3H32C

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
301
structure length
301
Chain Sequence
EASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
total genus 59
structure length 301
sequence length 301
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3h32C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3h32C02
1FZBC 2JHHC 3HUSC 1FZGB 2J3GA 1LT9C 2WNPF 3H32C 2JHIF 3GHGC 2FFDB 1FZBB 3HUSB 2J0YA 1LT9B 4R9JA 1RE3C 3H32B 2OYHC 2HPCC 1LWUC 2H43C 1FIBA 4M7HA 1FICA 1JC9A 1RE3B 4NYTA 2OYHB 2HPCB 1FZFB 1LWUB 2H43B 2J60A 2XNXC 2JHMF 2J2PA 4ZFGA 1FZCC 2XNXB 2J61B 3FIBA 2J3UA 2JHKF 1FZFC 3BVHC 2OYIC 1FZCB 1N86C 1Z3UA 1FZEB 2J0GA 2D39A 3BVHB 1RF1C 4JZCA 2OYIB 1N86B 2GY7A 1LTJC 2HODC 1RF1B 2FIBA 1FZAC 2J64A 2J1GA 1LTJB 2HODB 2HLOC 1RF0C 1M1JC 1FZEC 1N73C 1FZAB 3E1IC 4JYOX 4EPUA 1FIDA 4R9TA 2Q9IC 1RE4C 2HLOB 1RF0B 1M1JB 1N73B 2J3OA 3E1IB 2Q9IB 1RE4B 1FZDA 2Z4EC 4M7FA 2J3FD 2J61A 1Z3SA 2Z4EB 2J5ZA 2J3FA 2J0HA 1FZGC 2JHLF 2FFDC
chains in the Genus database with same CATH superfamily
1FZBC 2JHHC 3HUSC 1FZGB 2J3GA 1LT9C 2WNPF 3H32C 2JHIF 3GHGC 2FFDB 1FZBB 3HUSB 2J0YA 1LT9B 4R9JA 1RE3C 3H32B 2OYHC 3GHGB 2HPCC 1LWUC 2H43C 1FIBA 4M7HA 1FICA 1JC9A 1RE3B 4NYTA 2OYHB 2HPCB 1FZFB 1LWUB 2H43B 2J60A 2XNXC 2JHMF 2J2PA 4ZFGA 1FZCC 2XNXB 2J61B 3FIBA 2J3UA 2JHKF 1FZFC 3BVHC 2OYIC 1FZCB 1N86C 1Z3UA 1FZEB 2J0GA 2D39A 3BVHB 1RF1C 4JZCA 2OYIB 1N86B 2GY7A 1LTJC 2HODC 1RF1B 2FIBA 1FZAC 2J64A 2J1GA 1LTJB 2HODB 2HLOC 1RF0C 1M1JC 1FZEC 1N73C 1FZAB 3E1IC 4JYOX 4EPUA 1FIDA 4R9TA 2Q9IC 1RE4C 2HLOB 1RF0B 1M1JB 1N73B 2J3OA 3E1IB 2Q9IB 1RE4B 1FZDA 2Z4EC 4M7FA 2J3FD 2J61A 1Z3SA 2Z4EB 2J5ZA 2J3FA 2J0HA 1FZGC 2JHLF 2FFDC
chains in the Genus database with same CATH topology
1FZBC 2JHHC 3HUSC 1FZGB 2J3GA 1LT9C 2WNPF 3H32C 2JHIF 3GHGC 2FFDB 1FZBB 3HUSB 2J0YA 1LT9B 4R9JA 1RE3C 3H32B 2OYHC 2HPCC 1LWUC 2H43C 1FIBA 4M7HA 1FICA 1JC9A 1RE3B 4NYTA 2OYHB 2HPCB 1FZFB 1LWUB 2H43B 2J60A 2XNXC 2JHMF 2J2PA 4ZFGA 1FZCC 2XNXB 2J61B 3FIBA 2J3UA 2JHKF 1FZFC 3BVHC 2OYIC 1FZCB 1N86C 1Z3UA 1FZEB 2J0GA 2D39A 3BVHB 1RF1C 4JZCA 2OYIB 1N86B 2GY7A 1LTJC 2HODC 1RF1B 2FIBA 1FZAC 2J64A 2J1GA 1LTJB 2HODB 2HLOC 1RF0C 1M1JC 1FZEC 1N73C 1FZAB 3E1IC 4JYOX 4EPUA 1FIDA 4R9TA 2Q9IC 1RE4C 2HLOB 1RF0B 1M1JB 1N73B 2J3OA 3E1IB 2Q9IB 1RE4B 1FZDA 2Z4EC 4M7FA 2J3FD 2J61A 1Z3SA 2Z4EB 2J5ZA 2J3FA 2J0HA 1FZGC 2JHLF 2FFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZB C;  2JHH C;  3HUS C;  1FZG B;  2J3G A;  1LT9 C;  2WNP F;  3H32 C;  2JHI F;  3GHG C;  2FFD B;  1FZB B;  3HUS B;  2J0Y A;  1LT9 B;  4R9J A;  1RE3 C;  3H32 B;  2OYH C;  2HPC C;  1LWU C;  2H43 C;  1FIB A;  4M7H A;  1FIC A;  1JC9 A;  1RE3 B;  4NYT A;  2OYH B;  2HPC B;  1FZF B;  1LWU B;  2H43 B;  2J60 A;  2XNX C;  2JHM F;  2J2P A;  4ZFG A;  1FZC C;  2XNX B;  2J61 B;  3FIB A;  2J3U A;  2JHK F;  1FZF C;  3BVH C;  2OYI C;  1FZC B;  1N86 C;  1Z3U A;  1FZE B;  2J0G A;  2D39 A;  3BVH B;  1RF1 C;  4JZC A;  2OYI B;  1N86 B;  2GY7 A;  1LTJ C;  2HOD C;  1RF1 B;  2FIB A;  1FZA C;  2J64 A;  2J1G A;  1LTJ B;  2HOD B;  2HLO C;  1RF0 C;  1M1J C;  1FZE C;  1N73 C;  1FZA B;  3E1I C;  4JYO X;  4EPU A;  1FID A;  4R9T A;  2Q9I C;  1RE4 C;  2HLO B;  1RF0 B;  1M1J B;  1N73 B;  2J3O A;  3E1I B;  2Q9I B;  1RE4 B;  1FZD A;  2Z4E C;  4M7F A;  2J3F D;  2J61 A;  1Z3S A;  2Z4E B;  2J5Z A;  2J3F A;  2J0H A;  1FZG C;  2JHL F;  2FFD C; 
#chains in the Genus database with same CATH topology
 1FZB C;  2JHH C;  3HUS C;  1FZG B;  2J3G A;  1LT9 C;  2WNP F;  3H32 C;  2JHI F;  3GHG C;  2FFD B;  1FZB B;  3HUS B;  2J0Y A;  1LT9 B;  4R9J A;  1RE3 C;  3H32 B;  2OYH C;  3GHG B;  2HPC C;  1LWU C;  2H43 C;  1FIB A;  4M7H A;  1FIC A;  1JC9 A;  1RE3 B;  4NYT A;  2OYH B;  2HPC B;  1FZF B;  1LWU B;  2H43 B;  2J60 A;  2XNX C;  2JHM F;  2J2P A;  4ZFG A;  1FZC C;  2XNX B;  2J61 B;  3FIB A;  2J3U A;  2JHK F;  1FZF C;  3BVH C;  2OYI C;  1FZC B;  1N86 C;  1Z3U A;  1FZE B;  2J0G A;  2D39 A;  3BVH B;  1RF1 C;  4JZC A;  2OYI B;  1N86 B;  2GY7 A;  1LTJ C;  2HOD C;  1RF1 B;  2FIB A;  1FZA C;  2J64 A;  2J1G A;  1LTJ B;  2HOD B;  2HLO C;  1RF0 C;  1M1J C;  1FZE C;  1N73 C;  1FZA B;  3E1I C;  4JYO X;  4EPU A;  1FID A;  4R9T A;  2Q9I C;  1RE4 C;  2HLO B;  1RF0 B;  1M1J B;  1N73 B;  2J3O A;  3E1I B;  2Q9I B;  1RE4 B;  1FZD A;  2Z4E C;  4M7F A;  2J3F D;  2J61 A;  1Z3S A;  2Z4E B;  2J5Z A;  2J3F A;  2J0H A;  1FZG C;  2JHL F;  2FFD C; 
#chains in the Genus database with same CATH homology
 1FZB C;  2JHH C;  3HUS C;  1FZG B;  2J3G A;  1LT9 C;  2WNP F;  3H32 C;  2JHI F;  3GHG C;  2FFD B;  1FZB B;  3HUS B;  2J0Y A;  1LT9 B;  4R9J A;  1RE3 C;  3H32 B;  2OYH C;  2HPC C;  1LWU C;  2H43 C;  1FIB A;  4M7H A;  1FIC A;  1JC9 A;  1RE3 B;  4NYT A;  2OYH B;  2HPC B;  1FZF B;  1LWU B;  2H43 B;  2J60 A;  2XNX C;  2JHM F;  2J2P A;  4ZFG A;  1FZC C;  2XNX B;  2J61 B;  3FIB A;  2J3U A;  2JHK F;  1FZF C;  3BVH C;  2OYI C;  1FZC B;  1N86 C;  1Z3U A;  1FZE B;  2J0G A;  2D39 A;  3BVH B;  1RF1 C;  4JZC A;  2OYI B;  1N86 B;  2GY7 A;  1LTJ C;  2HOD C;  1RF1 B;  2FIB A;  1FZA C;  2J64 A;  2J1G A;  1LTJ B;  2HOD B;  2HLO C;  1RF0 C;  1M1J C;  1FZE C;  1N73 C;  1FZA B;  3E1I C;  4JYO X;  4EPU A;  1FID A;  4R9T A;  2Q9I C;  1RE4 C;  2HLO B;  1RF0 B;  1M1J B;  1N73 B;  2J3O A;  3E1I B;  2Q9I B;  1RE4 B;  1FZD A;  2Z4E C;  4M7F A;  2J3F D;  2J61 A;  1Z3S A;  2Z4E B;  2J5Z A;  2J3F A;  2J0H A;  1FZG C;  2JHL F;  2FFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...