3H32C

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
301
structure length
301
Chain Sequence
EASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
total genus 59
structure length 301
sequence length 301
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3h32C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3h32C02
1N73C 2HPCC 1LTJB 2D39A 2HODB 1RF0C 1FZFB 1M1JB 1RF1B 2JHLF 2J3FA 2J5ZA 3H32B 2XNXB 4R9JA 4M7FA 1RE3B 2J64A 2J0HA 2HODC 2HLOB 1LWUB 1M1JC 1FZFC 1FZCC 2JHIF 2J61B 3H32C 2XNXC 1FIBA 1FZGB 1RE3C 1LT9C 2JHHC 4EPUA 2HLOC 2OYHB 1LWUC 3BVHB 4R9TA 2J0YA 2GY7A 1FZCB 3FIBA 3E1IB 2FIBA 1FZGC 2Z4EC 1FZBB 2Q9IC 1LT9B 2OYHC 1FZEC 3BVHC 2J3FD 1N86B 2J61A 3GHGC 2JHKF 3E1IC 4M7HA 1FZBC 2Z4EB 2OYIC 2Q9IB 4JYOX 2H43C 1FZEB 2J3GA 1FICA 1N86C 2J2PA 1Z3SA 2FFDB 4ZFGA 1RE4B 2J60A 4JZCA 2J1GA 2OYIB 2J0GA 2J3UA 2H43B 1FZAB 2FFDC 1RE4C 3HUSB 1FZDA 1Z3UA 1FIDA 2J3OA 1FZAC 2WNPF 4NYTA 1LTJC 1N73B 2HPCB 1JC9A 3HUSC 1RF0B 2JHMF 1RF1C
chains in the Genus database with same CATH superfamily
1N73C 2HPCC 1LTJB 2D39A 2HODB 1RF0C 1FZFB 1M1JB 1RF1B 2JHLF 2J3FA 2J5ZA 3H32B 2XNXB 4R9JA 4M7FA 1RE3B 2J64A 2J0HA 2HODC 2HLOB 1LWUB 1M1JC 1FZFC 1FZCC 2JHIF 2J61B 3H32C 2XNXC 1FIBA 1FZGB 1RE3C 1LT9C 2JHHC 4EPUA 2HLOC 2OYHB 1LWUC 3BVHB 4R9TA 2J0YA 2GY7A 3GHGB 1FZCB 3FIBA 3E1IB 2FIBA 1FZGC 2Z4EC 1FZBB 2Q9IC 1LT9B 2OYHC 1FZEC 3BVHC 2J3FD 1N86B 2J61A 3GHGC 2JHKF 3E1IC 4M7HA 1FZBC 2Z4EB 2OYIC 2Q9IB 4JYOX 2H43C 1FZEB 2J3GA 1FICA 1N86C 2J2PA 1Z3SA 2FFDB 4ZFGA 1RE4B 2J60A 4JZCA 2J1GA 2OYIB 2J0GA 2J3UA 2H43B 1FZAB 2FFDC 1RE4C 3HUSB 1FZDA 1Z3UA 1FIDA 2J3OA 1FZAC 2WNPF 4NYTA 1LTJC 1N73B 2HPCB 1JC9A 3HUSC 1RF0B 2JHMF 1RF1C
chains in the Genus database with same CATH topology
1N73C 2HPCC 1LTJB 2D39A 2HODB 1RF0C 1FZFB 1M1JB 1RF1B 2JHLF 2J3FA 2J5ZA 3H32B 2XNXB 4R9JA 4M7FA 1RE3B 2J64A 2J0HA 2HODC 2HLOB 1LWUB 1M1JC 1FZFC 1FZCC 2JHIF 2J61B 3H32C 2XNXC 1FIBA 1FZGB 1RE3C 1LT9C 2JHHC 4EPUA 2HLOC 2OYHB 1LWUC 3BVHB 4R9TA 2J0YA 2GY7A 1FZCB 3FIBA 3E1IB 2FIBA 1FZGC 2Z4EC 1FZBB 2Q9IC 1LT9B 2OYHC 1FZEC 3BVHC 2J3FD 1N86B 2J61A 3GHGC 2JHKF 3E1IC 4M7HA 1FZBC 2Z4EB 2OYIC 2Q9IB 4JYOX 2H43C 1FZEB 2J3GA 1FICA 1N86C 2J2PA 1Z3SA 2FFDB 4ZFGA 1RE4B 2J60A 4JZCA 2J1GA 2OYIB 2J0GA 2J3UA 2H43B 1FZAB 2FFDC 1RE4C 3HUSB 1FZDA 1Z3UA 1FIDA 2J3OA 1FZAC 2WNPF 4NYTA 1LTJC 1N73B 2HPCB 1JC9A 3HUSC 1RF0B 2JHMF 1RF1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 C;  2HPC C;  1LTJ B;  2D39 A;  2HOD B;  1RF0 C;  1FZF B;  1M1J B;  1RF1 B;  2JHL F;  2J3F A;  2J5Z A;  3H32 B;  2XNX B;  4R9J A;  4M7F A;  1RE3 B;  2J64 A;  2J0H A;  2HOD C;  2HLO B;  1LWU B;  1M1J C;  1FZF C;  1FZC C;  2JHI F;  2J61 B;  3H32 C;  2XNX C;  1FIB A;  1FZG B;  1RE3 C;  1LT9 C;  2JHH C;  4EPU A;  2HLO C;  2OYH B;  1LWU C;  3BVH B;  4R9T A;  2J0Y A;  2GY7 A;  1FZC B;  3FIB A;  3E1I B;  2FIB A;  1FZG C;  2Z4E C;  1FZB B;  2Q9I C;  1LT9 B;  2OYH C;  1FZE C;  3BVH C;  2J3F D;  1N86 B;  2J61 A;  3GHG C;  2JHK F;  3E1I C;  4M7H A;  1FZB C;  2Z4E B;  2OYI C;  2Q9I B;  4JYO X;  2H43 C;  1FZE B;  2J3G A;  1FIC A;  1N86 C;  2J2P A;  1Z3S A;  2FFD B;  4ZFG A;  1RE4 B;  2J60 A;  4JZC A;  2J1G A;  2OYI B;  2J0G A;  2J3U A;  2H43 B;  1FZA B;  2FFD C;  1RE4 C;  3HUS B;  1FZD A;  1Z3U A;  1FID A;  2J3O A;  1FZA C;  2WNP F;  4NYT A;  1LTJ C;  1N73 B;  2HPC B;  1JC9 A;  3HUS C;  1RF0 B;  2JHM F;  1RF1 C; 
#chains in the Genus database with same CATH topology
 1N73 C;  2HPC C;  1LTJ B;  2D39 A;  2HOD B;  1RF0 C;  1FZF B;  1M1J B;  1RF1 B;  2JHL F;  2J3F A;  2J5Z A;  3H32 B;  2XNX B;  4R9J A;  4M7F A;  1RE3 B;  2J64 A;  2J0H A;  2HOD C;  2HLO B;  1LWU B;  1M1J C;  1FZF C;  1FZC C;  2JHI F;  2J61 B;  3H32 C;  2XNX C;  1FIB A;  1FZG B;  1RE3 C;  1LT9 C;  2JHH C;  4EPU A;  2HLO C;  2OYH B;  1LWU C;  3BVH B;  4R9T A;  2J0Y A;  2GY7 A;  3GHG B;  1FZC B;  3FIB A;  3E1I B;  2FIB A;  1FZG C;  2Z4E C;  1FZB B;  2Q9I C;  1LT9 B;  2OYH C;  1FZE C;  3BVH C;  2J3F D;  1N86 B;  2J61 A;  3GHG C;  2JHK F;  3E1I C;  4M7H A;  1FZB C;  2Z4E B;  2OYI C;  2Q9I B;  4JYO X;  2H43 C;  1FZE B;  2J3G A;  1FIC A;  1N86 C;  2J2P A;  1Z3S A;  2FFD B;  4ZFG A;  1RE4 B;  2J60 A;  4JZC A;  2J1G A;  2OYI B;  2J0G A;  2J3U A;  2H43 B;  1FZA B;  2FFD C;  1RE4 C;  3HUS B;  1FZD A;  1Z3U A;  1FID A;  2J3O A;  1FZA C;  2WNP F;  4NYT A;  1LTJ C;  1N73 B;  2HPC B;  1JC9 A;  3HUS C;  1RF0 B;  2JHM F;  1RF1 C; 
#chains in the Genus database with same CATH homology
 1N73 C;  2HPC C;  1LTJ B;  2D39 A;  2HOD B;  1RF0 C;  1FZF B;  1M1J B;  1RF1 B;  2JHL F;  2J3F A;  2J5Z A;  3H32 B;  2XNX B;  4R9J A;  4M7F A;  1RE3 B;  2J64 A;  2J0H A;  2HOD C;  2HLO B;  1LWU B;  1M1J C;  1FZF C;  1FZC C;  2JHI F;  2J61 B;  3H32 C;  2XNX C;  1FIB A;  1FZG B;  1RE3 C;  1LT9 C;  2JHH C;  4EPU A;  2HLO C;  2OYH B;  1LWU C;  3BVH B;  4R9T A;  2J0Y A;  2GY7 A;  1FZC B;  3FIB A;  3E1I B;  2FIB A;  1FZG C;  2Z4E C;  1FZB B;  2Q9I C;  1LT9 B;  2OYH C;  1FZE C;  3BVH C;  2J3F D;  1N86 B;  2J61 A;  3GHG C;  2JHK F;  3E1I C;  4M7H A;  1FZB C;  2Z4E B;  2OYI C;  2Q9I B;  4JYO X;  2H43 C;  1FZE B;  2J3G A;  1FIC A;  1N86 C;  2J2P A;  1Z3S A;  2FFD B;  4ZFG A;  1RE4 B;  2J60 A;  4JZC A;  2J1G A;  2OYI B;  2J0G A;  2J3U A;  2H43 B;  1FZA B;  2FFD C;  1RE4 C;  3HUS B;  1FZD A;  1Z3U A;  1FID A;  2J3O A;  1FZA C;  2WNP F;  4NYT A;  1LTJ C;  1N73 B;  2HPC B;  1JC9 A;  3HUS C;  1RF0 B;  2JHM F;  1RF1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...