KDP B;  2NPS D;  2SPZ A;  1N73 A;  1KQG B;  1LTB C;  3KXD A;  3H1J E;  1N73 B;  1KOR A;  4I1L A;  4NPD A;  3A0B H;  5TIS E;  5KLV G;  2FFD C;  3QWO C;  1GD2 E;  5APT A;  3B8E B;  4JYB A;  4XE5 B;  2BCC J;  4D6T G;  1BCC J;  2KYV A;  1YYC A;  1L0L E;  1R5S A;  3RL0 B;  5AVV B;  4TT3 H;  1PP9 E;  1JCC A;  3AEC C;  3KZI H;  2ZAE B;  1GMJ A;  1OVR A;  3V2P A;  3VN0 A;  3GHG B;  2O3J A;  3L74 D;  1YI2 P;  3IF4 A;  2ZYA A;  2A06 G;  1S2E A;  1P84 I;  5AVT B;  4JYC A;  1BE3 E;  1OWA A;  2P2U A;  2W6B A;  1YHQ P;  2J5U A;  1GW3 A;  3L71 G;  4XA4 A;  4JQ0 D;  1NYH A;  1P84 E;  1BDD A;  2JEE A;  2KLV A;  4DT0 A;  1M7L A;  5AW0 B;  4GOF A;  1SQB D;  2QIW A;  1DEE G;  2JHM F;  3BCC G;  3RK3 B;  2XDJ A;  1OW7 A;  5AW4 B;  5AW8 B;  2V4H A;  1KB9 I;  3EFG A;  1FJP A;  2OYO A;  2C0W A;  4OH8 B;  3AEA C;  3ZDM A;  2J2P A;  2IZ0 A;  3IAO A;  5BU5 A;  2Z5I A;  2V7Q J;  4XFJ A;  1OXZ A;  1NKZ B;  2E76 C;  1KQL A;  2PGD A;  1LP1 A;  4GDO A;  3GF3 A;  2KSJ A;  1FS0 E;  2IFM A;  2V7Q H;  2XZR A;  1BSN A;  1HF9 A;  2ZXE B;  3H1J J;  1YJN P;  3PP5 A;  1KIL D;  4DZO A;  2WPV B;  1SFC A;  2JP3 A;  1IK7 A;  2HFE D;  1J2J B;  1VQN P;  4R4L A;  5KTB A;  3FWL A;  1EZV E;  4YPC A;  2K1A A;  1N7L A;  1SFC B;  2M8R A;  1RF0 C;  3PTZ A;  2O01 N;  4MN4 C;  1NWQ A;  2E5Y A;  1KYO E;  3PLN A;  1PP9 J;  2PAJ A;  5TIS H;  2D39 A;  2ZT9 C;  2QJP B;  2KB7 P;  3CC4 P;  2YMY A;  3L72 D;  1L4A C;  5APQ A;  1BE3 J;  4HB1 A;  3EWK A;  2MJZ A;  2R5D A;  4C7R A;  5APW A;  3L74 G;  1VF5 C;  1M8O B;  3OAK A;  1PL5 A;  1M1J C;  2PP6 A;  1LWU A;  2IZ1 A;  2WPR A;  2IPP A;  4UB8 E;  4U7J A;  1P84 H;  1Y47 A;  2R3S A;  1SQB G;  5KJ7 C;  2XNX B;  5GTH E;  1CSB A;  4R4M A;  5C39 A;  5KKZ B;  3MUD A;  3U1C A;  3O6Q A;  2HOD A;  1OVV A;  4H44 B;  1SQB K;  2OYH A;  3O6Q B;  2Q3E A;  2QG4 A;  2HOD B;  1Q2N A;  3PJS K;  2OYH B;  2IX7 C;  2HPC C;  1UIX A;  4IL6 E;  2WIT A;  1Z3S A;  1H88 A;  1JB0 J;  1SQV D;  4WY4 A;  1FZC C;  1HGV A;  4JYO X;  2H43 C;  3M9Q A;  1S5L X;  4WY4 B;  4Y99 C;  3CC2 P;  3M91 A;  1KFN A;  1J1D B;  1W2B O;  2FY8 A;  1U57 A;  1A02 J;  2KI7 B;  2QJK C;  1N7S A;  2C0X A;  3V4W A;  2H88 C;  2WSF H;  3TGU J;  1SQB E;  3VYI A;  1ZME C;  4ZKU A;  1N7S B;  2UWJ E;  3WU2 E;  2N1T B;  4W7Y A;  3NXS A;  2ZXX A;  1U7M A;  1JEK A;  1YJ9 P;  4IOI H;  1HJB A;  3TNU B;  3HD7 C;  3L72 G;  3KPE A;  4NYT A;  1FZA C;  2J5Z A;  2R44 A;  3VTP C;  3LID A;  4W7Z A;  2ZVN B;  1QX8 A;  3W67 A;  4PD4 E;  4LC1 A;  3CX5 D;  5AW7 B;  3H1L D;  2WSC H;  2N9Y B;  2FXO A;  5CJ4 A;  2L5G B;  5AW1 B;  1NTZ K;  2J59 M;  4H13 C;  4LLH A;  3L37 A;  3AE8 C;  1L4A D;  2IBZ D;  2FXP A;  5AVR B;  3EFF K;  3L35 A;  2NPS C;  3MGN A;  2YNY A;  3CLQ A;  4U3F E;  2HG5 D;  3FX0 A;  4GKG A;  2D2C B;  1NU1 K;  2B9B A;  2NRG A;  4BXL A;  3V2N A;  3FXE A;  3H1H D;  1DH3 A;  3A7O A;  4WB4 A;  4L75 A;  2HYN A; 
#chains in the Genus database with same CATH homology
 1AQ5 A;  1LWU C;  2M3B A;  1FOS E;  1JY3 O;  3MTU E;  5APU A;  1E5W A;  3KQG A;  3H32 C;  1N7S D;  3B5N D;  4IFF A;  2P7J A;  3CI9 A;  5CCG A;  4AUW A;  1NHL A;  1H89 A;  3TSI A;  2JHK F;  2FFD B;  1AFO A;  1GL2 C;  2Q9I C;  3RK2 C;  3G3Z A;  2C9L Y;  5AW9 B;  2N1T D;  1LGH B;  2OYI B;  1DX7 A;  2POH A;  2P67 A;  1IFN A;  3HRN A;  1JY2 N;  4N6J A;  1LTT C;  2WPQ A;  1IJD B;  1IK9 A;  1WT6 A;  1ZLL A;  5CJ0 A;  1JUN A;  1YTZ I;  3KDP B;  3VP8 A;  1SQX K;  2NPS D;  5CCH D;  1N73 A;  1QL1 A;  2J58 A;  3C9I A;  2J0H A;  1LTB C;  4N78 E;  1LTA C;  2BAS A;  3MD0 A;  3IR9 A;  1VDF A;  1H8A A;  2OAR A;  2Z4E C;  1N73 B;  2Q3I A;  4I1L A;  1IC2 A;  3VOP A;  3E1I B;  1JY2 O;  1RE4 A;  1YTZ T;  3FIB A;  2FFD C;  1FOS F;  5APT A;  1GD2 E;  1PFI A;  3B8E B;  4JYB A;  4XE5 B;  2OYI C;  1Z3U A;  3A5T A;  1RE4 B;  5CCG C;  1GL2 D;  1NKN A;  2KYV A;  1YYC A;  3RK2 D;  3RL0 B;  1FZD A;  5AVV B;  1T3J A;  4O9B A;  2J3O A;  1JCC A;  1J1E B;  2FFD A;  2XV5 A;  1WRG A;  3V2P A;  1QL2 A;  1LTJ A;  3VN0 A;  1NTM K;  1ZN5 A;  3GHG B;  3M06 A;  2WTY A;  1N73 C;  1HH0 A;  5AVU B;  3E1I C;  2WNP F;  3U59 A;  1LTJ B;  4N78 D;  4M3L A;  1KIL A;  5KJ7 A;  5AVT B;  1GK4 A;  3M0D A;  2R5B A;  4I2L C;  4JYC A;  4EOT A;  1OWA A;  2P2U A;  2J61 A;  2LKM A;  2W6B A;  3V4Q A;  3VMY A;  1GW3 A;  4XA4 A;  2WSE H;  1RE4 C;  4EIJ A;  1KIL B;  3MIW A;  1W2E A;  4GIF A;  4GT1 A;  2JEE A;  3RL0 C;  2KLV A;  1M7L A;  5AW0 B;  2J61 B;  4AYC A;  1J1E C;  3L36 A;  1SQQ K;  1URQ A;  3P8C E;  4JF7 A;  5CCG D;  3T97 A;  2CPB A;  2JHH C;  1JC9 A;  1HBW A;  3OA7 A;  3GHG C;  2JHM F;  3VMX A;  1IO4 A;  1FZB A;  1URQ B;  3VMZ A;  3SWY A;  1G1I A;  1Z56 A;  3RK3 B;  2XDJ A;  2HPC A;  1LTJ C;  2XNX A;  1FZB B;  5AW4 B;  1NOH A;  5AW8 B;  5APV A;  1X9V A;  2E43 A;  1XTC C;  1KIL C;  3H6P A;  3EFG A;  2H43 A;  1FJP A;  2A45 H;  2YKO A;  2C0W A;  5AW6 B;  4DOJ A;  2WWW A;  1RE3 A;  4C7N A;  1N86 A;  2XU6 A;  4OH8 B;  4IFM A;  4C46 A;  2GM4 A;  2J2P A;  1L0L K;  2J3F D;  2H43 B;  1RY3 A;  3RL0 D;  1RF0 A;  5BU5 A;  2Z5I A;  1RE3 B;  4C7N B;  3UIA A;  1T2K C;  1N86 B;  2O1J A;  3P32 A;  1URQ C;  1OXZ A;  2FIB A;  1NKZ B;  5AW5 B;  1FDM A;  1KQL A;  5AW3 B;  3RK3 C;  1KZU B;  1ZR4 A;  1RF0 B;  1FJK A;  2KSJ A;  1X8Y A;  1FZB C;  1G2C A;  1JY3 P;  1FZF A;  2IFM A;  2P1J A;  2XZR A;  1L4A A;  1ZV8 A;  1G2C B;  4ZFG A;  1FZF B;  1FZG A;  1FU1 A;  2ZXE B;  3TYY A;  2R3C A;  3SWF A;  3PP5 A;  1JTH A;  3BRT B;  1KIL D;  4DZO A;  1SFC A;  5CHX A;  1L4A B;  3WMM 0;  3HE4 A;  1JOC A;  2HFE D;  3NFQ A;  1RE3 C;  2HLO A;  1IFI A;  1FZG B;  2A45 G;  1N86 C;  1J2J B;  2FYU K;  3BAT A;  3HD7 A;  1GU4 A;  5KTB A;  1JTH B;  2J0G A;  1MUU A;  1N7L A;  1SFC B;  2M8R A;  3HE4 B;  1FZA A;  1RF0 C;  1FBM A;  1T3U A;  3CL3 D;  2JJL A;  1M1J A;  1T2K D;  2HLO B;  1NWQ A;  1RF1 A;  3HD7 B;  3TK1 A;  1URQ D;  1JY2 P;  3RK3 D;  2QM8 A;  3BRV B;  1SQV K;  4WBA A;  3P7K A;  2PAJ A;  4EPU A;  2D39 A;  1HTL C;  1M1J B;  1RF1 B;  1GTW A;  4LGD E;  1ZR2 A;  2O01 H;  1FZF C;  5KLV K;  2KB7 P;  2N1T A;  2YMY A;  1GW4 A;  2O1K A;  1L4A C;  5APQ A;  3TNU A;  1FZG C;  5CCH A;  2J3G A;  3OJA B;  3V2R A;  1LTG C;  1SFC C;  1NO4 A;  2E42 A;  2MJZ A;  2R5D A;  4C7R A;  2HLO C;  1MFZ A;  5APW A;  2FYZ A;  2GUS A;  1LT9 A;  1A02 F;  3OAK A;  3M0A A;  3I5C A;  1IFJ A;  2YO2 A;  1M1J C;  2YKQ A;  2PP6 A;  4R9T A;  1LWU A;  3A3Y B;  5APX A;  4IFD K;  1N2D C;  2IPP A;  2WPR A;  2GY7 A;  1LT9 B;  1JNM A;  2N9B A;  2WT7 A;  2A45 I;  2Q9I A;  1GL2 A;  3R2P A;  4AQR D;  2FKW B;  3BAS A;  5AVQ B;  1FZC A;  2HPC B;  2WT7 B;  2CPS A;  5KJ7 C;  2XNX B;  3M0D C;  1CSB A;  5BU8 B;  3V2Q A;  1FID A;  3HE5 A;  3NTN A;  3MUD A;  2J64 A;  1NAF A;  1GU5 A;  1S9K E;  1FZC B;  4M7F A;  1CI6 A;  3U1C A;  1SQP K;  1HGZ A;  2QM7 A;  4M7H A;  3HE5 B;  2R32 A;  2HOD A;  2I1J A;  4Y99 B;  1NH4 A;  1X79 B;  1LT9 C;  3HTK A;  1CI6 B;  2YO3 A;  1SQB K;  2OYH A;  5AVS B;  3KYQ A;  3P8C D;  2WZ7 A;  1MZ9 A;  2HOD B;  2XKM A;  4ZKP A;  2IFN A;  2OYI A;  3HTK B;  4HH2 A;  1IFM A;  2H7H A;  2OYH B;  2IX7 C;  2HPC C;  2XNX C;  2WIT A;  1FIB A;  1Z3S A;  1H88 A;  4WY4 A;  3BVH A;  1JO5 A;  1FZC C;  2ZFC A;  1HGV A;  4B86 A;  2J1G A;  5KJ7 D;  5AVX B;  4JYO X;  2H43 C;  3M9Q A;  3II6 A;  1CW5 A;  1NTK K;  1GK6 A;  4WY4 B;  3BVH B;  1XTG B;  3E1I A;  4Y99 C;  1SVF A;  2YKP A;  4W80 A;  2J0Y A;  1HUC A;  2Q5U A;  1FZE A;  3M9B A;  3HUS A;  5BVZ A;  1S9K D;  3LW5 H;  3M91 A;  1KFN A;  1J1D B;  1HWT C;  5AW2 B;  4RES B;  2HOD C;  1A02 J;  3P8M C;  2OYH C;  1FZE B;  5AVW B;  2WPS A;  3HUS B;  1N7S A;  2C0X A;  3B5N A;  3V4W A;  1FZA B;  2JHI F;  2WSF H;  2J3F A;  3VYI A;  1JMM A;  4R9J A;  2I1K A;  4ZKU A;  2FXM A;  1N7S B;  3B5N B;  2KP8 A;  1SLQ A;  3M9H A;  2KOG A;  3GHG A;  1HVV A;  2N1T B;  2W27 A;  2NPS A;  4WY4 C;  3O8Z A;  2JHL F;  3BVH C;  4KHX A;  1CZQ A;  4W7Y A;  3NXS A;  4I6M C;  1G1J A;  3U1A A;  4N3Y B;  3VP9 A;  1J1D C;  1HJB A;  1JCD A;  3TNU B;  4JZC A;  2NPS B;  1DEB A;  2Z5H A;  3HD7 C;  3KPE A;  3LIE A;  1L0N K;  1FZE C;  5AVY B;  3HUS C;  4NYT A;  1FZA C;  2J5Z A;  1RF1 C;  3VTP C;  3LID A;  4W7Z A;  3V5B A;  2J3U A;  4LC1 A;  5AW7 B;  1FAV A;  3H32 A;  1N7S C;  3B5N C;  1SP4 A;  2WSC H;  2VRS A;  5CJ4 A;  1LWU B;  1GZL A;  4HYT B;  1FIC A;  2L5G B;  2Q7C A;  5AW1 B;  1NTZ K;  2N1T C;  2J59 M;  3N4X A;  2J60 A;  4LLH A;  1IFD A;  3L37 A;  3H32 B;  1LTS C;  1VPC A;  3L4F A;  1L4A D;  1LTI C;  3EQ2 A;  5APS A;  2Q9I B;  1GL2 B;  3RK2 B;  5AVR B;  3A2A A;  1MV8 A;  3L35 A;  2NPS C;  4WY4 D;  1JY3 N;  5CCH C;  3MGN A;  5CMZ A;  2YNY A;  3CLQ A;  2W6A A;  5APY A;  2HG5 D;  1SFC D;  4GKG A;  1GDT A;  1EQ7 A;  2Z4E A;  1NU1 K;  2H8P D;  5AVZ B;  3HD7 D;  2GUV A;  3NMD A;  1KFM A;  3N7N A;  3IFM A;  1T8Z A;  3V2N A;  2C9N Y;  1DH3 A;  3A7O A;  4WB4 A;  2Z4E B;  2HYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...